2NRUA

Crystal structure of irak-4
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
293
Chain Sequence
RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Crystal structures of IRAK-4 kinase in complex with inhibitors: a serine/threonine kinase with tyrosine as a gatekeeper.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 293
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2nruA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2nruA01
3CR0A 4GJ3A 3NS9A 4L42A 3FMEA 4KNBA 5I9ZA 3EQIA 3QGYA 3FI3A 4YMJA 2IVSA 2CCHA 3CLYA 5DIAA 2XRWA 3OOGA 1XWSA 1CM8A 4JDHA 5ICPA 4FKWA 4FX3A 4RT7A 4IB1A 4AACA 3KVWA 1XKKA 4N0SA 4G6NA 3ZXTA 4CZTA 3FZRA 5DT4A 4Z3VA 5CF8A 2YIYA 3W2QA 3HVCA 5TF9A 4NH1A 3WARA 5FEQA 1OIRA 4GIIA 4ZZNA 5C8NA 3DU8A 5AP5A 3ZO4A 2PZ5A 5HORA 1TVOA 2PVFA 3F9NA 4KSQA 4XOYA 1XH5A 2NO3A 3W18A 2W1HA 3AC5A 3HV5A 2CGXA 4XBRA 3RZBA 3OCTA 3PIZA 4FVPA 4YR8A 2HXQA 2QOIA 3S0OA 1JQHA 2HWOA 1URWA 3ZUVA 5JEBA 3BLHA 3SV0A 3R7IA 5I9WA 3PP0A 5F20A 1F3MC 5F94A 3FPMA 3FMNA 3FYKX 1MQBA 2C6DA 5I4NA 4QO9A 4QYGA 2BKZA 4EH7A 5JZNA 4RWIA 2OJJA 3E8CA 2W7XA 3ZEWA 5JFWA 1U54B 3M2WA 3WILA 5K4IA 1KE8A 1V0BA 3R9OA 1ZMVA 3H0ZA 4X6RA 4CEGA 5M51A 2KULA 2XH5A 3AGMA 4XRJA 3R8UA 1PXIA 3EYGA 2YAAA 5EQYA 5FG8A 5DPVA 1WVWA 3L1SA 4M66A 4D4SA 5EYCA 3UYTA 3QYWA 3OC1A 3QQUA 4AU8A 4CTBA 4R77A 1OZ1A 4L01A 1UU9A 1LEZA 1F0QA 3VC4A 3TM0A 5J1WA 3V5WA 2WKMA 4KB8A 5E92A 4M0YA 3HRFA 3LAUA 2QHNA 3TZ9A 2NNWB 4PRJA 4QQTA 1Q41A 4RX8A 5FLFA 3WIGA 4D0WA 2CKPA 3NCZA 4AG8A 4DTAA 2PUIA 3B8RA 5L2WA 3FC1X 3LFFA 3ORTA 4QYFA 5M53A 5D1JA 2V62A 4MWIA 4ZS4A 3D83A 3VW8A 5I9XA 1T46A 3BHVA 2UVZA 3MSSA 3U4WA 3Q53A 5AUWA 3FLNC 2Z7SA 4L00A 2YM3A 2YN8A 3ZLSA 4OAUC 1M7NA 3GQIA 4Y73A 3CS9A 5JKGA 4A7CA 3NPCA 5E1EA 5HLNA 3DBEA 4XG8A 2WMQA 5BYZA 4UBAA 5EW3A 1IASA 4YBKA 4K6ZA 4FTKA 4C3FA 4BDAA 2BCJA 3JY9A 2BRBA 4HGTA 1U59A 3RPYA 1IR3A 4R5SA 4EWHA 4FKIA 5CZHA 4QTDA 3SLSA 4FTUA 4Q5HA 3EL8A 4I23A 4RIOA 5G6VA 3C5IA 4ORKA 2B7AA 4TT7A 5K0KA 3ZU7A 4EK8A 4FSYA 5KZIA 4ERWA 2XS0A 5D12A 4FF8A 5GHVA 2CGUA 1HOWA 1ZARA 2GNJA 3ZO2A 1WBSA 2WQBA 4RIYA 3DFCB 3OCBA 4ALUA 4AGWA 2ZJWA 3EQGA 2ZDTA 4DEBA 5FTGA 3CSVA 3BGQA 4FKGA 3DXQA 4YHFA 4JBPA 4DH5A 4XP3A 3K5UA 5EW8A 4Y5HA 4GCJA 3R0TA 4JDJA 4RVLA 4BI0A 2CNUA 5EQEA 4EJ7A 3G15A 5HZNA 3RTPA 2HCKA 4FTJA 3OBGA 2C6MA 1GZOA 1BI7A 1OIUA 3D94A 4CVAA 2OXDA 2GHMA 3TACA 4CFMA 4UWYA 4AF3A 4EUUA 4MHAA 2YFXA 1ZYJA 2YAKA 1JOWB 4W4YA 4AZWA 5HG9A 3KC3A 1OKVA 4A9YA 3R21A 2P3GX 5AIRA 2BTSA 4J97A 1ZZ2A 1EH4A 4FKLA 3ZRMA 4S32A 5EOLA 3CKXA 4MWHA 3R8MA 3COKA 4IAKA 1G8SA 2C1AA 3QQKA 3LMIA 1GNGA 3NVMB 5DHJA 4D2PA 3UG2A 5IUGA 4GKIA 3UQFA 5CEIA 2R7BA 5HO6A 4AN2A 1H07A 4LI5A 2WTVA 5LMKC 3DJ5A 3R8VA 3OXIA 3KMMA 1WVXA 2CKEA 3LMGA 4FZ7A 4HGSA 2GS2A 4EH8A 5CENA 2XIXA 4FZDB 5KMJA 4BCGA 4YO4A 4EOIA 4ARKA 5DLSA 1OITA 3V3VA 5DG5A 2BAKA 1NVQA 3PJCA 2WPAA 4HVGA 3K3IA 2J5EA 3RK7A 2F7XE 1YOMA 2YM4A 3UOLA 4D4VA 4DN5A 4O7VA 3PRIA 4W8DA 1R3CA 5JZJA 3B8QA 4DYMA 3PXZA 5D41A 4FYOA 4NSTA 2WTKB 3P0MA 2YERA 1YWNA 2WMBA 3R30A 1W82A 4FSWA 4LV5A 4OW8A 2O5KA 3R04A 4C34A 4DINA 4DCEA 1PXOA 2VX0A 4QP8A 2G2FA 2Z7LA 4L3JA 3IW6A 4U80A 5DEYA 3FSFA 2Y4PA 4M14A 4AE6A 4EOSA 3Q4CA 3BEAA 2B9HA 4ACMA 2Y6MA 1B38A 2GHLA 4D0XA 2YZAA 4M68A 4FSTA 2IZUA 4E73A 5FD2A 4DE4A 2IWIA 2OK1A 3DCVA 1KSWA 4WNOA 2O65A 4CMOA 4WG5A 4R7BA 4X7QA 4O86A 3FC2A 4CV8A 3SKCA 3WOWA 4DBNA 2W1ZA 4JX7A 3VUTA 4EI4A 4O81A 4R8QA 3Q52A 4PTCA 3G2FA 4ITIA 2B1PA 3KULA 5HIBA 4L3LA 4DH7A 1YRPA 2J0LA 2J2IB 2WZJA 5CU6A 3DKGA 4X3FB 3Q60A 3H30A 3IOKA 4KAOA 4RA5A 5AA8A 4I20A 5DYJA 4LL5A 3O8TA 2A1AB 3EZVA 1OL1A 4V04A 3RZFA 2BZJA 4D5HA 4USEA 4IZ5A 3B2TA 3MH1A 4I92A 4LOQA 1P4OA 4M69A 4N4SA 3TG1A 2QONA 3DTCA 5DOSA 3ZLWA 5EK7A 3OY3A 4D2TA 2VTHA 4F64A 4F7NA 4O0WA 2VRXA 3VAPA 3POZA 1PMVA 4IMYA 3Q9WA 4QTBA 3TWJA 4PV0A 3E63A 4O21A 2J90A 4LFIA 4YZDA 3BLRA 4Z16A 2I7QA 3EYHA 2XK9A 2DUVA 4TWOA 1K2PA 5E91A 5AUVA 5K4JA 3IGGA 4O7YA 2W1IA 2CJMA 4IWOA 5CVHA 1Q8YA 3ZH8A 2C4GA 2Y9QA 1OGUA 4QP9A 5CY3A 2GU8A 3H9RA 3JY0A 2NRYA 4MX9A 2JDOA 4I0SA 4QP3A 2R3IA 2UZEA 4YGAA 3C0GA 4X6QC 5AP1A 4YTFA 3OT3A 2GFCA 3NSZA 3QL8A 5CSPA 3BRBA 4FOBA 4NTSA 4QYYA 4S30A 1ZZLA 2XK7A 3BE2A 4UMQA 3VJNA 4A9RA 3QD3A 4N6ZA 5HBJA 4IIRA 2OI4X 2QR8A 5DE2A 5EDPA 5BMSA 5BUJA 3GU5A 5CAOA 2CLXA 3MVMA 4AFJA 1IRKA 5AIKA 3FMMA 2SRCA 3DLZA 3QZHA 3H4JA 2H8HA 3O96A 4TWPA 2OLCA 3PDTA 4C57A 5HE0A 4UALA 5AV1A 4EHZA 2X4FA 4M12A 3RWPA 4C7TA 1BUHA 2OWBA 3QRTA 3EQPA 3R1SA 2Y4IB 4TYJA 4XX9A 4BCQA 4EYMA 4DT8A 2Z7RA 1OIQA 1V0OA 3KK8A 4DAWA 4MYGA 1U46A 1CKJA 3EQRA 4F09A 4QMQA 5L2IA 1M7QA 2BDWA 3LM0A 4TPTA 2WD1A 2WTKC 5TOZA 4EH6A 1V0PA 2E2BA 3ELJA 4XYFA 5KMLA 2VX1A 1H4LA 1ZOHA 4OTQA 2IG7A 2XVDA 3C4XA 3UIXA 3RP9A 5M57A 3Q2JA 1YW2A 3MJ1A 3F3UA 3NUYA 4M13A 4YJPA 4BBFA 3ORIA 3O8PA 3UP2A 3MH0A 5CU3A 5HHWA 3IONA 1KOBA 3AGLA 4FC0A 1YI3A 3MH2A 2PWLA 4PPAA 5E8UA 3SD0A 4CQEA 3VUIA 4UMTA 2FA2A 4MXZA 1VZOA 2XNEA 1MQ4A 2IVTA 2QOLA 2QU6A 2JKMA 5E8ZA 3RWQA 5C4KA 2EB3A 2PVRA 4C4GA 2OZAA 3QCQA 5IUIA 3UOHA 4BI2A 2QLUA 3I6WA 5DH3A 4E26A 4AGDA 4O91A 1R0PA 4RZVA 4QQCA 4AE9A 4GH2A 4U79A 4JXFA 5HTBA 3ENHA 3T3UA 2CNQA 4GK2A 3GGFA 3L9PA 3NIEA 4TKSA 4FNYA 2NPQA 3LFDA 3MN3A 3KA0A 4MD7E 2QOCA 4LMUA 4X3FC 3FI4A 4PPCA 3RALA 3CPCA 3W33A 3ATTA 3GCUA 2VWYA 3R00A 5M44A 1GIHA 2ITVA 2ETRA 2GCDA 2I6LA 3VNTA 4M0ZA 3UYSA 2QG7A 1R0EA 4NEUA 4RWKA 4CYIA 2XNPA 4FTNA 4QMNA 4ANBA 4FICA 3UPZA 1G8AA 4HYIA 5AV0A 2J0KA 1H0WA 4JBVA 4L43A 5CU2A 4EKLA 4WBBB 3TV6A 3GCSA 1ND4A 3C50A 2CLQA 3JYAA 4I0TA 5HNBA 1O6YA 4RRVA 3R7GA 3PE2A 2W5AA 3EFLA 4I4FA 4XG3A 4ZSLA 1PYEA 5CAPA 2P33A 4MXXA 3VS2A 2AC3A 4PDOA 3FUPA 1UU7A 4FK3A 4RVKA 3RBWA 2PZYA 4I0RA 3FLYA 3CPBA 4F9BA 5AR4A 4ASEA 4AXAA 5CSVA 4BCOA 3GU6A 4IC8A 2PVHA 3DAJA 2HW6A 1TQIA 3QQLA 3A7HA 2OH4A 3EFWA 4UWBA 3F69A 5HLWA 1H1QA 4O7NA 2IPXA 2PE0A 2C5XA 5EKNA 2JBPA 3S95A 3PVUA 2Y4IC 3TDVA 4G3DA 1UNLA 3DK7A 4NTTA 3W1FA 3PXRA 4FG9A 4MF1A 4YC3A 4C8BA 3PXKA 2E9UA 3I4BA 1PMEA 3CQUA 1P5EA 1XH8A 4WNPA 3TV7A 4EQUA 3HAMA 3PFQA 2FSLX 3WF8A 4BCKA 3VF8A 3CD3A 2C0OA 4J53A 4O7SA 2IN6A 2YCSA 1H01A 3NYVA 4N70A 4M67A 4OR5A 3K54A 3CQEA 4YU2A 4FG8A 2JFMA 4JJRA 4ONAA 2YWVA 1YDTE 3LFCA 2C69A 4ZTLA 3TNIA 4DFYA 2JITA 2VTNA 2YIXA 4QPMA 3ZO1A 1L8TA 2W0JA 2YZLA 4ZSEA 4ZY4A 3PVGA 4AW5A 5H2UA 4QQ5A 4BYIA 3B2WA 4O7WA 3GC8A 4OTPA 2X9EA 4DGOA 5EH0A 4EC8A 1J91A 2WMVA 2WO6A 3NLBA 3WE8A 5L2QA 1BKXA 3D7TA 4MTAA 4F7LA 4JT3A 4BR3A 4FIJA 4KABA 5IU2A 1SZMA 4WNMA 4ZMFA 2G2HA 4DGLC 5A54A 5AUYA 2J51A 3QTZA 4FUXA 4TYEA 3RM7A 4DEEA 5I3RA 3W55A 5AP4A 3MPAA 1E1XA 3UIBA 4CLJA 1Q24A 3A7IA 4QTEA 3KN6A 3Q4TA 4BTMA 2UVYA 2BALA 5FTQA 4R3PA 3T9TA 4J95A 4YBJA 4PL5A 5T6KA 3ULZA 4EK4A 3A7JA 4CKJA 3VJOA 3QLGA 1WBOA 2BZKB 4JRVA 3GBZA 4YTIA 3TIYA 3DY7A 2FVDA 4OTRA 5EHLA 3ZTXA 4CCUA 2X6DA 3NAYA 3O50A 4BYJA 3RNIA 1DAWA 4I5PA 3DJ7A 3TZ8A 4FL2A 1E1VA 4DCAA 5BYLA 5H8BA 3QF9A 4CV9A 3BYVA 3IW7A 3ZOSA 4I6BA 2ZV8A 2BIKB 3EQFA 3OG7A 1W0XC 3R8ZA 2QURA 4QTCA 4IX4A 4YJSA 3N4TA 1WCCA 4TYGA 5EI6A 3HMPA 1Q62A 4ANLA 4BCFA 2GDOA 3A4OX 2FSOX 3ZFMA 2VUWA 4D2VA 1KOAA 2P4IA 3CGFA 3PSDA 3VUKA 5IQFA 4C59A 2VO0A 2CPKE 1YDRE 4Y83A 2ITTA 3FJQE 3QCXA 3ZBFA 2E9NA 4DA5A 1XQZA 4NCTA 4E5BA 2F7EE 2OH0E 3KRRA 4D1SA 4TXCA 3FMJA 4DITA 3VBYA 3NUAA 4H1MA 4Z7GA 4BB4A 2OKRA 3F2RA 3MGYA 2C47A 2OXXA 4FODA 3VS1A 4FKPA 3Q3BA 3ROYA 3ZHPC 1ZOEA 1XH6A 2JDTA 5J7HA 2PUNA 3HV7A 4RIXB 3QQHA 3G9NA 3DDPA 3PA5A 4MNEB 4FEWA 2ITXA 5M55A 3ZC5A 3QHRA 4IAYA 3VS6A 1Z57A 2Z2WA 3MW1A 2Z7QA 1XO2B 5EM6A 2W9FB 3EQBA 3FHRA 1OPJA 4IE9A 2XKCA 2QLQA 4C3RA 2IZTA 3RPSA 3ACKA 3BX5A 2PZRA 5KCVA 2C0TA 5IA4A 1MRYA 2HZIA 4RSSA 3VHEA 4BDFA 5DRDA 4JR7A 2QHMA 3OCSA 4PPBA 3TJCA 5E8XA 4E20A 1VEBA 4EH2A 5BVFA 3THBA 4EH5A 2B54A 3FDNA 1TQPA 3TUDA 3RK9A 2W99B 5ANKA 2WMRA 1OI9A 2C3JA 3CY3A 3N4VA 3KVXA 3ZLXA 3FSKA 2YM8A 4U43A 4I3ZA 4I1ZA 5J87A 5IA2A 4FNZA 4BI1A 3BBTB 2XYUA 2UW3A 4IB0A 4F65A 3PY0A 2ITWA 3V5QA 1SVEA 2R3NA 1ZAOA 5BPYA 2OFUA 4P5ZA 2W1FA 1OVEA 5GNKA 4F99A 4F1MA 3DAEA 3C4FA 4IX5A 2ETKA 4JOAA 3RAWA 4X2KA 3E62A 3DBQA 3L8VA 3R1YA 4YLLA 5HIDA 4MQ2A 3RNYA 4QP2A 4TTHB 4TYHB 2XIRA 4IHPA 3WI6A 5AV4A 3OS3A 3OXTA 5JGDA 3ZO3A 1GJOA 3RPVA 1LR4A 1Q97A 4A9TA 4C02A 4CRLA 4BDKA 4IADA 4PF4A 4JL9A 3R7UA 3KU2A 3AOXA 2OICA 3JS2A 2Y8OA 1BI8A 5A9UA 4E6QA 3GUBA 1PF8A 2WAJA 3CKWA 4O2ZA 3TT0A 5B7VA 4AZEA 2YLFA 3GFWA 2Q83A 1PJKA 4FV1A 4ZXTA 1IA8A 1NY3A 1YI4A 3QUDA 1M2QA 2YLEA 3FZSA 1F5QA 5CQWA 2AUHA 2XBAA 2EXCX 4X2NA 5CX9A 4CZUA 1PXJA 2XBJA 2HAKA 3G0EA 2XCHA 3ERKA 3PXFA 1GIJA 2UW9A 4L3PA 4FV2A 3V8SA 3HMOA 4FOCA 1JKTA 3OCGA 2UW5A 4OBQA 4U41A 5AV2A 5L6PA 3OZ6A 1PXLA 3OF0A 3NNXA 3QTSA 5AP3A 5FUTA 4GU9A 4JBQA 3AD5A 5AX9A 4G9RA 3U55A 5FM3A 5JQ5A 3PA4A 4FSMA 5IMEA 3NWWA 3OBJA 1UNGA 5ACKA 4O0YA 4BCMA 2RFNA 4IJPA 4AW0A 5AFVA 4NYEA 3FLSA 5IQCA 4BWXA 2QKRA 3R1QA 3ZZEA 3UPXA 3UOJA 3SXFA 4IACA 2R3JA 3ZSHA 2ZDUA 2ZYBA 4IVCA 4FV4A 5FP5A 1H1WA 4G34A 4EH9A 2FYSA 4F7SA 2QCSA 4XOZA 4DTKA 4FA2A 1YWRA 1P4FA 3EJ1A 3QQJA 4AN9A 4CYJA 4FT3A 3WF9A 2XK3A 2IO6A 5I0BA 2YJSA 3HV4A 1P14A 5IQEA 3I6UA 4KIPA 4MQ1A 5CI6A 3MA6A 5FEDA 3TUBA 1Q61A 2XRUA 5BMMA 3R2YA 2EVAA 4FV0A 4F6UA 1OL6A 5JSMA 3HAVA 2XNMA 5E8WA 4JVGA 1U54A 1JKLA 2QI8A 4C38A 4XHKB 3UJGA 4QP6A 4BF2A 3N4UA 3DB8A 3FMKA 2XJ2A 3MY1A 4JAJA 4LYNA 1S9JA 2NRUA 3OEFX 1WBVA 1ZWSA 4OTFA 5E8VA 5B2LA 1OL5A 1OBDA 5DA3A 1XHAA 4G2FA 4B7TA 3BU6A 1H00A 1Y6BA 5A4EA 2XIKA 3GNIB 5CVGA 2VAGA 3NX8A 4JI9A 3OUNB 4ZK5A 2OJGA 3ZDIA 2I0VA 3ULIA 2G9XA 2VNWA 4RIWA 3VS0A 5LMBA 1YHVA 3UOKA 2C5VA 5CANA 3A8WA 4G31A 3V04A 1XH7A 3JUHA 3QA8A 3DJ6A 3QRJA 4JS8A 3CIKA 4XLIA 5AR5A 4Q9ZA 2Y0AA 1FMKA 2FH9A 2BROA 2C6OA 3EOCA 4HNFA 3ZBXA 4USFA 4ERKA 5CLPA 2VTPA 3TTJA 2WQOA 1ZY5A 5M4IA 4J98A 4QT1A 5CU0A 4RA4A 5IUHA 2HWPA 2C68A 2R2PA 2F2CB 3I79A 3PG3A 3IW4A 3I0OA 4OTDA 4AZFA 3MPTA 3UMWA 4QPSA 4YURA 3WIKA 3UZTA 4PDYA 5H9BA 3QUEA 2R3KA 5C8KA 4BDBA 3F3TA 4O0RA 3BHTA 5D11A 3R8PA 3ITZA 1H0VA 1OB3A 4W4VA 3AT2A 3NW6A 2ESMA 4CG9A 2CDZA 2PMIA 4BDHA 4MXCA 3G51A 1REKA 2ETMA 4QD6A 4HYUA 4IZ7A 4JX3A 1BL6A 4LRKA 5L4QA 3O2MA 4CG8A 3Q5IA 3F82A 4EH4A 4MK0A 5JN2A 1NT2A 3E64A 3BYMA 2R3RA 4ZY5A 2JC6A 5BX0A 4ZMEA 3BGZA 4FT7A 4C4EA 3AMYA 4AT5A 4C2WA 5T3QA 5AP7A 4BDIA 3QTRA 1A9UA 3DKCA 3OWJA 5HVKA 4H3BA 3GU7A 4K77A 4DEGA 4R5YA 3U9NA 2A2AA 4NIFA 3QZIA 4FV9A 1Q5KA 3ETAA 4W9XA 5AAFA 1VJYA 2OJ9A 3UZRA 3MBLA 2KTYA 3CJFA 4OTGA 3VS7A 1UV5A 4B0GA 4PUZA 2V22A 1J7UA 5J9ZA 2J50A 3NIZA 2BHEA 2XJ0A 4O82A 4BIDA 2WFYA 1BL7A 4IAIA 1Q8UA 1WBWA 2WEVA 3VF9A 1RJBA 3KGAA 5EFQA 1ZY4A 3PLAE 2ITNA 1AGWA 4JG7A 4FGBA 5LMAA 4O7RA 4FTCA 4UV0A 3DKFA 4ALWA 2R3MA 4OAVB 3QD4A 4H3QA 4IX3A 5EYKA 3T9IA 4FTQA 3PY3A 4E4LA 3GI3A 4YNEA 2JAVA 4OT5A 3EN7A 1LEWA 5CASA 4BCPA 3N9XA 3RM6A 4RLLA 4CRSA 3LOKA 2RG5A 3E93A 2XB7A 4YHJA 2B9FA 2XMYA 5LOHA 3D2IA 3QZFA 2J9MA 3R28A 3FKLA 3DA6A 4FTOA 1LP4A 2Q0NA 3C4EA 3O51A 5IH4A 3F3WA 4ZIMA 1IA9A 4GK3A 5BYYA 3P78A 4KRCA 4M8TA 3P9JA 2C6KA 3WZEA 4H58A 3N51A 3QQFA 2HZ4A 3SXRA 4Y85A 1XJDA 3I7CA 1VYZA 4XG7A 4F0IA 2UZOA 2RG6A 4ZSAA 4RVMA 5FM2A 2C5OA 4D55A 3RGFA 5ANIA 5DN3A 1HCLA 2PU8A 4FSQA 4ANNA 3G9LX 4FIFA 4DEAA 1WBNA 4C0TA 4GYIA 2VTRA 2HZNA 2JEDA 4XEYA 5HOAA 3A99A 5A6NA 2X8DA 3TTIA 2VD5A 1H25A 5F95A 3EQCA 4IZYA 3NZ0A 2WHBA 4FYNA 3NUXA 3AD6A 3MVLA 3OVVA 4GIHA 3LJ1A 4QP4A 5ANGA 2W1CA 5IQGA 1M17A 4L53A 5HCZA 1H26A 4YZNA 3L8SA 2W5HA 5M4FA 3PA3A 3R22A 2RIOA 4XV1A 3KXXA 2OZOA 4CKRA 2ZV9A 1X8BA 3FZ1A 3VS5A 5CEKA 4O27B 1Q3WA 3PPJA 4RJ7A 3ODZX 3HZTA 2EUFB 5BUEA 4X21A 5FXSA 2ZMDA 3U6IA 3PJ8A 1W98A 1L3RE 2HW7A 2B53A 3G6GA 4FVRA 5CALA 5KBQA 3EHAA 3F5XA 2XNBA 5IA5A 3AC4A 1T45A 2R3HA 5LARA 4D4YA 3E7OA 4IAZA 4JQ7A 4DGNA 3U4UA 3HP2A 4O22A 5KHXA 1Y8GA 4C4JA 1O6LA 4I94A 2BPMA 2V5QA 1QPJA 1R1WA 4J7BA 4PP9A 2VTLA 1PXNA 2GQRA 4D2RA 5CI7A 3D14A 2UZUE 5EHOA 4WSYA 3PUPA 5BVDA 4ACHA 1I44A 3G5DA 4PMPA 2F4JA 3HA8A 3PY1A 3RK5A 3HECA 3RPOA 3U8WA 3ZC6A 5L6WL 3WZUA 2YCRA 3C4WA 4KKHA 3MY5A 1PHKA 3UODA 2P2IA 3A62A 2PE1A 5FDXA 2P55A 3F3ZA 5AR3A 3UNKA 4NZWB 4RIYB 4F1TA 3WZKA 4BL1A 5J5TA 2QD9A 3FYJX 5G1XA 3MIYA 4MXOA 3P5KA 2PVYA 4ANMA 4N6YA 4U44A 4C35A 4RJ6A 4CCBA 4DFLA 4K2RA 4HCTA 4QPAA 4FTAA 3VUDA 4BBEA 4LGDA 4E93A 3BU5A 3IW8A 3VUGA 3KQ7A 2C6TA 3LLTA 5CU4A 4U42A 3RHKA 2VTIA 2I0HA 4FZ6A 4BIEA 5CEMA 2XIZA 3LXNA 5AAGA 4IWQA 3WF6A 5EG3A 3SGCA 2YISA 3RKBA 3KXMA 5GJGA 3FLWA 2OG8A 3CBLA 4QNYA 5AR2A 3P7CA 1Z5MA 2PL0A 3VUHA 4GT3A 3E8EA 5CT0A 4R6VA 2WELA 4WO5A 3LFSA 5M4UA 1LUFA 3FPQA 4BC6A 5E4HA 1Q3DA 4KS7A 4Y95A 3ZDUA 3Q4ZA 5FRIA 3R9DA 5FEEA 2WU6A 1B6CB 3AD4A 1UA2A 3UNJA 1WVYA 3H9OA 3NUNA 3KXNA 1OUYA 1CDKA 3EN5A 4V0GA 2PPQA 4BDCA 4NM7A 4JQEA 2BHHA 3IDBA 3KN5A 4OT6A 2WTDA 3F7ZA 3ORMA 4FTMA 3LXLA 5DR6A 5DT3A 3PXYA 3FZTA 5BVWA 3BWFA 1K3AA 4C62A 2DYLA 4O96A 2JKOA 1J1BA 2ZMCA 3PSBA 1UVRA 4S2ZA 4O0SA 5E8TA 3BELA 1MP8A 4KIKA 5AR8A 4G6OA 4K9YA 2B0QA 5ANJA 3KF7A 4UYAA 3GC9A 4YJNA 4Z7HA 2J0MB 5EM8A 3BLQA 3ID6C 5GJFA 3KREA 2R3QA 4FEQA 4DLIA 4E7WA 3EWHA 3E3BX 4RG0A 3NYXA 2GS6A 2OO8X 4NKSA 3FQHA 3D5WA 4G3CA 2Z60A 4EOJA 5L6OA 4BKYA 4WKQA 3QTQA 4AA5A 3F2AA 4EWQA 4AW2A 2PHKA 3Q04A 4IVBA 4GU6A 5IDPA 2P0CA 2QOFA 5M4CA 5J79A 2BAQA 2HYYA 2R3OA 5A4TA 2B9JA 4L7SA 2REIA 4FSZA 3E87A 3IKAA 4HYSA 5LWMA 2YM5A 3WE4A 3VWAA 4LRMA 2F49A 1ZLTA 1OMWA 4IH8A 4K8AA 5I5ZA 4E3CA 3RAKA 4U45A 2QOHA 4AT3A 4J8MA 5K9IA 4ID7A 3RHXA 2E9PA 3GOPA 4RX9A 3LE6A 3NDMA 3KULB 2YWPA 4XBUA 5FP6A 3P86A 5DVRA 3A7GA 3AC8A 2PY3A 4DG0E 4RVTA 3VBXA 5IQDA 4I6FA 4CSVA 3KXHA 4ASDA 2ACXA 3OROA 1K9AA 3F5GA 4EHEA 3R9HA 5FBOA 3H3CA 5CF6A 1OBGA 4XV2A 4L45A 4M84A 2FGIA 3E8NA 2FO0A 3O7LB 4CGAA 4IZAA 3LW0A 2GNHA 4GT5A 5CEPA 3HX4A 2XA4A 3AQVA 4NW6A 3F2NA 3Q32A 3GU4A 2W06A 4ALVA 5GZ9A 2VO7A 4EQCA 2JDVA 3HRCA 3KKVA 4WNKA 4BTKA 4Z55A 1YXUA 3LFAA 2W4JA 3QTWA 2OBJA 3ORZA 4ANSA 3Q9XA 4U8ZA 4E8AA 2XP2A 4E6CA 1GZ8A 5LWNA 4LL0A 4UZDA 5AX3A 1WZYA 4ZTQA 3FQEA 3PWDA 4NUSA 3UQCA 3VQHA 2X81A 4GT4A 4BHNA 1QL6A 2PZIA 4M15A 5TR6A 5E1SA 3MVJA 3F7WA 4QYHA 1YHWA 2A4LA 2BZIB 4Q2AA 4WRSA 3R7VA 4AWIA 1H1PA 5DWRA 1JSVA 4F08A 4FIIA 4EC9A 5ANDA 3W2RA 3C9WA 3WZJA 4I6QA 4RQKA 4E1ZA 2H6DA 2FSMX 3BHUA 3TUCA 3QD2B 2GTMA 4RPVA 5J8IA 3S3IA 4EOPA 3TXOA 4WUAA 4EK6A 2ITPA 2XK8A 1Z9XA 4GSBA 3L8XA 3D5XA 5HD4A 1KV1A 4TYIA 2CKQA 5EYMA 4EQMA 5KKRB 2H9VA 3VN9A 2O2UA 3ORNA 5HU9A 3QYZA 2JKQA 3PE1A 3TZ7A 3RINA 3HNGA 4CKIA 4UX9A 2CN5A 4EKKA 4O7LA 3ORLA 5AEPA 1PYXA 3VO3A 1OL2A 3A7FA 5CNOA 5C8MA 3PWYA 5JFVA 2UVXA 2XNOA 2I40A 1Q8WA 3R9NA 4FKRA 5HG8A 5ACBC 4RJ8A 4KS8A 5CSWA 2QVSE 3U51A 5EW9A 3UO4A 3OMVA 2JKKA 1URCA 3NUPA 3AC3A 3CQWA 5M07A 5LVNA 3FLQA 3QXPA 1E9HA 4YPDA 4XP0A 4CFUA 2VWIA 1QPDA 4L7FA 4RGJA 4XNEA 5EDRA 2OJFE 2J4ZA 2UZVA 2GHGA 1DM2A 5CZIA 4OTIA 3V51A 3EB0A 3MY0A 4RWJA 4F0GA 5KMNA 2IZSA 3ANQA 3OD6X 3PRFA 4OBPA 4ANOA 4BKJA 4W4WA 5AUUA 5IQAA 3K3JA 3F66A 3JXWA 5HX6A 4U40A 3E3PA 2AYPA 3FY2A 5J9YA 5D10A 4QNAA 4YHTA 2PZPA 3P1AA 3KB7A 1ZRZA 2ONLA 4AZTA 4RBLA 1YWVA 2W96B 5CEQA 3NNVA 4PMMA 4E6DA 5HLPA 3F61A 4YJRA 1YI6A 4G5PA 3MFUA 3V8TA 4D9TA 1TKIA 4R3CA 4TWCA 1CKPA 4BRXA 2R7IA 2PSQA 2XEZA 5A46A 2J5FA 3LM5A 3KRWA 4WG4A 3SQQA 1FQ1B 4D58A 4YJOA 1SM2A 2W1GA 2OIBA 4O0UA 3LJ0A 3L9NA 3REPA 3UO5A 4RJ5A 5JK3A 4FBXA 3QAME 4XS2A 2ZV2A 3GQLA 5A14A 4QMPA 1KUTA 1LPUA 2JBOA 3MS9A 4PWNA 4RWLA 4I22A 4R1VA 4DGMA 4IM2A 1OPKA 5CXZA 2FSTX 2OJIA 5C27A 4FVQA 5FXQA 3TNQB 2EWAA 4E5WA 2WTJA 3FHIA 3HLLA 3CC6A 2I1MA 2VTQA 3MDYA 4IM3A 2OF2A 3DBFA 1PXPA 4F9WA 5AUXA 3C4CA 3DOGA 3IOPA 3NVKI 3HRBA 4DFNA 2X7OA 4PTEA 3MWUA 4EZ7A 3QD0A 3DKOA 3NAXA 2BMCA 4O2PA 5HKMA 1UKHA 4DEIA 1JPAA 2WXVA 5I3OA 4DEDA 2W4OA 2I0YA 3I1AA 2V7OA 3BYSA 4U3YA 3ROCA 5AR7A 3SOCA 2PYWA 3I60A 4IDVA 4L44A 2PTKA 3AMAA 2ITZA 1ZMUA 5KKRC 4H39A 3RI1A 3D4QA 1QMZA 4D1ZA 1MRVA 1ERKA 1JVPP 2BRMA 5KMOA 4LM5A 3CTJA 2JIVA 2GTNA 2VZ6A 3FZPA 5ETCA 5DEWA 2QOKA 5HNIX 5IA3A 5HO8A 3GC0A 3HGKA 3U54A 3Q4UA 4DH3A 4RX5A 1FPUA 3DAKA 4O0XA 3U9CA 4YNOA 4DGGA 2WIHA 3P08A 4OBOA 1ZYLA 3G6HA 1R39A 3PIXA 4D28A 1RDQE 3ORPA 2UV2A 2BILB 2B4SB 3KXGA 2OXYA 5IMXA 4J96A 4PX6A 5L8LA 4QMXA 4TYHA 2WOUA 2JDSA 2CMWA 3IDCA 3D7TB 2CGVA 3M11A 2VTAA 3OW3A 1DAYA 1GIIA 4NW5A 3GXLA 4AS0A 3PVBA 1UU3A 3IGOA 4L46A 3O17A 4USDA 4ZZMA 3GT8A 4IBMA 2WQEA 4KIQA 4I6HA 2JGZA 4QQJA 4YSJA 1YXVA 5IPJA 2ITOA 3GC7A 4G9CA 4X2FA 5F1ZA 4QMOA 3DXNA 3I81A 3VVHA 5JH6A 3GVUA 5DR9A 5LXMA 4QP7A 4GFOA 4GVJA 3ENMA 3EZRA 3UNZA 4A06A 2X1NA 2YHVA 5C4LA 5DI1A 3ORKA 2W1EA 5EM7A 1HCKA 2PUUA 3E7VA 2G01A 2QU5A 3BPRA 5A4LA 2XJ1A 5HICA 3MYGA 2XCKA 1SYKA 4FTTA 4M97A 5IDNA 4C3PA 3IO7A 3P4KA 4DG2E 4CFNA 2RSVA 1FVRA 4YJTA 5F4NA 2GNGA 3HA6A 1JKSA 3O0GA 4LRJA 4O38A 5HQ0A 1UWHA 5FGKA 3MB7A 2AC5A 4IW0A 4DEHA 3II5A 4ZY6A 2QOBA 5IQBA 1UWJA 3E5AA 3NYOA 2IW9A 3IS5A 4IB3A 4UEUA 4KKEA 3ALNA 1V1KA 4KBCA 5M08A 4FL1A 2JFLA 3C13A 1R78A 3HMIA 4IVDA 3W2PA 4KSPA 3IECA 4MXYA 3U6JA 1ZOGA 2IW6A 5H3QA 4XG6A 4KUJA 3ZM4A 4PDPA 2ZM3A 5BVNA 4NK9A 2OGVA 4GYGA 4Y5QA 4CT2A 1ZMWA 1PRYA 5HCXA 4LV8A 5ITAA 3ZLYA 3QA0A 4MVFA 3TL8A 3SRVA 3HEGA 4Q9SA 1Y91A 4UMPA 4S31A 3LCDA 5AA9A 5IG1A 4F0FA 4R78A 3MB6A 4PMSA 3A4PA 3CE3A 2VTSA 2ZV7A 4I21A 4KIOA 1OIYA 4CD0A 3BWJA 1H8FA 4FTLA 2UZDA 2WMUA 3Q2MA 4E5AX 4JDKA 4TN6A 4MBIA 4BCHA 5L8JA 3VRZA 5KMMA 5H8GA 5KNJA 2JAMA 4FKVA 2WTCA 4FKQA 4EL9A 3FAAA 4GS6A 1IAHA 4X2JA 4YJQA 5J7BA 4CFVA 3EQHA 4NU1A 3R1NA 2WQMA 2YEXA 3BHHA 3PJ3A 4QTAA 1O6KA 3NYNA 5TE0A 3GEQA 3NGAA 3WF7A 4CZYB 2H34A 4Y8DA 2LGCA 4YO6A 4TL0A 5L3AA 2VWXA 4G1WA 3Q6UA 3OWLA 4EORA 4E4MA 5D7VA 5M09A 4LMNA 3LKMA 5LVPA 2R3GA 2GPHA 3LJ2A 1GZNA 5IEXA 3GENA 2O64A 1PMUA 3GCQA 5AJQA 4G6LA 4ZTNA 5IA1A 3BHYA 4XCUA 4BDGA 2JIIA 4CFWA 4DFBA 4O1PA 4QRCA 1GAGA 4FTRA 1MUOA 4UY9A 4WG3A 1JWHA 2GQGA 4PQNA 3T8OA 4CFXA 4H1JA 3HMNA 5HNGA 1M2RA 4WHZA 2UW8A 2X8IA 3CTHA 1IEPA 3D7ZA 4BDJA 3QX2A 4MH7A 4QMYA 2QO7A 3S2PA 1WAKA 5FTOA 5LMKA 4O7TA 4WT6A 5LQFA 2FB8A 2CNVA 2X2MA 3GU8A 3NW5A 5CAQA 5A6OA 2ZB1A 5CXHA 3KMUA 4BKZA 5CNNA 4E4XA 2R64A 3Q96A 4ACCA 3SA0A 4S33A 4LOOA 4BZNA 3AT3A 5IH5A 5HTIA 2R3PA 2OW3A 2XNGA 1W84A 1SNXA 2OFVA 2UW6A 4B9DA 4GKHA 4ZJIA 4C4HA 3AT4A 4A4LA 3O8UA 1WMKA 4AN3A 2WTWA 4HGEA 4XV3A 5GINE 4XRLA 4UXQA 4S34A 2WIPA 5E8SA 3QC4A 4BGGA 5HTCA 2YCFA 5B2KA 4DG3E 4BCNA 4JDIA 5CT7A 1PKDA 2OF4A 3UO6A 4DBXA 3FLZA 4NCTC 2G15A 3PPKA 2BDFA 4APCA 4AAAA 3PJ2A 3POOA 2ERZE 2XZSA 5CQUA 3SG9A 4LOPA 1KE6A 4BDEA 4RJ3A 2JIUA 3C1XA 4XG9A 5LCKA 3QQGA 3SW7A 4I5CA 3HV6A 3S4QA 4F70A 5HG5A 3LQ3A 3OWKA 1BLXA 4C2VA 5KO1A 3SVVA 3DB6A 3PP1A 3TV4A 2BTRA 4HPUE 5EHYA 3U87A 4D2WA 2R9SA 3DDQA 4WA9A 5EDQA 4KINA 4QYEA 5C01A 3OWPA 4FKOA 2C6IA 2V0DA 3QX4A 5B0XA 3LMHA 5DT0A 3D5UA 3FV8A 3QALE 1NVRA 1SNUA 3VUMA 4KKGA 4HGLA 3F88A 4IWDA 4MKCA 2H96A 2XUUA 3UBDA 3QFVA 3E92A 3W8QA 5LVOA 4F9YA 2XKFA 3PZHA 4Y72A 4GW8A 5ETIA 3U6HA 4FEUA 4J1RA 2XNNA 1B39A 1RE8A 2BFYA 2UW7A 4GUEA 4KBKA 1BMKA 4GUBA 2R4BA 4N57A 3TZMA 2DQ7X 4MF0A 5FBNC 3FY0A 4TZRA 3R73A 5M56A 3DXPA 3TNWA 1YKRA 2ITQA 2C6EA 2VWBA 3PTGA 4J8NA 4LUEA 3ZRKA 4EOLA 3DBDA 3K2LA 4V01A 5KBRA 4DH8A 2CCIA 3DT1A 5BVEA 5E7RA 1JAMA 4X3JA 1YXXA 2XYNA 4OTHA 5T68A 2R0IA 3MV5A 4BICA 4E4NA 3PYYA 4FG7A 4B6LA 2QKWB 4IANA 4B4LA 4Z9LA 4YLKA 4EUTA 3TIZA 3KXZA 4JIKA 2XM8A 4JIAA 2O3PA 5I9UA 2HENA 2P2HA 3FL4A 5LCJA 1PMNA 3G0FA 4FT9A 5HBEA 4RIWB 5CTPA 1JKKA 2EB2A 4LGHA 1M52A 3TCPA 4F1OA 4RLKA 1YOLA 3WYXA 4FT5A 5D9HA 3BYUA 4HCVA 3P7BA 4P90A 3VW6A 4EBWA 2X39A 2YACA 1M2PA 4GG7A 3P7AA 2RFDA 3V01A 2O8YA 5ANEA 1KE5A 2ZB0A 5KUPA 1U5QA 1YHSA 3DS6A 4CMTA 3A61A 4TNDA 2VX3A 2XIYA 4U3ZA 3V5JA 2QO2A 4H36A 4ASZA 5FWKK 4FKSA 4DLJA 3QHWA 4K11A 4JG6A 5CAVA 2B9IA 2W4KA 3HL7A 5IQHA 3DV3A 3DK6A 4CTCA 2OU7A 4BGHA 4D5KA 1YQJA 4XJ0A 2VGPA 3ODYX 4FKTA 2VU3A 2NP8A 1PKGA 3I0QA 4YSMA 4CMUA 4YPSA 4ITJA 2QG5A 4FI1A 1KE7A 5GJDA 2PK9A 3F3VA 3UZPA 3LFQA 4XLVA 3KEXA 3NNWA 4FKUA 3RPRA 3SC1A 1TQMA 1Q4LA 4JNWA 4R7IA 4KA3A 3H0YA 4ASXA 5K5NA 3EN9A 3QWJA 4R1YA 5KX8A 3CP9A 4TNBA 3M1SA 4RC3A 2PUPA 4C36A 1PY5A 1FGKA 1XBAA 3UVQA 4AFEA 2BAJA 3R2BA 4B8LA 2WTIA 5DRBA 4EHGA 5KMIA 2ZM4A 1Y8YA 3JVRA 3QC9A 3VBTA 1ZYSA 1JLUE 3OP5A 4IJ9A 3SDJA 5A3XA 4ZLYA 4FKJA 3NRMA 4PY1A 2XK4A 3EL7A 3KRXA 2VN9A 4IX6A 4UYNA 4YJUA 3DNDA 5LJJA 4NKAA 3O71A 3TN8A 3GCVA 4NIFB 3ZONA 4RC2A 2UZBA 3QKKA 4O83A 3WBLA 1FVVA 1QCFA 3MIAA 4ENXA 3PZEA 3CTQA 5EI2A 3FEGA 3QTUA 5JT2A 3FI2A 4U5JA 2F57A 2YJRA 3PLSA 4XG4A 5DFPA 2VV9A 2X7GA 5HBHA 4O6EA 5A4QA 5A4CA 4X3FA 3UQGA 1JNKA 3ZEPA 4NM3A 4BN1A 5TT7A 3KCFA 3ZXZA 4G3GA 2RFSA 4AOIA 1STCE 1H24A 1MRUA 1NA7A 2CSNA 4MCVA 4RMZA 3C5UA 3W2CA 4P7EA 4NFNA 4HNIA 2BUJA 3DK3A 4YZBA 2C30A 4LQMA 4WOVA 5CF5A 4RFMA 3LCTA 4EBVA 3GB2A 3LQ5A 1YVJA 4BWPA 4U7ZA 2BFXA 4XMOA 1FOTA 4L52A 4DFXE 4NM5A 4NJ3A 5TKDA 2VTOA 1W83A 4EOKA 3W2SA 1NXKA 3LZBA 1H1RA 1A06A 3QTXA 2QODA 4HJOA 4C37A 2GNFA 2C3KA 2C1BA 3Q6WA 5I9YA 3VULA 2PVLA 3HP5A 4IAFA 3ZMMA 2UZTA 4FE2A 4BY9E 5KZ0A 5J5SA 4RC4A 3UC3A 1FGIA 2X9FA 3WF5A 3R01A 2BRNA 2OIQA 3AMBA 3MFTA 3ZSIA 4EK3A 5IISA 4FV3A 3FMLA 4XP2A 4QOXA 1JBPE 3EIDA 1OUKA 4IFGA 4AP7A 3NR9A 4ITHA 3LPBA 3OFMA 4UB7A 3HYHA 4FK6A 3VRYA 4C61A 4C33A 2YM7A 4W4XA 5HX8A 3C4ZA 1OM1A 4EEVA 5IF1A 3WZDA 4I5MA 3R7OA 4CFFA 1REJA 2B55A 2GMXA 3C0HA 3DBCA 3HKOA 4MXAA 3MTFA 3OT8A 4YZ9A 4FZAB 5IKWA 3VIDA 2I0EA 4FMQA 4IB5A 3ZCLA 5C03A 5AP2A 4HVSA 3MJ2A 5FDPA 1ATPE 3FQSA 4J52A 3R8LA 5JFSA 4QMUA 4HVHA 4WSQA 3MI9A 3R83A 5CS6A 2C3LA 4IC7A 5FQDC 3CCNA 3JPVA 4EHVA 4IQ6A 4YP8A 3HDNA 3HDMA 4GFMA 3L9LA 3MFSA 3CGOA 1H27A 3I7BA 4DC2A 4MEDA 4BWKA 4YUQA 3CJGA 4YC6A 4C58A 5AP0A 4XH6A 3FWQA 4YTCA 3ANRA 5E9EA 2IZRA 4M3QA 2QNJA 3MESA 3EH9A 3COIA 4FT0A 1H28A 3CY2A 2W9ZB 2YM6A 3FKOA 3V5LA 1J3HA 3ZSGA 4FGRA 2JD5A 1APME 2HY0A 1VR2A 2PMNX 3OTVA 3BV2A 3SHEA 3T3VA 1Q8TA 1BX6A 3DFAA 4PNKA 4NL0A 2ZM1A 3LFNA 4HCUA 4WBOA 5JMSA 2C0IA 4UMRA 2IVUA 2UW0A 4DHFA 3QXOA 1YXSA 3QWKA 5J9LA 4FUYA 3SX9A 4FZFB 3W16A 3ET7A 5AUZA 2WB8A 4GVAA 3NMUF 2J0IA 4AT4A 3BYOA 3AG9A 3DQXA 2HOGA 5JGBA 2GSFA 3LCSA 5EI8A 4A9UA 2YDIA 1RQQA 3FZOA 4II5A 2BZHB 4RJ4A 2EU9A 5H8EA 3VS4A 3RMFA 4EYJA 4GMYA 2W17A 4OLIA 2CKOA 4RQVA 2ZAZA 3BZ3A 1DS5A 4MBJA 5E90A 5DMZA 3BI6A 4AQCA 3TNPC 4F9AA 2PVNA 2WMAA 2F9GA 1PXMA 2A19B 3PJ1A 4A4XA 2JDRA 2XKEA 1VYWA 2R3LA 5AP6A 2RGPA 4CT1A 4L8MA 3V8WA 2UZLA 1G3NA 5JFXA 2VWUA 3CEKA 3R6XA 3OXZA 4FIEA 1RW8A 4BFMA 5KMKA 4ZTHA 3KK9A 3D9VA 2DS1A 3KFAA 3SOAA 1KWPA 1OECA 1GY3A 4HVIA 2Z8CA 4M69B 4APPA 2CGWA 3PIYA 2ZOQA 4F9CA 1I09A 5HI2A 3AC1A 3QKMA 5HGIA 3TNHA 5IQIA 4GL9A 4I24A 4V0GB 5ETFA 4YZCA 2DWBA 4W8EA 3DZOA 1YDSE 3COMA 2X8EA 4HW7A 1SVGA 3S00A 5K0XA 1H08A 3LFEA 5J1VA 2X6EA 4C4IA 3ZZWA 2VWZA 3IDPA 3OOMA 5GZ8A 3GOKA 1WFCA 3QKLA 2OIDA 5BUIA 3EFKA 3IG7A 1FMOE 3SG8A 4FEXA 4WD5A 3ALOA 1XBCA 3BQCA 3R7YA 3LCKA 4F63A 4KIKB 4DTBA 3R02A 1Q8ZA 2WMXA 5AADA 4FR4A 4UXLA 5JGAA 3SAYA 3F5UA 3I5ZA 4GG5A 4GFGA 2FUMA 4NT4A 4BGQA 4QMZA 4BVUA 3NUSA 1NVSA 3FXXA 5CSHA 4ZP5A 2XM9A 3VBWA 4DT9A 3C0IA 2EXMA 2BDJA 3BGPA 2A0CX 3JVSA 4O1OA 3LLAA 3AXWA 1Y57A 5JQ8A 2VTTA 3QCYA 4PMTA 1AQ1A 4NFMA 3BQRA 2B52A 2J0JA 3PSCA 1FBNA 4G16A 1ZYCA 4BCIA 4ACDA 2GNLA 3EN4A 3HUCA 4C4FA 2CHLA 4YTHA 3D0EA 4FV7A 4FV8A 2VTJA 4MD8E 4BZOA 4DF3A 2HELA 4ZLZA 3E88A 4L6QA 3VBQA 4LGGA 2XK6A 4ZZOA 3LHJA 4QMLA 5IH6A 3QRIA 3UVPA 4A9SA 1CTPE 3RCDA 4WIHA 3ZUTA 3H10A 4XV9A 5EQPA 3BIZA 3GFEA 4L67A 5LVMA 4AOJA 3SW4A 5FXRA 3UGCA 4KWPA 4ZJVA 1JSTA 3EN6A 3P79A 3UDBA 3M42A 2G1TA 4MAOA 4PP7A 2QR7A 2YCQA 3OTUA 5HE1A 3W32A 3QGWA 5HU3A 1J1CA 4DFZE 3TKHA 4U81A 3R9RA 2OZAB 2GQSA 2HZ0A 3LCOA 2QC6A 1XBBA 3UE4A 1Q99A 1ZYDA 3RAIA 4OUCA 5BVKA 1GZKA 1S9IA 1SMHA 4O6LA 4FEVA 5BNJA 1PW2A 1BYGA 1CMKE 2O0UA 5B2MA 4FV5A 3VQUA 3V5TA 3IPHA 4F6WA 3RVGA 2ITYA 3TDWA 3LFBA 4G3EA 4P2KA 3QU0A 3HMMA 5L2SA 3KL8A 3ATSA 4BBMA 3KRJA 5EKOA 4YC8A 5E8YA 4U0IA 2X2KA 4YJVA 5ANOA 4CQGA 2J6MA 2QOQA 5GIPE 4CXAA 2YA9A 4IVAA 3A2CA 3H9FA 5BVOA 4YZMA 3CD8A 4L68A 4XG2A 2YIQA 4I5HA 4XUFA 5CAUA 2QO9A 5I9VA 2F2UA 2WQNA 5CSXA 3UTOA 5EYDA 5DNRA 1A48A 3NCGA 3ZYAA 2GNIA 2V55A 2IW8A 4J99A 5HVJA 2E9VA 4KD1A 4QMVA 4D4RA 4EOOA 4D9UA 4G17A 2Y7JA 3ZUUA 4BCJA 2UW4A 4O84A 5L8KA 4K1BA 3O7LD 4H05A 2PVMA 4JG8A 4AOTA 4RX7A 2VTMA 2F7ZE 3MFRA 4RIXA 5CWZA 1AD5A 4B99A 2WGJA 4MNEA 2XF0A 3GCPA 4F7JA 5AUTA 4MBLA 3NEWA 3G90X 3MH3A 4Q5EA 5KHWA 2J7TA 4NM0A 3OY1A 1O9UA 4PTGA 5K3YA 4HYHA 5J95A 4CLIA 3FI8A 4JQ8A 3PVWA 2C5YA 2R0UA 5AWMA 3F6XA 4ZJJA 1UU8A 1YXTA 5K5XA 1DI9A 4FTIA 3UP7A 3FXZA 3PXQA 2A27A 4JLCA 5GIOE 5HESA 3NNUA 4G5JA 5JRSA 2RL5A 2PE2A 5DGZA 4BZDA 1G5SA 1KE9A 2EXEA 4FV6A 4IWPA 2BIYA 5AAEA 3COHA 3AC2A 3KY2A 3LIJA 4OTWA 3SXSA 1CKIA 3PG1A 5EOBA 2X4ZA 3NUUA 4WUNA 3BCEA 4LG4A 3MVHA 4X2GA 1H1SA 4FIGA 4PL4A 3F5PA 2E9OA 5CVFA 5HD7A 4BHZA 4EOMA 2RFEA 3UIMA 3LXKA 2R5TA 4EONA 2C5NA 3BEGA 3BBWA 5IA0A 3FBVA 3BU3A 3OW4A 3DNEA 4O0TA 1U5RA 4V05A 3EKNA 4AX8A 1FINA 4KRDA 3R7EA 4DFUA 4EZ5A 1P2AA 4F6SA 3DTWA 3OHTA 4EK5A 4M7IA 1UKIA 2XKDA 2ZVAA 4GEOA 5TO8A 2VWWA 1W8CA 4A07A 1SVHA 1U4DA 2YDKA 5L2TA 1JSUA 3Q9ZA 4AA4A 3L8PA 4R3RA 2IVVA 3QCSA 2HY81 4IM0A 1XR1A 3D5VA 1YOJA 3RAHA 4AZVA 4ENYA 2C3IB 4P4CA 1KV2A 2WU7A 3KRLA 3ORXA 4FNWA 4IAAA 4E6AA 2YABA 4O7ZA 4MNFA 2C6LA 3QRUA 3ZS5A 4I4EA 3QZGA 3W2OA 5IEVA 3QRKA 2X0GA 3EQDA 2V7AA 3NW7A 2ERKA 2YIWA 4HZRA 4ZOGA 3VHKA 5AM7A 2WMWA 1OKWA 4IFCA 3RCJA 4FSUA 5CYIA 2X2LA 2RKUA 2PMOX 5D7AA 3WYYA 2YITA 1W7HA 3JR1A 4PL3A 1GOLA 4JBOA 3V6RA 3W10A 4I41A 3BKBA 4ZS0A 4BTJA 5HEZA 4ZTRA 4Y46A 3R63A 4GK4A 4H3PA 4TY1A 4D1XA 3QTIA 4IXPA 5CF4A 5CEOA 3G33A 3KMWA 3QLFA 4ZSGA 3W8LA 4ZSJA 4AA0A 3C51A 4W9WA 3RJCA 3ACJA 4JAIA 4UZHA 5AM6A 3MTLA 3UMXA 2PULA 3V5PA 2X7FA 4B8MA 2WNTA 3FL5A 2JLDA 3E8DA 4HOKA 1OPLA 3Q9YA 4JR3A 3TKUA 5C9CA 5M06A 3A60A 2IJMA 4AGCA 4PNIA 4AUAA 2VGOA 5IZFA 5F9EA 3BV3A 5C26A 3LVPA 3O23A 1OL7A 2HXLA 3DGKA 3L9MA 2W05A 3QBNA 3DPKA 3LXPA 4RFYA 4U97A 2R3FA 4G3FA 5HCYA 4HVDA 4EOQA 5DBXA 2WMTA 2UZWE 3C7QA 3CXWA 3QUPA 4IEBA 3FKNA 1Y6AA 3Q5ZA 4QMWA 4WRGA 4FSRA 4GRBA 3I5NA 4I93A 5LVLA 4ZAUA 3KF4A 2WOTA 5HO7A 4U6RA 3ZM9A 2VO6A 4FIHA 4TWNA 2GFSA 4GV1A 4BTFA 4QMSA 1OKYA 1ZXEA 5HG7A 4AZSA 2ONLC 1WBPA 2OSCA 2VO3A 2W1DA 5GZAA 1J7IA 3UVRA 1XH9A 4DH1A 4ANQA 3ZFYA 4JRNA 2BR1A 5AV3A 3GP0A 1FVTA 4A4OA 2HIWA 5HVYA 2QOOA 3IQ7A 3TI1A 4ZTSA 2O63A 4P5QA 4CNHA 3UIUA 4QP1A 1WBTA 4O0VA 2WEIA 1CSNA 3OUKA 3D15A 3D2KA 2LAVA 4ACGA 2WMSA 4K33A 2VWVA 2UUEA 3HUBA 5BQ0A 1M14A 2W5BA 2GS7A 4GJ2A 3K5VA 3TJDA 4TW9A 4EZ3A 4LUDA 3UG1A 5JRQA 1QPCA 4UWCA 3MA3A 2Q0BA 4HZSA 5ETAA 2QQ7A 3TEIA 2XEYA 3VBVA 3S1HA 1NW1A 1UNHA 4R7HA 4FL3A 5DR2A 4F4PA 5C1QB 2BVAA 4J71A 3ZFXA 3IK3A 4EJNA 5EM5A 3EFJA 3R71A 3BE9A 4K0YA 1XH4A 3A8XA 5KE0A 4K18A 2CN8A 2RF9A 4MD9E 4RFZA 4BIBA 4D2SA 4NWMA 2YIRA 3FXWA 3DQWA 4ZTMA 4UMUA 2HK5A 3FMDA 4EH3A 3DLSA 3TKIA 4ZEGA 1DI8A 3FE3A 3KCKA 3P23A 2UZNA 4AW1A 2YDJA 3ZRLA 4HPTE 4NJDA 1QPEA 2VNYA 4L9IA 4X0MA 3SRVB 4FSNA 3OEZA 5HIEA 5HE2A 3UC4A 4UN0C 1IAJA 2BRHA 3DZQA 4QMMA 2PMLX 5AMNA 1OKZA 3LQ8A 2Y6OA 3VS3A 4RZWA 3EMGA 2BRGA 3HV3A 4QMTA 4TRLA 3V6SA 4BDDA 3FMHA 2PVKA 2Z02A 4U9AA 4AGUA 1IG1A 4PDSA 2PVJA 4YLJA 5IEYA 2BKKA 2G2IA 4IDTA 4KBAA 1PXKA 4FNXA 4OGRA 5HE3A 4ZLOA 1J7LA 3MPMA 3EKKA 2ITUA 3IW5A 3PPZA
chains in the Genus database with same CATH superfamily
3CR0A 4GJ3A 3NS9A 4L42A 3FMEA 4KNBA 5I9ZA 3EQIA 3QGYA 3FI3A 4YMJA 2IVSA 2CCHA 3CLYA 5DIAA 2XRWA 3OOGA 1XWSA 1CM8A 4JDHA 5ICPA 4FKWA 4FX3A 4RT7A 4IB1A 4AACA 3KVWA 1XKKA 4N0SA 4G6NA 3ZXTA 4CZTA 3FZRA 5DT4A 4Z3VA 5CF8A 2YIYA 3W2QA 3HVCA 5TF9A 4NH1A 3WARA 5FEQA 1OIRA 4GIIA 4ZZNA 5C8NA 3DU8A 5AP5A 3ZO4A 2PZ5A 5HORA 1TVOA 2PVFA 3F9NA 4KSQA 4XOYA 1XH5A 2NO3A 3W18A 2W1HA 3AC5A 3HV5A 2CGXA 4XBRA 3RZBA 3OCTA 3PIZA 4FVPA 4YR8A 2HXQA 2QOIA 3S0OA 1JQHA 2HWOA 1URWA 3ZUVA 5JEBA 3BLHA 3SV0A 3R7IA 5I9WA 3PP0A 5F20A 1F3MC 5F94A 3FPMA 3FMNA 3FYKX 1MQBA 2C6DA 5I4NA 4QO9A 4QYGA 2BKZA 4EH7A 5JZNA 4RWIA 2OJJA 4FJVA 4JMQA 3E8CA 2W7XA 3ZEWA 5JFWA 1U54B 3M2WA 3WILA 5K4IA 1KE8A 1V0BA 3R9OA 1ZMVA 3H0ZA 4X6RA 4CEGA 5M51A 2KULA 2XH5A 3AGMA 4XRJA 3R8UA 1PXIA 3EYGA 2YAAA 5EQYA 5FG8A 5DPVA 1WVWA 3L1SA 4M66A 4D4SA 5EYCA 3UYTA 3QYWA 3AKLA 3OC1A 3QQUA 4AU8A 4CTBA 4O4BB 4R77A 1OZ1A 4L01A 1UU9A 1LEZA 1F0QA 3VC4A 3TM0A 5J1WA 3V5WA 2WKMA 4KB8A 5E92A 4M0YA 3HRFA 3LAUA 2QHNA 3TZ9A 2NNWB 4PRJA 4QQTA 1Q41A 4RX8A 5FLFA 3WIGA 4D0WA 2CKPA 3NCZA 4AG8A 4DTAA 2PUIA 3B8RA 5L2WA 3FC1X 3LFFA 3ORTA 4QYFA 5M53A 5D1JA 2V62A 4MWIA 4ZS4A 3D83A 3VW8A 5I9XA 3W0MA 1T46A 3BHVA 2UVZA 3MSSA 3U4WA 3Q53A 5AUWA 3FLNC 2Z7SA 4L00A 2YM3A 2YN8A 3ZLSA 4OAUC 1M7NA 3GQIA 4Y73A 3CS9A 5JKGA 4A7CA 3NPCA 5E1EA 5HLNA 3DBEA 4XG8A 2WMQA 5BYZA 4UBAA 5EW3A 1IASA 4YBKA 4K6ZA 4FTKA 4C3FA 4BDAA 2BCJA 3JY9A 2BRBA 4HGTA 1U59A 3RPYA 1IR3A 4R5SA 4EWHA 4FKIA 5CZHA 4QTDA 3SLSA 4FTUA 4Q5HA 3EL8A 4I23A 4RIOA 5G6VA 3C5IA 4ORKA 2B7AA 4TT7A 5K0KA 3ZU7A 4EK8A 4FSYA 5KZIA 4ERWA 2XS0A 5D12A 4FF8A 5GHVA 2CGUA 4AXFA 1HOWA 1ZARA 2GNJA 3ZO2A 1WBSA 2WQBA 4RIYA 3DFCB 3OCBA 4ALUA 4AGWA 3BLAA 2ZJWA 3EQGA 2ZDTA 4DEBA 5FTGA 3CSVA 3BGQA 4FKGA 3DXQA 4YHFA 4JBPA 4DH5A 4XP3A 3K5UA 5EW8A 4Y5HA 4GCJA 3R0TA 4JDJA 4RVLA 4BI0A 2CNUA 5EQEA 4EJ7A 3G15A 5HZNA 3RTPA 2HCKA 4FTJA 3OBGA 2C6MA 1GZOA 1BI7A 1OIUA 3D94A 4CVAA 2OXDA 2GHMA 3TACA 4CFMA 4UWYA 4AF3A 4EUUA 4MHAA 2YFXA 1ZYJA 2YAKA 1JOWB 4W4YA 4AZWA 5HG9A 3KC3A 1OKVA 4A9YA 3R21A 2P3GX 5AIRA 2BTSA 4J97A 1ZZ2A 1EH4A 4FKLA 3ZRMA 4S32A 5EOLA 3CKXA 4MWHA 3R8MA 2XALA 3COKA 4IAKA 1G8SA 2C1AA 3QQKA 3LMIA 1GNGA 3NVMB 5DHJA 4D2PA 3UG2A 5IUGA 4GKIA 3UQFA 5CEIA 2R7BA 5HO6A 4AN2A 1H07A 4LI5A 2WTVA 5LMKC 3DJ5A 3R8VA 3OXIA 3KMMA 1WVXA 2CKEA 3LMGA 4FZ7A 4HGSA 2GS2A 4EH8A 5CENA 2XIXA 4FZDB 5KMJA 4BCGA 4YO4A 4EOIA 4ARKA 5DLSA 1OITA 3V3VA 5DG5A 2BAKA 1NVQA 3PJCA 2WPAA 4HVGA 3W0SA 3K3IA 2J5EA 3RK7A 2F7XE 1YOMA 2YM4A 3UOLA 4D4VA 4DN5A 4O7VA 3PRIA 4W8DA 1R3CA 5JZJA 3B8QA 4DYMA 3PXZA 5D41A 4FYOA 4NSTA 2WTKB 3P0MA 2YERA 1YWNA 2WMBA 3R30A 1W82A 4FSWA 4LV5A 4OW8A 2O5KA 3R04A 4C34A 4DINA 4DCEA 1PXOA 2VX0A 4QP8A 3O5AA 2G2FA 2Z7LA 4L3JA 3IW6A 4U80A 5DEYA 3FSFA 2Y4PA 4M14A 4AE6A 4EOSA 3Q4CA 3BEAA 2B9HA 4ACMA 2Y6MA 1B38A 2GHLA 4D0XA 2YZAA 4M68A 4FSTA 2IZUA 4E73A 5FD2A 4DE4A 2IWIA 2OK1A 3DCVA 1KSWA 4WNOA 2O65A 4CMOA 4WG5A 4R7BA 4X7QA 4O86A 3FC2A 4CV8A 3SKCA 3WOWA 4DBNA 2W1ZA 4JX7A 3VUTA 4EI4A 4O81A 4R8QA 3Q52A 4PTCA 3G2FA 4ITIA 2B1PA 3KULA 5HIBA 4L3LA 4DH7A 3W0QA 1YRPA 2J0LA 2J2IB 2WZJA 5CU6A 3DKGA 1W2CA 4X3FB 3Q60A 3H30A 3IOKA 4KAOA 4RA5A 5AA8A 4I20A 5DYJA 4LL5A 3O8TA 2A1AB 3EZVA 1OL1A 4V04A 3RZFA 2BZJA 4D5HA 4USEA 4IZ5A 3B2TA 3MH1A 4I92A 4LOQA 1P4OA 4M69A 4N4SA 3TG1A 2QONA 3DTCA 5DOSA 3ZLWA 5EK7A 3OY3A 4D2TA 2VTHA 4F64A 4F7NA 4O0WA 2VRXA 3VAPA 3POZA 1PMVA 4IMYA 3Q9WA 4QTBA 3TWJA 4PV0A 3E63A 4O21A 2J90A 4LFIA 4YZDA 3BLRA 4Z16A 2I7QA 3EYHA 2XK9A 2DUVA 4O4FA 4TWOA 1K2PA 5E91A 5AUVA 5K4JA 3IGGA 4O7YA 2W1IA 2CJMA 4IWOA 5CVHA 1Q8YA 3ZH8A 2C4GA 2Y9QA 1OGUA 4QP9A 5CY3A 2GU8A 3H9RA 3JY0A 2NRYA 4MX9A 2JDOA 4I0SA 4QP3A 2R3IA 2UZEA 4YGAA 3C0GA 4X6QC 5AP1A 4YTFA 4AQKA 3OT3A 2GFCA 3NSZA 3QL8A 5CSPA 4BJJA 3BRBA 4FOBA 4NTSA 4QYYA 4S30A 1ZZLA 2XK7A 3BE2A 4UMQA 3VJNA 4A9RA 3QD3A 4N6ZA 5HBJA 4IIRA 3UDZA 2OI4X 2QR8A 5DE2A 5EDPA 5BMSA 5BUJA 3GU5A 5CAOA 2CLXA 3MVMA 4AFJA 1IRKA 5AIKA 3FMMA 2SRCA 3DLZA 3QZHA 3H4JA 2H8HA 3O96A 4TWPA 2OLCA 3PDTA 4C57A 5HE0A 4UALA 5AV1A 4EHZA 2X4FA 4M12A 3RWPA 4C7TA 1BUHA 2OWBA 3QRTA 3EQPA 3R1SA 2Y4IB 4TYJA 4XX9A 4BCQA 4EYMA 4DT8A 2Z7RA 1OIQA 1V0OA 3KK8A 4DAWA 4MYGA 1U46A 1CKJA 3EQRA 4F09A 4QMQA 5L2IA 1M7QA 2BDWA 3LM0A 4TPTA 2WD1A 2WTKC 5TOZA 4EH6A 1V0PA 2E2BA 3ELJA 1XMMA 4XYFA 5KMLA 2VX1A 1H4LA 1ZOHA 4OTQA 2IG7A 2XVDA 3C4XA 3UIXA 3RP9A 5M57A 3Q2JA 1YW2A 3MJ1A 3F3UA 3NUYA 4M13A 4YJPA 4BBFA 3ORIA 3O8PA 3UP2A 3MH0A 5CU3A 5HHWA 3IONA 1KOBA 3AGLA 4FC0A 1YI3A 3MH2A 2PWLA 4PPAA 5E8UA 3SD0A 4CQEA 3VUIA 4UMTA 2FA2A 4MXZA 1VZOA 2XNEA 1MQ4A 2IVTA 2QOLA 2QU6A 2JKMA 5E8ZA 3RWQA 5C4KA 4I6LA 2EB3A 2PVRA 4C4GA 2OZAA 3QCQA 5IUIA 3UOHA 4BI2A 3W0NA 2QLUA 3I6WA 5DH3A 4E26A 4AGDA 4O91A 1R0PA 4RZVA 4QQCA 4AE9A 4GH2A 4U79A 4JXFA 5HTBA 3ENHA 3T3UA 2CNQA 4GK2A 3GGFA 3L9PA 3NIEA 4TKSA 4FNYA 2NPQA 3LFDA 3MN3A 3KA0A 4MD7E 2QOCA 4LMUA 4X3FC 3FI4A 4PPCA 3RALA 3CPCA 3W33A 3ATTA 3GCUA 2VWYA 3R00A 5M44A 1GIHA 2ITVA 2ETRA 2GCDA 2I6LA 3VNTA 4M0ZA 3UYSA 2QG7A 1R0EA 4NEUA 4RWKA 4CYIA 2XNPA 4FTNA 4QMNA 4ANBA 4FICA 3UPZA 1G8AA 4HYIA 5AV0A 2J0KA 1H0WA 4JBVA 4L43A 5CU2A 4EKLA 4WBBB 3TV6A 3GCSA 1ND4A 3C50A 2CLQA 3JYAA 4I0TA 5HNBA 1O6YA 4RRVA 3R7GA 3PE2A 2W5AA 3EFLA 4I4FA 4XG3A 4ZSLA 1PYEA 5CAPA 2P33A 4MXXA 3VS2A 2AC3A 4PDOA 3FUPA 1UU7A 4FK3A 4RVKA 3RBWA 2PZYA 4I0RA 3FLYA 3CPBA 4F9BA 5AR4A 4ASEA 4AXAA 5CSVA 4BCOA 3GU6A 4IC8A 2PVHA 3DAJA 2HW6A 1TQIA 3QQLA 3A7HA 2OH4A 4AXCA 3EFWA 4UWBA 3F69A 5HLWA 1H1QA 1ST0A 4O7NA 3UDTA 2IPXA 2PE0A 2C5XA 5EKNA 2JBPA 3S95A 3PVUA 2Y4IC 3TDVA 4G3DA 1UNLA 4QDVA 3DK7A 4NTTA 3W1FA 3PXRA 4FG9A 4MF1A 4YC3A 4C8BA 3PXKA 2E9UA 3I4BA 1PMEA 3CQUA 1P5EA 3ZM9A 1XH8A 4WNPA 3TV7A 4EQUA 3HAMA 3PFQA 2FSLX 3WF8A 4BCKA 3VF8A 3CD3A 2C0OA 4J53A 4O7SA 2IN6A 2YCSA 1H01A 3NYVA 4N70A 4M67A 4OR5A 3K54A 3CQEA 4YU2A 4FG8A 2JFMA 4JJRA 4ONAA 2YWVA 1YDTE 3LFCA 2C69A 4ZTLA 3TNIA 4DFYA 2JITA 2VTNA 2YIXA 4QPMA 3ZO1A 1L8TA 4MUQA 2W0JA 4QEBA 2YZLA 4ZSEA 4ZY4A 3PVGA 4AW5A 5H2UA 4QQ5A 4BYIA 3B2WA 4O7WA 3GC8A 4OTPA 2X0QA 2X9EA 4DGOA 5EH0A 4EC8A 1J91A 2WMVA 2WO6A 3NLBA 3WE8A 5L2QA 1BKXA 3D7TA 4MTAA 4F7LA 4JT3A 4BR3A 4FIJA 4KABA 5IU2A 1SZMA 4WNMA 4ZMFA 2G2HA 4DGLC 5A54A 5AUYA 3PFYA 2J51A 3QTZA 4FUXA 4TYEA 3RM7A 4DEEA 5I3RA 3W55A 5AP4A 3MPAA 1E1XA 3UIBA 4CLJA 1Q24A 3A7IA 4QTEA 3KN6A 3Q4TA 4BTMA 2UVYA 2BALA 5FTQA 4R3PA 3T9TA 4J95A 4YBJA 4PL5A 5T6KA 3ULZA 4EK4A 3A7JA 4CKJA 3VJOA 3QLGA 3VONA 1WBOA 2BZKB 4JRVA 3GBZA 4YTIA 3TIYA 3DY7A 2FVDA 4OTRA 5EHLA 3ZTXA 4CCUA 2X6DA 3NAYA 3O50A 4BYJA 3RNIA 1DAWA 4I5PA 3DJ7A 3TZ8A 4FL2A 1E1VA 4DCAA 5BYLA 5H8BA 3QF9A 4CV9A 3BYVA 3IW7A 3ZOSA 4I6BA 2ZV8A 2BIKB 3EQFA 3OG7A 1W0XC 3R8ZA 2QURA 4QTCA 4IX4A 4YJSA 3N4TA 1WCCA 4TYGA 5EI6A 3HMPA 1Q62A 4ANLA 4BCFA 2GDOA 3A4OX 2FSOX 3ZFMA 2VUWA 4D2VA 3AKKA 1KOAA 2P4IA 3CGFA 3PSDA 3VUKA 5IQFA 4C59A 2VO0A 2CPKE 1YDRE 4Y83A 2ITTA 3FJQE 3QCXA 3ZBFA 2E9NA 4DA5A 1XQZA 4NCTA 4E5BA 2F7EE 2OH0E 3KRRA 4D1SA 4TXCA 3FMJA 4DITA 3VBYA 3NUAA 4H1MA 4Z7GA 4BB4A 3ML1A 2OKRA 3F2RA 3MGYA 2C47A 2OXXA 4FODA 3VS1A 4FKPA 3Q3BA 3ROYA 3ZHPC 1ZOEA 1XH6A 2JDTA 5J7HA 2PUNA 3HV7A 4RIXB 3QQHA 3G9NA 3DDPA 3PA5A 4MNEB 4FEWA 2ITXA 5M55A 3ZC5A 3QHRA 4IAYA 3VS6A 1Z57A 2Z2WA 3MW1A 2Z7QA 1XO2B 5EM6A 2W9FB 3EQBA 3FHRA 4QDEA 1OPJA 4IE9A 3W0OA 2XKCA 2QLQA 4C3RA 2IZTA 3RPSA 3ACKA 3BX5A 2PZRA 5KCVA 2C0TA 5IA4A 1MRYA 2HZIA 4RSSA 3VHEA 4BDFA 2IEWA 5DRDA 4JR7A 2QHMA 3OCSA 4PPBA 3TJCA 5E8XA 4E20A 1VEBA 4EH2A 5BVFA 3THBA 4EH5A 2B54A 3FDNA 1TQPA 3TUDA 3RK9A 2W99B 5ANKA 2WMRA 1OI9A 2C3JA 3CY3A 3N4VA 3KVXA 3ZLXA 3FSKA 2YM8A 4U43A 4I3ZA 4I1ZA 5J87A 5IA2A 4FNZA 4BI1A 3BBTB 2XYUA 2UW3A 4IB0A 4F65A 3PY0A 2ITWA 3V5QA 1SVEA 2R3NA 1ZAOA 5BPYA 2OFUA 4P5ZA 2W1FA 1OVEA 5GNKA 4F99A 4F1MA 3DAEA 3C4FA 4IX5A 2ETKA 4JOAA 3RAWA 4X2KA 3E62A 3DBQA 3L8VA 3R1YA 4YLLA 5HIDA 4MQ2A 3RNYA 4QP2A 4TTHB 4TYHB 2XIRA 4IHPA 3WI6A 5AV4A 3OS3A 3OXTA 5JGDA 3ZO3A 1GJOA 3RPVA 1LR4A 1Q97A 4A9TA 4C02A 4CRLA 4BDKA 4IADA 4PF4A 4JL9A 3R7UA 3KU2A 3AOXA 2OICA 3JS2A 2Y8OA 1BI8A 5A9UA 4E6QA 3GUBA 1PF8A 2WAJA 3CKWA 4O2ZA 3TT0A 5B7VA 4AZEA 2YLFA 3GFWA 2Q83A 1PJKA 4FV1A 4ZXTA 1IA8A 1NY3A 1YI4A 3QUDA 1M2QA 2YLEA 3FZSA 1F5QA 5CQWA 2AUHA 2XBAA 2EXCX 4X2NA 5CX9A 4CZUA 1PXJA 2XBJA 2HAKA 3G0EA 2XCHA 3ERKA 3PXFA 1GIJA 1G8JA 2UW9A 4L3PA 4FV2A 3V8SA 3HMOA 4FOCA 1JKTA 3OCGA 2UW5A 4OBQA 4U41A 5AV2A 5L6PA 3OZ6A 1PXLA 3OF0A 3NNXA 3QTSA 5AP3A 5FUTA 4GU9A 4JBQA 3AD5A 5AX9A 4G9RA 1VLRA 5FM3A 5JQ5A 3U55A 3PA4A 4FSMA 5IMEA 3NWWA 3OBJA 1UNGA 5ACKA 4O0YA 4BCMA 2RFNA 4IJPA 4AW0A 5AFVA 4NYEA 3FLSA 5IQCA 4BWXA 2QKRA 3R1QA 3ZZEA 3UPXA 3UOJA 3SXFA 4IACA 2R3JA 3ZSHA 2ZDUA 2ZYBA 4IVCA 4FV4A 5FP5A 1H1WA 4G34A 4EH9A 2FYSA 4F7SA 2QCSA 4XOZA 4DTKA 4FA2A 1YWRA 1P4FA 3EJ1A 3QQJA 4AN9A 4CYJA 4LDTA 4FT3A 3WF9A 2XK3A 2IO6A 5I0BA 2YJSA 3HV4A 1P14A 5IQEA 3I6UA 4KIPA 4MQ1A 5CI6A 3MA6A 5FEDA 3TUBA 1Q61A 2XRUA 2A98A 5BMMA 3R2YA 2EVAA 4FV0A 4F6UA 1OL6A 5JSMA 3HAVA 2XNMA 5E8WA 4JVGA 1U54A 1JKLA 2QI8A 4C38A 4XHKB 3UJGA 4QP6A 4BF2A 3N4UA 3DB8A 3FMKA 2XJ2A 3MY1A 4JAJA 4LYNA 1S9JA 2NRUA 3OEFX 1WBVA 1ZWSA 4OTFA 5E8VA 5B2LA 1OL5A 1OBDA 5DA3A 1XHAA 4G2FA 4B7TA 3BU6A 1H00A 1Y6BA 5A4EA 2XIKA 3GNIB 5CVGA 2VAGA 3NX8A 4JI9A 3OUNB 4ZK5A 2OJGA 3ZDIA 3TMOA 2I0VA 3ULIA 2G9XA 2VNWA 4RIWA 3VS0A 5LMBA 1YHVA 3UOKA 2C5VA 5CANA 3A8WA 4G31A 3V04A 1XH7A 3JUHA 3QA8A 3DJ6A 3QRJA 4JS8A 3CIKA 4XLIA 5AR5A 4Q9ZA 2Y0AA 1FMKA 2FH9A 2BROA 2C6OA 3EOCA 4HNFA 3ZBXA 4USFA 4ERKA 5CLPA 2VTPA 3TTJA 2WQOA 1ZY5A 5M4IA 4J98A 4QT1A 5CU0A 2NYAA 4RA4A 5IUHA 2HWPA 2C68A 2R2PA 2F2CB 3I79A 3PG3A 3IW4A 3I0OA 4OTDA 4AZFA 3MPTA 3UMWA 4QPSA 4YURA 3WIKA 3UZTA 4PDYA 5H9BA 3QUEA 2R3KA 5C8KA 4BDBA 3F3TA 4O0RA 3BHTA 5D11A 3R8PA 3ITZA 1H0VA 1OB3A 4W4VA 3AT2A 3NW6A 2ESMA 4CG9A 2CDZA 2PMIA 4BDHA 4MXCA 3G51A 1REKA 2ETMA 4QD6A 4HYUA 4IZ7A 4JX3A 1BL6A 4LRKA 5L4QA 3O2MA 4CG8A 3Q5IA 3F82A 4EH4A 4MK0A 5JN2A 1NT2A 3E64A 3BYMA 2R3RA 4ZY5A 2JC6A 5BX0A 4ZMEA 3BGZA 4FT7A 4C4EA 3AMYA 4AT5A 4C2WA 5T3QA 5AP7A 4BDIA 3QTRA 1A9UA 3DKCA 3OWJA 5HVKA 4H3BA 3GU7A 4K77A 4DEGA 4R5YA 3U9NA 2A2AA 4NIFA 3QZIA 4FV9A 1Q5KA 3ETAA 4W9XA 5AAFA 1VJYA 2OJ9A 3UZRA 3MBLA 2KTYA 3CJFA 4OTGA 3VS7A 1UV5A 4B0GA 4PUZA 2V22A 3BL7A 1J7UA 5J9ZA 2J50A 3NIZA 2BHEA 2XJ0A 4O82A 4BIDA 2WFYA 1BL7A 4IAIA 1Q8UA 1WBWA 2WEVA 3VF9A 1RJBA 3KGAA 5EFQA 1ZY4A 3PLAE 2ITNA 1AGWA 4JG7A 4FGBA 5LMAA 4O7RA 4FTCA 4UV0A 3DKFA 4ALWA 2R3MA 4OAVB 3QD4A 4H3QA 4IX3A 5EYKA 3T9IA 4FTQA 3PY3A 4E4LA 2XANA 3GI3A 4YNEA 2JAVA 4OT5A 3EN7A 1LEWA 5CASA 4BCPA 3N9XA 3RM6A 4RLLA 4CRSA 3LOKA 2RG5A 3E93A 2XB7A 4YHJA 2B9FA 2XMYA 5LOHA 3D2IA 3QZFA 2J9MA 3R28A 3FKLA 3DA6A 4FTOA 1LP4A 2Q0NA 3C4EA 3O51A 5IH4A 3F3WA 4ZIMA 1IA9A 4GK3A 5BYYA 3P78A 4KRCA 4M8TA 3P9JA 2C6KA 3WZEA 4H58A 3N51A 3QQFA 2HZ4A 3SXRA 4Y85A 1XJDA 3I7CA 1VYZA 4XG7A 4F0IA 2UZOA 2RG6A 4ZSAA 4RVMA 5FM2A 2C5OA 4D55A 3RGFA 5ANIA 5DN3A 1HCLA 2PU8A 4FSQA 4ANNA 3G9LX 4FIFA 4DEAA 1WBNA 4C0TA 4GYIA 2VTRA 2HZNA 2JEDA 4XEYA 5HOAA 3A99A 5A6NA 2X8DA 3TTIA 2VD5A 1H25A 5F95A 3EQCA 4IZYA 3NZ0A 2WHBA 4FYNA 3NUXA 3AD6A 3MVLA 3OVVA 4GIHA 3UDSA 3LJ1A 4QP4A 5ANGA 2W1CA 5IQGA 1M17A 2X0PA 4L53A 5HCZA 1H26A 4YZNA 3L8SA 2W5HA 5M4FA 3PA3A 3R22A 2RIOA 4XV1A 3KXXA 2OZOA 4CKRA 2ZV9A 1X8BA 3FZ1A 3VS5A 5CEKA 4O27B 1Q3WA 3PPJA 4RJ7A 3ODZX 3HZTA 2EUFB 5BUEA 4X21A 5FXSA 2ZMDA 3U6IA 3PJ8A 1W98A 1L3RE 2HW7A 2B53A 3G6GA 4FVRA 5CALA 5KBQA 3BL9A 3EHAA 3F5XA 2XNBA 5IA5A 3AC4A 1T45A 2R3HA 5LARA 4D4YA 3E7OA 4IAZA 4JQ7A 4DGNA 3U4UA 3HP2A 4O22A 5KHXA 1Y8GA 4C4JA 1O6LA 4I94A 2BPMA 2V5QA 1QPJA 1R1WA 4J7BA 4PP9A 2VTLA 1PXNA 2GQRA 4D2RA 5CI7A 3D14A 2UZUE 5EHOA 4WSYA 3PUPA 5BVDA 4ACHA 1I44A 3G5DA 4PMPA 2F4JA 3HA8A 3PY1A 3RK5A 3HECA 3RPOA 3U8WA 3ZC6A 5L6WL 3WZUA 2YCRA 3C4WA 4KKHA 3MY5A 1PHKA 3UODA 2P2IA 3A62A 2PE1A 5FDXA 2P55A 3F3ZA 5AR3A 3UNKA 4NZWB 4RIYB 4F1TA 3WZKA 4BL1A 5J5TA 2QD9A 3FYJX 5G1XA 3MIYA 4MXOA 3P5KA 2PVYA 4ANMA 4N6YA 4U44A 4C35A 4RJ6A 4CCBA 4DFLA 4K2RA 4HCTA 4QPAA 4FTAA 3VUDA 4BBEA 4LGDA 4E93A 3BU5A 3IW8A 3VUGA 3KQ7A 2C6TA 3LLTA 5CU4A 4U42A 3RHKA 2AQXA 2I0HA 2VTIA 4FZ6A 4BIEA 5CEMA 2XIZA 3LXNA 5AAGA 4IWQA 3WF6A 5EG3A 3SGCA 2YISA 3RKBA 3KXMA 5GJGA 3FLWA 2OG8A 3CBLA 4QNYA 5AR2A 3P7CA 1Z5MA 2PL0A 3VUHA 4GT3A 3E8EA 5CT0A 4R6VA 2WELA 4WO5A 3LFSA 5M4UA 1LUFA 3FPQA 4BC6A 5E4HA 1Q3DA 4KS7A 4Y95A 3ZDUA 3Q4ZA 5FRIA 3R9DA 5FEEA 2WU6A 1B6CB 3AD4A 1UA2A 3UNJA 1WVYA 3H9OA 3NUNA 3KXNA 1OUYA 1CDKA 3EN5A 4V0GA 2PPQA 4BDCA 4NM7A 4JQEA 2BHHA 3IDBA 3KN5A 4OT6A 2WTDA 3F7ZA 3ORMA 4FTMA 3LXLA 5DR6A 5DT3A 3PXYA 3FZTA 5BVWA 3BWFA 1K3AA 4C62A 2DYLA 4O96A 2JKOA 1J1BA 2ZMCA 3PSBA 1UVRA 4S2ZA 4O0SA 5E8TA 3BELA 1MP8A 4KIKA 5AR8A 4G6OA 4K9YA 2B0QA 5ANJA 3KF7A 4UYAA 3GC9A 4YJNA 4Z7HA 2J0MB 5EM8A 3BLQA 3ID6C 5GJFA 4AXEA 3KREA 2R3QA 4FEQA 4DLIA 4E7WA 3EWHA 3E3BX 4RG0A 3NYXA 2GS6A 2OO8X 4NKSA 3FQHA 3D5WA 4G3CA 2Z60A 4EOJA 5L6OA 4BKYA 4WKQA 3QTQA 4AA5A 3F2AA 4EWQA 4AW2A 2PHKA 3Q04A 4IVBA 4GU6A 5IDPA 2P0CA 2QOFA 5M4CA 5J79A 2BAQA 2HYYA 2R3OA 5A4TA 2B9JA 4L7SA 2REIA 4FSZA 3E87A 3IKAA 4HYSA 5LWMA 2YM5A 3WE4A 3VWAA 4LRMA 2F49A 1ZLTA 1OMWA 4IH8A 4K8AA 5I5ZA 4E3CA 3RAKA 4U45A 2QOHA 4AT3A 4J8MA 5K9IA 4ID7A 3RHXA 2E9PA 3GOPA 4RX9A 3LE6A 3NDMA 3KULB 2YWPA 4XBUA 5FP6A 3P86A 5DVRA 3A7GA 3AC8A 2PY3A 4DG0E 4RVTA 3VBXA 5IQDA 1TZDA 4I6FA 4CSVA 3KXHA 4ASDA 2ACXA 3OROA 1K9AA 3F5GA 4EHEA 3R9HA 5FBOA 3H3CA 5CF6A 1OBGA 4XV2A 4L45A 4M84A 2FGIA 3E8NA 2FO0A 3O7LB 4F78A 4CGAA 4IZAA 3LW0A 2GNHA 4GT5A 5CEPA 3HX4A 2XA4A 3AQVA 4NW6A 3F2NA 3Q32A 3GU4A 2W06A 4ALVA 5GZ9A 2VO7A 4EQCA 2JDVA 3HRCA 3KKVA 4WNKA 3W0PA 4BTKA 4Z55A 1YXUA 3LFAA 2W4JA 3QTWA 2OBJA 3ORZA 4ANSA 3Q9XA 4U8ZA 4E8AA 2XP2A 4E6CA 1GZ8A 5LWNA 4LL0A 4UZDA 5AX3A 1WZYA 4BJJB 4ZTQA 3FQEA 3PWDA 4NUSA 3UQCA 3VQHA 2X81A 4GT4A 4O4DA