2NRUA

Crystal structure of irak-4
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
293
Chain Sequence
RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Crystal structures of IRAK-4 kinase in complex with inhibitors: a serine/threonine kinase with tyrosine as a gatekeeper.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 293
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2nruA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2nruA01
3V6RA 4FZAB 5EDQA 4TWOA 4RWIA 5IMEA 4MBLA 5IQFA 2C30A 2W4OA 4XV2A 3ZXZA 4LFIA 4YURA 5EDRA 3AT4A 2JDTA 3D9VA 2XIKA 4U3YA 1KV2A 3ODZX 3JVRA 4DFUA 1CKJA 4IHPA 5A4CA 3DQWA 5DVRA 2OH4A 4TL0A 3I81A 4LOQA 4PMPA 3DLZA 1URWA 4C3RA 5LARA 3DB6A 2QG7A 1GZOA 5HIEA 3IONA 2J50A 4PX6A 2W5HA 3IPHA 5CNOA 3EQRA 4Z16A 2OZAA 3OG7A 1UKHA 1BL6A 4QP8A 2VTOA 3I5ZA 2LGCA 4I93A 4DG3E 3DK3A 3E8EA 4NCTA 5FUTA 4ORKA 4NJ3A 3DOGA 1Q4LA 5EM7A 2XIRA 3CE3A 1LEWA 4IJPA 3A4PA 3FE3A 4C61A 2HXQA 2ERZE 5IA1A 3F5UA 2W1CA 4O0SA 4QMTA 3GT8A 4YC6A 3G6GA 2B52A 4ZK5A 3WF8A 4EZ3A 5HGIA 2XJ0A 3MY1A 4Q5EA 4PPBA 4JVGA 3VBXA 3D5WA 3DXQA 5HNGA 4DG2E 3E3BX 5DT4A 4NU1A 5ANEA 4JS8A 5IPJA 4G6LA 4KSPA 4BWXA 3QKLA 1JSVA 2ZMDA 3HMMA 4YZMA 3VUIA 5HIDA 4F6WA 3RVGA 4PWNA 4FEXA 3FZOA 3OUNB 5EG3A 2PVYA 5I9UA 2O63A 4O38A 1MQBA 4BWPA 3WF7A 2F2CB 4ZY5A 2ETKA 2GPHA 2VO6A 1NA7A 4UMUA 5FTOA 3A2CA 3GFEA 4FT0A 3U9NA 1H1WA 5FM2A 2WQMA 5IUIA 5DA3A 4TYHB 3VS0A 3KK9A 4MD7E 3PA3A 3F3TA 5KZ0A 2OF4A 2XNEA 4G3CA 4PDSA 1W84A 1WVWA 3DDQA 3OF0A 3OXIA 4IDVA 2BCJA 3E8CA 5EYKA 5K3YA 2QOQA 4F7NA 3L8SA 5HX8A 5M51A 3LFEA 3ALNA 2XH5A 1BYGA 2ITTA 3LFNA 3EZRA 4KIQA 1KOBA 4F4PA 3P0MA 2EU9A 1M52A 4QYHA 2Z8CA 4QP3A 3OC1A 3PJ8A 3MGYA 3ZM4A 2YDKA 3W2SA 2XIZA 3ZBFA 4ACMA 3MW1A 3SC1A 4OTFA 4X3FB 4EOJA 3TZMA 1XKKA 2QC6A 1UA2A 2O3PA 4RJ6A 1BL7A 2XNPA 3PJCA 2JBPA 3PA5A 5AIRA 3DTWA 3JUHA 4K8AA 4DG0E 4D2VA 3TKHA 5CEOA 4DT8A 4XCUA 2DS1A 4RIWA 4FTOA 3NR9A 4QTDA 4OTPA 4D2PA 5EQPA 3ORMA 1FINA 3CPBA 5AIKA 4AN2A 4MYGA 3TDVA 3E5AA 4U79A 4XNEA 2DWBA 2ZM1A 4F65A 4IVDA 4JG8A 4I6QA 4RWLA 4YZNA 5AP5A 2XJ2A 4U42A 5J87A 4AW5A 4YO6A 5AP3A 3R0TA 3MPAA 2HWOA 5BVWA 3EFLA 3V8SA 2E9UA 3IOPA 1ZYJA 4CLJA 3CC6A 2PVNA 5JGDA 4YJRA 2Q0BA 3PUPA 3ZLWA 4D4YA 4Z55A 4DYMA 2CCHA 3E87A 4RIOA 4AA0A 5AUUA 1BMKA 5CYIA 3R8VA 2WMWA 5HBEA 2YCFA 4FV0A 2VTTA 3LM0A 3GC8A 5IUGA 4M68A 2Z60A 4UV0A 2X39A 2H8HA 4G5JA 3R1SA 4H1MA 4D5HA 3FMHA 4NYEA 5ETFA 2VX0A 2PE1A 2CPKE 3E64A 4P90A 3V5JA 3P23A 1CSNA 3A60A 3AD6A 3OZ6A 4OT6A 4JRNA 1KV1A 2YIRA 3KF4A 3KXZA 2FH9A 3OD6X 4HZSA 5AR4A 5ETIA 2IZSA 5K0KA 2OICA 3QD0A 4ANSA 4DH1A 5HLNA 5I9YA 3OOMA 4O6LA 4UZHA 2QOCA 1QPJA 3BU3A 2Y4IB 2VWWA 1RQQA 3PJ3A 4BFMA 5TR6A 1ZWSA 5AV4A 2QONA 2W5AA 4XV1A 4XOZA 1XHAA 3PFQA 5C8NA 2QKWB 4DEBA 3JR1A 3NUAA 3LE6A 3HUCA 3W18A 4IWDA 4NTTA 3DPKA 2CLXA 1BI8A 2WNTA 3KMMA 4USFA 3F82A 3FMKA 2R3PA 1KE8A 5M07A 5HOAA 3NUUA 4BDDA 2YAAA 3HRCA 3R02A 4Y5HA 2WQNA 3QF9A 3UYSA 4ACGA 1KE6A 2XK8A 3AT3A 4O0YA 3TDWA 4J1RA 2IW6A 2YFXA 5CI6A 2EXMA 3OVVA 3PTGA 5JRSA 4AFJA 3GC0A 4C34A 3AC3A 4NL0A 3CP9A 2GTNA 3NZ0A 4B99A 1OIUA 3TNIA 4F1TA 4FKOA 4NM7A 4L42A 4LGGA 1KE5A 4OAUC 3IS5A 3BV2A 2I0YA 4UXLA 3U4WA 5KMKA 2IG7A 3RGFA 5CT7A 3U4UA 5CAVA 2NRYA 3QYZA 2XS0A 2W7XA 3FEGA 1XBBA 4ACCA 3MYGA 4V0GA 5KMJA 2OBJA 4XOYA 3QRKA 3F3WA 4FTNA 4W8DA 3N4TA 2IVUA 3AGMA 3D7TB 1APME 5E92A 4HVHA 3L9NA 4IB0A 1M2RA 4J97A 2JDSA 3QUDA 3PY3A 4JIKA 4U7ZA 1HCKA 3TIZA 3V5TA 4BDAA 4DH8A 3MB7A 5L3AA 1DAWA 4KBCA 4DBNA 4DFLA 1Q8TA 3BWJA 5D1JA 2RFNA 4IFCA 1W7HA 2X81A 1BUHA 3LCOA 1AQ1A 2QOHA 5E90A 4FGBA 5BMSA 5E8ZA 1FVVA 5H8BA 1OIQA 4DLIA 2NNWB 4IVBA 1KOAA 3LPBA 1XH6A 4JX7A 2P3GX 2C3JA 3UNJA 3VS3A 5AUZA 2XKCA 2AUHA 4M15A 2X9EA 3VF8A 3ORNA 2UZDA 1V1KA 3KGAA 2C1AA 4U45A 1KSWA 4FV9A 5J8IA 3C13A 3GCPA 3UP7A 3WZUA 4XRJA 1JSTA 5A4LA 1T45A 4YJTA 3BI6A 5DGZA 3WYXA 1H1SA 4DGGA 5AP2A 4TYGA 2CJMA 3U9CA 3PRIA 3ZHPC 1QMZA 3SKCA 4JAJA 3MESA 4WG5A 5JFXA 4FTTA 5D7VA 2G2FA 4IM0A 3VS7A 3POZA 4BYJA 5IA4A 1WMKA 5AM6A 4WUNA 4XEYA 3FMJA 5LWMA 4KKEA 4AX8A 3EWHA 3UP2A 4IX6A 3QRIA 4Q9ZA 2X2KA 3QL8A 3R1QA 4DFNA 4J96A 5HBHA 3GU7A 4DLJA 4CEGA 4JAIA 4FV7A 3KN6A 4P4CA 3E88A 2R0IA 1YVJA 1J3HA 4XG4A 2PMOX 5DN3A 2ETRA 3QRJA 4UBAA 3MN3A 3Q9XA 2PMLX 5HX6A 3U6JA 3FSKA 5LVLA 3H30A 4AT4A 4FSUA 4HYSA 4D1XA 3KA0A 3FKLA 3EQIA 3ZO1A 4S34A 4IAFA 5C8KA 1OPJA 3CR0A 3R22A 4Y95A 4M7IA 4EH3A 3DB8A 1Y91A 4ZJIA 2B53A 2FUMA 2IVTA 4F0GA 3HLLA 3H10A 3CXWA 4ALWA 4W9XA 3A7FA 1OITA 5HHWA 4JNWA 2PYWA 4U40A 4AACA 2R3NA 1YQJA 2H9VA 2OXYA 4OUCA 4GSBA 4DEIA 5HI2A 5AV1A 4YHJA 3AT2A 4IB3A 3RP9A 1H07A 4CV9A 4E7WA 2C6OA 1Y6AA 5DR9A 3ZXTA 1S9IA 3TUCA 3GBZA 2VTSA 2XM9A 5M55A 2BFXA 4O0VA 3ZMMA 4O27B 5IZFA 5KMMA 5CEKA 2IJMA 3N51A 2EUFB 1F0QA 1GIHA 5CTPA 5D7AA 2QODA 3KU2A 1P5EA 3DAKA 4C02A 1MRYA 1LEZA 3L8XA 4FZDB 3QWJA 4DCEA 4QMQA 4RX5A 1G8AA 3HV7A 5TF9A 3F3UA 3FXZA 5M09A 4C3FA 4HNIA 5LMAA 4JQEA 1JWHA 2V55A 4KIKA 3UIXA 4FODA 5AP7A 4DEAA 4DT9A 4FKVA 5L2SA 2ACXA 1WBPA 4N6ZA 2XNMA 2VWVA 3BGPA 4BICA 3LFQA 4Y85A 2VO0A 3I7CA 3E92A 2YWPA 3P7BA 3PSDA 4FNYA 3RI1A 3V5WA 5FDPA 3GU6A 5AR3A 3U54A 2OW3A 4TRLA 4C4FA 4LV8A 1VJYA 1F5QA 3DNEA 3KRRA 5HCYA 2VV9A 4AS0A 2ONLA 4PL4A 4EKLA 3NCZA 3SRVB 4E6AA 5I9ZA 2YM5A 4XUFA 1XH7A 3QD4A 5JMSA 3LCDA 4FTCA 3N4VA 5AP4A 4BN1A 3SDJA 3A62A 3E8DA 3G9LX 3MVLA 3DT1A 3G5DA 3UG2A 4BTFA 4O0XA 3QALE 3M2WA 4FL1A 5EI2A 4E5BA 3DBEA 3PDTA 3A61A 4O22A 3BZ3A 2B0QA 4XG9A 5I0BA 2ZDTA 3R9OA 3HRFA 4FUYA 5GZ9A 2WTWA 5TOZA 3ZONA 3NMUF 2QOFA 3TXOA 5IH6A 4RSSA 4DFBA 4BTKA 4EH5A 3C4WA 4QMOA 5L4QA 2EB3A 3ORIA 2BALA 3FAAA 3MH0A 2GNGA 2QURA 3BHHA 2AC5A 2C6MA 3GCSA 3GC9A 3IG7A 1PMVA 4FOCA 4UEUA 1R0EA 5JT2A 2VTAA 5BVDA 1PYXA 4C37A 3T9TA 2R3MA 3EJ1A 4CZTA 5AUXA 3TNWA 3VS4A 4C62A 2BPMA 4G6OA 4BBEA 1K2PA 2Y6OA 5CF5A 2UW3A 4BIDA 4IAKA 4QYFA 4LRKA 3MPTA 5E1SA 2ERKA 3MDYA 3EQGA 3R04A 3BE9A 4FK6A 5DG5A 4F9BA 4IVAA 2CCIA 4KNBA 4I0TA 3EQDA 4BBFA 2XEZA 4HGSA 3K5UA 5E8XA 4MXOA 3W8LA 4FE2A 1J7UA 4RX9A 5EW8A 1WVXA 3PE2A 1QPEA 3F5PA 4QTCA 3KEXA 1KE7A 4D58A 1J1CA 4R3RA 3LKMA 4C0TA 3DCVA 4MXAA 3P78A 5HE3A 5GJDA 2R2PA 3C1XA 1OUKA 3QTIA 1UU7A 2Y4IC 3NUPA 5EDPA 3QX2A 1FMOE 4FKJA 4O1OA 5CX9A 4BKYA 3SOCA 3L8PA 4MEDA 5B2MA 3LJ0A 1H01A 3LQ5A 3IW5A 3HL7A 2RIOA 2PZRA 3QUEA 1YWVA 3NNUA 2ZM3A 3SHEA 1IEPA 3QXPA 3VN9A 4CV8A 4IQ6A 4EEVA 4C4JA 2OIQA 4JBOA 3TL8A 1MUOA 5EH0A 5BPYA 3C7QA 2J0MB 2C6IA 2W4JA 4FKRA 3O0GA 4XG3A 5AEPA 4F64A 2VWYA 2WU7A 5JZNA 2J0IA 4C38A 3Q2JA 4J95A 4U3ZA 5F94A 5J7HA 5FBOA 3GXLA 3MJ1A 4GUBA 4RVKA 2O0UA 4J98A 1AD5A 2IN6A 4FTJA 4YPSA 3UOHA 5E8TA 4BZNA 1GJOA 4RGJA 3TACA 4GCJA 4YUQA 3RMFA 4WKQA 2VD5A 3OFMA 5EI8A 1DS5A 3UPXA 4EH4A 3FHIA 1OMWA 5DRBA 4FTRA 2YDJA 4C4IA 5HVYA 4BYIA 1R1WA 3DZQA 4WD5A 3D83A 2JKOA 2UW9A 1YOJA 4QMUA 5CF8A 4RLKA 4I5MA 4I5PA 2XA4A 3KKVA 2G15A 5FBNC 2BZHB 3ATSA 3OWKA 4MVFA 2RL5A 5E8UA 3QLFA 4YC3A 2XK9A 2W9ZB 3QQHA 4LI5A 3OY3A 5DBXA 5TE0A 2BMCA 4DN5A 4QNYA 3MBLA 1SZMA 3DBDA 4RIYA 3TTJA 3ZU7A 2X2LA 3HV6A 2CHLA 1Q8UA 3KULB 3E63A 5A4QA 5LJJA 5AM7A 3W2RA 2JFMA 2OI4X 4J71A 3WZDA 1H24A 4BCQA 2YABA 4X2JA 2VTHA 3RK7A 3S0OA 2BAQA 2R3LA 3PIXA 3PSCA 2YN8A 4FVRA 3TIYA 1LR4A 4IWOA 4D0WA 4CRSA 2UW8A 3ET7A 3VAPA 3R9DA 3JS2A 4S33A 3SLSA 4M12A 4R78A 3Q9ZA 2XNGA 3DA6A 1OKYA 1O6KA 1CDKA 3RPOA 1XH9A 1XH4A 4M0YA 3H9RA 2BIYA 2CN5A 3NYNA 3ERKA 2HK5A 1XWSA 2QOIA 3Q3BA 4RJ7A 2GNHA 3MS9A 4GRBA 3QD3A 3OEZA 4LYNA 3K3IA 4QMMA 3Q52A 3UVPA 2IZTA 2ZMCA 3W8QA 3BRBA 1YDSE 3IGOA 4GK4A 4O0WA 2GCDA 5DWRA 3AC5A 2BRGA 4ID7A 4UWBA 5DEYA 2WKMA 5AP6A 3MVJA 5ETCA 4DH3A 4CLIA 1XBCA 2QOLA 4RZWA 3OCTA 2ZB1A 3IW8A 5JFSA 4EOSA 3MA6A 3VNTA 2QHMA 4H58A 4NIFB 3BCEA 3C9WA 4U41A 3A7HA 2VN9A 3OCBA 2RFDA 2A19B 3G0EA 3QTZA 4ZTQA 3L9MA 5FGKA 3ZFXA 5G6VA 2A4LA 4D2SA 4Z7HA 5HCZA 2HYYA 2PVKA 3A7IA 3PRFA 4QPAA 4AW0A 5I9VA 5KMOA 2HZNA 5FXSA 1R0PA 4CTBA 2PE0A 3V04A 3FI2A 1GZNA 4RC2A 1W82A 4IVCA 1V0BA 5AX3A 3UO4A 3HECA 2QOBA 5CF6A 4PDPA 3LLTA 4B8MA 4PP9A 3KFAA 2OGVA 2WTKB 4FL3A 4UMQA 4IX4A 4JJRA 3W16A 4A9YA 5FWKK 5HVKA 4PUZA 3TI1A 4FEQA 5M4FA 3M1SA 1OECA 4HPTE 4KABA 3ZZEA 3FBVA 5KMLA 2VX1A 2I0HA 4DGMA 2IW9A 4HCUA 4IE9A 2PPQA 3EFWA 3HDMA 4AFEA 3G0FA 3FWQA 3D7ZA 3F9NA 3FLQA 2W5BA 4JX3A 4GKHA 3MPMA 3BGQA 3OY1A 3FC1X 2HW6A 4IB5A 4CGAA 3TNQB 3ZRKA 3COKA 1WCCA 4EUUA 3UVRA 5E1EA 4RIXA 4O84A 5D11A 3FPQA 2I6LA 4EQCA 3G15A 2WEIA 3E7OA 1HOWA 3DDPA 3P79A 4GV1A 4M66A 1U4DA 3RAKA 4EZ7A 3NWWA 2UZUE 1YI3A 2EVAA 3QQUA 4K1BA 5FM3A 4F6UA 2BHEA 2VX3A 5EM5A 1REJA 4BI1A 4X2GA 4W8EA 1YHSA 4JL9A 2VGPA 3IK3A 4FEWA 4ZMEA 3PXZA 4BCHA 4G16A 4LRMA 4UY9A 5AP1A 3EN5A 3FMNA 1WFCA 3QUPA 3VHEA 4AW1A 4IAIA 2XIYA 4EHVA 3ITZA 2VWIA 4FTAA 4O7YA 1V0OA 3OOGA 4ARKA 1G8SA 2ZJWA 5EHYA 3TZ8A 2RF9A 4D55A 4DINA 3AQVA 3MY5A 4IZ7A 5C26A 4YJOA 2O5KA 4QYYA 3N9XA 2H96A 2WQOA 4PMMA 3UTOA 3F3ZA 3DTCA 3UC4A 3LZBA 4DE4A 3RWPA 3L1SA 3RZFA 2VUWA 3VBQA 1OGUA 1OPKA 3ZSIA 2QLQA 4NM0A 4IDTA 3ORKA 5EYMA 3OUKA 4N4SA 1Q3WA 3BYMA 4YTHA 4D4VA 2QG5A 4Q9SA 4XYFA 5M4IA 5E4HA 3G9NA 3NW6A 4JDKA 4CCBA 4CMOA 1NW1A 1OPLA 3PXQA 3CCNA 4AW2A 2WTCA 3ZTXA 3CLYA 1ZOGA 5E9EA 4A4XA 4RJ8A 2GQSA 2WIHA 5J5TA 3F7ZA 1ERKA 5FD2A 4ZMFA 4O86A 2CGXA 3QTRA 3I0OA 4FIEA 4GVJA 3EQBA 4I4EA 3RK5A 5IQHA 5IQEA 4APCA 4FK3A 1M2PA 3ZUUA 4EYJA 2NO3A 3QHRA 3TZ9A 4WNKA 2P2IA 4FT9A 5JQ5A 2E9PA 3O7LD 4FKWA 4FKUA 2PK9A 4I22A 5DE2A 1U5RA 3NIZA 4O2PA 5ITAA 3CQWA 4CT2A 1OZ1A 3ZRLA 4JR7A 5JKGA 4TNDA 1YWRA 3NX8A 4FNXA 5BVEA 4BDKA 4GJ2A 3V8WA 5BVKA 4FKQA 5KBQA 2EWAA 2BUJA 1HCLA 3NUNA 1Q62A 2W0JA 3EN4A 4R77A 4FTLA 1ATPE 5AUYA 4JBPA 4KUJA 1SYKA 2G2HA 4KRDA 3MFRA 4F9WA 2GNFA 5CEMA 3EYHA 2X8DA 3EFJA 2J5FA 3ZZWA 3GOKA 4HGEA 1P4FA 3DXPA 4PDYA 3F2RA 2UZTA 4YJQA 1ZYCA 2C5OA 4K77A 4DEEA 4EHZA 5GZ8A 4AN3A 4E5WA 4BL1A 5LVNA 2WPAA 4QO9A 2PUUA 5CAQA 3Q96A 4BI0A 5IQDA 3COIA 3CEKA 4O1PA 3EYGA 4PDOA 5D10A 1PKGA 3BHYA 4L52A 4JIAA 4RIWB 3NAXA 2IVSA 2GHLA 3ATTA 3SX9A 2E9NA 1E1XA 3F3VA 4GIIA 1UNGA 1OL5A 4S30A 3ID6C 3R28A 1PXJA 3NAYA 4XRLA 5J9LA 3F6XA 3KCFA 4FYOA 4KAOA 4AE9A 4EH2A 4S31A 2JAVA 5ANJA 3GNIB 3VJOA 1FMKA 1M14A 1U5QA 5HCXA 3R8LA 4EOLA 3R9HA 5CXHA 4ZSEA 3UVQA 2UZLA 1XH5A 3H0YA 4FX3A 4TZRA 4NTSA 3LOKA 4BDIA 4V04A 1AGWA 3QZHA 2VAGA 3NUYA 1H1QA 3FL4A 3SQQA 4XH6A 3AMYA 1OKWA 2VO3A 4CFVA 4NWMA 3A99A 2W06A 4FVPA 3IKAA 4LMUA 5AAEA 4KINA 1Q41A 3KF7A 3ACKA 3UO5A 2VWZA 1OB3A 2GHGA 3I60A 1OM1A 4FG9A 2XP2A 4HZRA 2OSCA 3QA8A 5H3QA 3UODA 3F5XA 4K11A 4R1YA 2F2UA 3FLSA 4NW6A 4XBRA 5HORA 3LMIA 4BRXA 4HGTA 4OR5A 3WBLA 2BRNA 5B7VA 1ZZ2A 4KSQA 3QQLA 4DTKA 5M44A 4U0IA 2X6DA 2F7EE 1IR3A 2E9OA 1I44A 3B2TA 3AC8A 4D9TA 3ELJA 3NW5A 4GFMA 3ZUTA 1NVQA 4I41A 3HNGA 4C4EA 3E7VA 4W9WA 4H05A 2PWLA 3EQHA 3Q4TA 4TKSA 4NEUA 3VBTA 2PZIA 3Q53A 4CCUA 3UIMA 3BE2A 4MK0A 3WE4A 3K54A 4CKRA 1YXSA 2UZBA 3WZEA 2WELA 4FZ7A 4LRJA 5BYZA 5JH6A 5K4IA 3QGWA 4RJ4A 3O7LB 4D2TA 4FSWA 5FEQA 2WTJA 2C4GA 3Q5IA 4CMTA 4HNFA 3NSZA 4O7LA 4QRCA 2ZDUA 5D41A 3T3VA 3GGFA 5B0XA 1Q99A 2ITXA 5TT7A 3TKIA 4DCAA 4FT5A 4YZDA 2YWVA 4WBOA 1W83A 2I40A 4LG4A 4EH8A 5E7RA 5K9IA 3D94A 5TKDA 3GP0A 2WFYA 4CRLA 1L8TA 3T8OA 4G3FA 3OMVA 3CTJA 3SV0A 4D28A 2Z02A 5M4CA 4FGRA 4D2RA 3CPCA 4J99A 4RG0A 3V5LA 3KY2A 2RG5A 4CZUA 5CT0A 3EMGA 3ZYAA 2OJFE 4E8AA 4O81A 3TNPC 2HY81 3TG1A 2P0CA 5CLPA 4ZJJA 3RCDA 1QL6A 2XK6A 2QI8A 4O91A 4V0GB 3VC4A 4CYJA 4B0GA 4N57A 3UZPA 4L68A 3WIGA 4BTJA 2X4FA 4E20A 3OT8A 3BHUA 1NVRA 3GFWA 4O21A 3UOJA 3SG8A 1Y8YA 1NT2A 5IA0A 4F9AA 5C4LA 5HLPA 3LFFA 3V5QA 3LJ1A 4YTCA 3NVKI 3VQUA 3FUPA 2E2BA 1P14A 4BCIA 5AR5A 3NVMB 1QPDA 3MIYA 3Q32A 3G33A 4P5ZA 4E6CA 3S3IA 3BEAA 4WNMA 2WTKC 5HG5A 3QCXA 4YNOA 4HOKA 4RQKA 2R3IA 3W32A 4F9YA 2UW0A 1VR2A 2YM3A 3TWJA 5L2IA 3H9OA 4A9SA 2YIWA 3GQIA 2KTYA 3OCGA 4ZOGA 2QR7A 3VS5A 2C0IA 3FZPA 4GH2A 1B6CB 4FTUA 4IZAA 4U8ZA 5GJGA 3RWQA 3TKUA 4PNKA 3NW7A 2QHNA 2XKDA 4QQ5A 5FP6A 1STCE 1OVEA 3PXRA 5I3RA 2PVJA 5IDNA 2FGIA 1SMHA 3UDBA 4UX9A 4DA5A 3LXNA 5EM8A 2CNVA 4ZS4A 2X8EA 4PL5A 4FSRA 1OI9A 4D0XA 4NT4A 5E8WA 4O7SA 3DGKA 5L2TA 4WT6A 4I94A 3CD8A 1O9UA 4RZVA 3DQXA 5IA2A 4DBXA 2WHBA 5ANOA 4AXAA 5BUEA 2BZJA 4RVMA 2DYLA 2JAMA 2B4SB 2XJ1A 5DH3A 2WTVA 3NLBA 2WXVA 4OTHA 4GK3A 3QA0A 5IEVA 3UMWA 3QZGA 1IG1A 3R7GA 4WRSA 3MY0A 5AR7A 5L8KA 2XNOA 3QCYA 1BKXA 4CZYB 3SGCA 3PP1A 5GNKA 3OTVA 1H00A 3UOLA 3W1FA 4BF2A 5CSPA 3PJ1A 5HO8A 4I6FA 1YXUA 2CLQA 2F57A 3FHRA 3FYJX 4ZLOA 3VBWA 4I5CA 3R83A 2UZWE 1RJBA 5KO1A 1M17A 2R7IA 4PTCA 4NCTC 2YM7A 4WSQA 3AMBA 5LMKA 2PUPA 2OIDA 5HKMA 2REIA 1FVTA 4TYHA 4P2KA 4ZSJA 4KS8A 2JITA 2XIXA 5M06A 4PMSA 3NS9A 3TV6A 2YZAA 4CFXA 3AD5A 2JC6A 2ZAZA 5AUWA 4DC2A 1RDQE 3S00A 4EOPA 2ITPA 2O2UA 1R39A 2E9VA 3LJ2A 3PY0A 4IMYA 5HG7A 4ASXA 5IISA 5IUHA 2WMVA 1H08A 3QKKA 3LW0A 4XHKB 5JFWA 4DTBA 3VIDA 1WBTA 4GKIA 4EK5A 2B1PA 5BYLA 3NGAA 2WQBA 1P2AA 4X3FA 5CWZA 5AR8A 2BILB 4DGOA 4QTBA 3D5UA 1A06A 4FG7A 5T6KA 4CG8A 2JGZA 3I7BA 2YM6A 3WARA 4ZLZA 4UYNA 2F9GA 3DLSA 1PMEA 4CFWA 4R3PA 3IQ7A 3V5PA 1PXOA 2JD5A 3HVCA 4EK6A 5HD4A 4FV8A 1IAHA 4AF3A 4X2NA 2JKQA 3LFSA 3QX4A 4ZY6A 4ACHA 2OU7A 4PF4A 2CDZA 2PTKA 3RK9A 2J9MA 4XG2A 2HOGA 3HDNA 3Q6WA 4NW5A 4KIKB 3VBYA 3ENMA 4EK4A 5D12A 1ZOHA 4L8MA 3BYUA 4QQJA 4QMLA 4AGCA 3RPRA 4LGDA 3F61A 3EQCA 3QZIA 5HE2A 4LL5A 3CGOA 3KQ7A 3EN6A 3V51A 3HAVA 1JAMA 4WUAA 4DAWA 4MHAA 1H4LA 4EOOA 1JKSA 2QO9A 3SXRA 1GOLA 3C0HA 4K33A 1LPUA 4N6YA 3O8PA 1GNGA 4KKGA 4FV2A 4Y5QA 3GQLA 4RC3A 5KHXA 4XS2A 2JKKA 2C1BA 3LHJA 2WMSA 2V7AA 4CD0A 3P4KA 1Q24A 1Q8YA 3KB7A 4RLLA 3PZHA 5L2QA 4CQEA 4BCKA 4GIHA 3OT3A 1WBSA 4B4LA 4OTGA 3S4QA 4B8LA 4JQ8A 3BLRA 4S2ZA 3PJ2A 4B7TA 2HZ0A 4EKKA 5AV3A 4RA4A 4FKPA 5EYCA 1JQHA 4G3DA 3W2OA 3RAHA 1IAJA 3I79A 4M69A 3WILA 3ZDUA 1VEBA 4WO5A 2QKRA 4MNEA 4BWKA 5AWMA 2XCKA 2OJIA 4ANQA 2WIPA 2FSLX 2JBOA 2C5VA 2W99B 2XNBA 4FL2A 3BHTA 1TQMA 5ANKA 3JY9A 3PXKA 2XK3A 3GOPA 3CTHA 3R9RA 3PG1A 4BI2A 2QLUA 4QQCA 2OXXA 4IACA 4EOQA 4CTCA 5LOHA 2W4KA 4I0SA 4L43A 5EW9A 3OEFX 4X7QA 2YITA 4C7TA 4AGWA 2UW7A 3REPA 1XQZA 4EHGA 3DKOA 2IZUA 1PJKA 4UN0C 2WU6A 4HYIA 4LUDA 3HMNA 3BWFA 4WA9A 1Q3DA 3JPVA 3B8QA 4G9RA 5IEYA 2UW5A 2R0UA 4P5QA 5E8SA 2BZIB 2JFLA 4GL9A 4IADA 4RVLA 4YJVA 4WG3A 2YIQA 4XBUA 3TV4A 1YXVA 3LXPA 4HVDA 3LMHA 5EOBA 3DXNA 4AG8A 5GINE 2W9FB 5HE0A 4BGQA 2Y8OA 4OTRA 4FV1A 2X2MA 1PKDA 5CSWA 3NRMA 4BDJA 3ZFYA 4L00A 1PXIA 4HVGA 4M14A 3Q6UA 4ASDA 3R7OA 4O7ZA 3OBGA 1W0XC 2BTRA 2F4JA 2XF0A 3ZLXA 3R73A 3WF5A 1Z9XA 4HCVA 2WTDA 5KE0A 4A06A 5CF4A 3QTUA 4XG8A 4YSJA 3D14A 3GI3A 4YTIA 4W4VA 3BLQA 3BHVA 3DZOA 2OF2A 4ITIA 3ZC5A 4BCFA 4GG7A 4H3PA 2Y4PA 4BVUA 1U54B 4HPUE 2BKKA 2YIXA 1REKA 3PXFA 2HXLA 1CM8A 4GK2A 3ZBXA 2QU6A 4FUXA 4APPA 3DNDA 4A9TA 4TWNA 4YO4A 1WVYA 2X4ZA 4AT3A 1JPAA 2YERA 2R3JA 4X6RA 2SRCA 3Q04A 3RM7A 5JN2A 3RHXA 1Y8GA 3DU8A 2YAKA 3I1AA 5DNRA 5BUJA 3BELA 3FQSA 1PMNA 2BROA 3KN5A 4IX3A 1X8BA 4RIYB 5H8EA 4FEUA 4IZ5A 4E6DA 1Q8ZA 3H3CA 2ITWA 2J0JA 2G01A 3VUHA 3FLYA 2UVYA 3ZFMA 1H1RA 2P2HA 4AE6A 3ODYX 4YHFA 1U59A 3IW4A 3Q4ZA 4PY1A 4R8QA 3THBA 4AZWA 5J7BA 5J9ZA 3GCUA 2GMXA 3D2KA 5AJQA 5HICA 1GY3A 2XEYA 1Z5MA 3TTIA 2GHMA 2ZV7A 3BYSA 3RPSA 3SG9A 1YOLA 2OFUA 3P1AA 2CKEA 4GYGA 3UQFA 4O6EA 4HVIA 2ITNA 1ZXEA 4L67A 5C8MA 2JKMA 4D2WA 3TUDA 1PF8A 2GQRA 2YHVA 4Q5HA 1K3AA 1PW2A 2H34A 2X9FA 2C47A 4FBXA 4O0TA 5D9HA 5CENA 4BDEA 1SNUA 3PYYA 3UNZA 4UMRA 4AWIA 4CKIA 1L3RE 2W1EA 4CYIA 1U46A 3WE8A 3UZRA 3L8VA 4FEVA 4RRVA 5HO6A 3TJCA 3DJ5A 5FEDA 3EOCA 5C27A 4E93A 4IWQA 2BIKB 4RX7A 3S1HA 4CSVA 4G6NA 4UMPA 4YZBA 2G2IA 3K5VA 1ZMUA 5CQWA 4PMTA 4FV3A 4ZLYA 1B38A 5IQIA 3FKNA 3OCSA 1ZYDA 4LOPA 3ZS5A 4JXFA 4R5YA 4XP2A 4QMZA 5JZJA 1GAGA 4QYGA 2XK7A 5HQ0A 4H39A 2YLEA 1UV5A 4MTAA 2UZEA 1YWNA 1MP8A 4S32A 1JSUA 2CSNA 4KKHA 4AU8A 3FXXA 4C58A 4EI4A 4EWHA 2C6LA 2F49A 4L6QA 4W4YA 3AOXA 2X8IA 2XBAA 3K2LA 3EQFA 4G17A 5AAGA 3LFBA 4PTEA 4L7FA 3VW6A 2B9IA 3OWJA 5AUVA 5IG1A 2BFYA 3HUBA 4GT4A 4P7EA 3LCTA 2GSFA 3DKFA 3JVSA 3R1YA 3VBVA 5HTBA 4ITJA 5IF1A 4C35A 4CFNA 5BX0A 3FMDA 4ANNA 3BEGA 4AA5A 2V22A 4K2RA 3R63A 4H3QA 3EH9A 4FV4A 3FI3A 1IRKA 4FI1A 4MQ2A 5H2UA 4A9RA 4F1OA 3IW7A 3QTQA 4NM5A 3EN7A 1SVGA 2CGWA 3KCKA 3OWLA 1RE8A 4KB8A 4E4NA 3CKXA 4TYIA 1H27A 3HGKA 3PP0A 4JRVA 4RIXB 4EYMA 4GW8A 5LQFA 3MH3A 3FI8A 4DEGA 1PMUA 1Q8WA 4QPSA 2VTNA 4X2FA 5BVOA 4NUSA 4MH7A 4JG6A 1Q61A 3DAEA 4RWKA 2XYUA 3WIKA 3UZTA 2CGUA 1FVRA 4YGAA 2BAKA 1PXLA 3QTSA 3CS9A 5EK7A 2W05A 4H3BA 2IPXA 4FTIA 4UB7A 1H0VA 2OO8X 2QO7A 4M13A 5CS6A 1G5SA 1BLXA 5EQYA 2ONLC 3KK8A 4EC8A 5FTGA 2AC3A 3C0GA 4X2KA 2C0OA 2WB8A 2I7QA 3BBTB 3ULIA 1J7LA 3AC2A 3MFUA 1FBNA 1W8CA 3ZO4A 4EOIA 4TTHB 3ORTA 3IGGA 4I21A 3MVHA 3E8NA 3MTFA 2VU3A 3FL5A 4HGLA 5KKRC 3IDPA 2XCHA 3QTWA 2PUNA 3H4JA 5CSHA 2R64A 4YZ9A 3NPCA 5KHWA 4YMJA 2CNQA 4JDJA 4F99A 2QOOA 2W1IA 5DHJA 3V8TA 5CSVA 2Y9QA 3EL8A 3QQFA 4TN6A 2B9JA 3R8ZA 4E1ZA 4F6SA 4F7JA 5JFVA 2HCKA 3ANRA 3QD2B 4FOBA 3IW6A 4IAYA 1YDRE 3FMLA 5C1QB 4KBAA 3KVXA 1VZOA 3GCQA 5J1VA 1UU3A 2YJSA 2QQ7A 3LM5A 3O96A 4I6BA 2CN8A 3V3VA 2G9XA 5CASA 2PU8A 3R8UA 1SVEA 3O2MA 5CI7A 4FTMA 2KULA 3ORLA 4K18A 2ZV8A 4QMPA 5FG8A 2HW7A 1CTPE 5TO8A 3ZLSA 3WZKA 4A07A 5CU2A 5KKRB 2I0VA 3KL8A 3PLSA 2GS6A 5L8LA 5HE1A 2PUIA 4USDA 2JEDA 4X21A 4PPCA 2QOKA 4GU6A 1G3NA 5GZAA 3LQ3A 2WMXA 2GS7A 3V6SA 2GFSA 2IZRA 4X3JA 4HJOA 4Z9LA 3LLAA 1YOMA 3G90X 3GEQA 3H9FA 4ANLA 5GIPE 3G6HA 1IA8A 3PPZA 4C2VA 2CKPA 5HU9A 3LVPA 1UNHA 2DUVA 4O7VA 4EK8A 2GFCA 4G31A 4ZTRA 1BI7A 3QKMA 2FB8A 4F09A 5A14A 4K6ZA 3COHA 4J7BA 3L9PA 3VQHA 5IQAA 1UU9A 5CU0A 1M7QA 2PMNX 4NJDA 4QP2A 3UYTA 1PXPA 3UE4A 2VTQA 4LGHA 5DLSA 3HZTA 4QP7A 4XV9A 5M53A 2OZAB 3MA3A 4D5KA 4JG7A 5BNJA 3AC1A 3PIZA 4N0SA 2RG6A 3VUKA 3WYYA 4F63A 4PNIA 3BKBA 2VWBA 4FNZA 3R01A 3C0IA 5KZIA 4ZTLA 4DGLC 3DKCA 5CAPA 2DQ7X 4IW0A 5I5ZA 1KE9A 5HZNA 4MBJA 3EKNA 4MXZA 4RBLA 1OBGA 3TV7A 4OTDA 2YCSA 2VZ6A 1YRPA 4M97A 4MF0A 3ROCA 4ENYA 4C8BA 2C5YA 5CEPA 3D2IA 1B39A 3FZTA 4EC9A 5DMZA 2VNYA 3C4XA 3R8PA 4XLIA 2V0DA 2W1FA 2C6DA 4KD1A 4BKZA 3PSBA 4MXYA 3CD3A 2F7ZE 4K0YA 3R7IA 5ANDA 3UO6A 4CFMA 4FV5A 4CFUA 2JLDA 4FYNA 4ZEGA 3W2QA 3MB6A 3TM0A 4E6QA 3D15A 5F9EA 2HENA 5A4EA 3ETAA 4TT7A 4QP6A 3IDCA 3CSVA 4L7SA 5DOSA 2B7AA 4BDFA 5ACKA 2GU8A 3F7WA 3BU5A 3EL7A 4QOXA 5EI6A 4BGGA 3NNXA 4YC8A 5FEEA 4Z3VA 3MVMA 4F70A 3HRBA 4D4SA 3DBQA 4R5SA 5EFQA 4YZCA 3GU8A 5M57A 3CQEA 4XLVA 5E8YA 5EKOA 3SA0A 1UNLA 3O51A 4LV5A 4FSMA 3VF9A 3MIAA 4ZZNA 2EXEA 2ITYA 2BTSA 3KXMA 3UC3A 1VYZA 4MNFA 4OAVB 3ZEPA 4QP1A 4XG6A 3VUDA 2QVSE 4I20A 2XRWA 3ACJA 1O6YA 5CVGA 1O6LA 4ZAUA 4FICA 4N70A 4CNHA 3JYAA 4NM3A 3U51A 3DFAA 3UGCA 1OIRA 4TW9A 4NH1A 4BCMA 3EHAA 4QTEA 4I3ZA 4OT5A 4PPAA 5IKWA 4FC0A 2YZLA 1H25A 3KMWA 5HD7A 4UWYA 3CTQA 4OTIA 3UOKA 3HKOA 3QTXA 2VTJA 1ZYLA 4ACDA 1NVSA 4EH7A 4ERWA 3HEGA 1CMKE 4FSNA 1P4OA 2O64A 3DJ7A 4BIEA 4WOVA 5AA8A 3IDBA 1E9HA 4IWPA 4AGUA 3HV4A 1TQPA 3GCVA 4AOIA 4YLJA 3ULZA 4IFGA 5J9YA 2WTIA 5C03A 3A8XA 2PVFA 2ITQA 3DY7A 4F7LA 4MD8E 4R7IA 1XBAA 2XBJA 3U87A 4DFYA 4E26A 2J2IB 4E5AX 2BRHA 4TY1A 3Q4UA 2UZOA 4K9YA 3VHKA 4LUEA 4H1JA 2QR8A 1KUTA 4OBOA 3CJFA 3UJGA 5JRQA 1WBWA 5DIAA 4QD6A 4FTQA 4Y73A 4GS6A 3VRZA 3VJNA 3MWUA 3AGLA 4ITHA 3HP2A 5IU2A 2RGPA 3PZEA 4BIBA 4J8NA 2QD9A 5B2LA 2X6EA 3I4BA 3P7AA 3QQJA 4NSTA 2W17A 3DS6A 4TYEA 5CVFA 3H0ZA 4FR4A 4EOMA 1GIJA 2V5QA 4D1ZA 4AZTA 4KBKA 1DI8A 1UWJA 3D0EA 3JY0A 3VUTA 4KRCA 4U44A 4WNOA 5HEZA 2WOUA 5HO7A 2UZNA 3BPRA 5LVPA 3QYWA 4Y72A 3GUBA 5IA5A 4ZIMA 3GB2A 5JK3A 5GIOE 4U9AA 4RT7A 3VULA 4OTWA 4FIGA 1OL6A 3HX4A 3R7UA 4C57A 2QNJA 2Q0NA 4BCOA 3SW7A 4CXAA 3E3PA 3FLWA 3Q9YA 1JVPP 4GU9A 3CJGA 3F69A 4LM5A 5HBJA 5J5SA 4EJ7A 5HU3A 2WMRA 1LP4A 3FLZA 4JOAA 5KUPA 4FT3A 4DFZE 2V7OA 2Z7QA 5KBRA 3R7YA 4E4XA 2BHHA 2YCRA 3RBWA 2ZB0A 2BKZA 3KRXA 2ITUA 4FKLA 4BY9E 3EIDA 1M2QA 5C9CA 3RZBA 5BVNA 5IQGA 4FZFB 4V05A 2BDWA 3BGZA 4FSZA 4M3QA 4V01A 3A8WA 4G1WA 4YBKA 4ZSLA 3ZH8A 5AADA 2R3KA 2UVXA 1A9UA 2WAJA 3HA8A 4YLLA 4EH6A 2QU5A 1JKLA 2ESMA 4HYHA 4YP8A 3ORZA 3KVWA 3PWYA 5EHLA 3R1NA 4O7WA 3RNIA 3HV3A 5C4KA 4AZSA 2OFVA 4QMXA 3BBWA 3PVBA 4EJNA 3FZ1A 4UALA 4YJUA 5CNNA 2CNUA 5JQ8A 4YU2A 3ZRMA 3M42A 4QMSA 4BHZA 2YISA 3LXLA 1IA9A 5KCVA 1OL1A 4OLIA 4EQMA 4LL0A 5CANA 3A7GA 4TYJA 4ZTHA 4ONAA 3ZUVA 3HMIA 2V62A 5C01A 4I1ZA 4EH9A 2XKEA 3ZM9A 2R5TA 5LXMA 4HCTA 2R3FA 5EHOA 3OWPA 1E1VA 2WOTA 2WMBA 2X1NA 2YM8A 4YLKA 3S95A 3ZOSA 4AN9A 3OS3A 4C33A 4ERKA 1FPUA 4NKSA 2OZOA 2R3OA 1H26A 2J4ZA 4GFGA 2C0TA 4XJ0A 5LWNA 4D4RA 5M4UA 1A48A 5IQCA 4DGNA 4AT5A 4FZ6A 4JT3A 2XKFA 1UVRA 4PL3A 3BX5A 3D5XA 4M8TA 3DKGA 3I6WA 3RTPA 4QYEA 3R7VA 3VUGA 5J1WA 4O7TA 2G1TA 4UXQA 1TQIA 2PHKA 4CG9A 4FIFA 4TWCA 5EW3A 5I4NA 3CGFA 2XM8A 5A6NA 4O7NA 4IX5A 2ZV9A 4I6HA 4IH8A 1QPCA 3DFCB 3QBNA 5ICPA 2GDOA 4AOTA 3E62A 2FSOX 3LFAA 1JBPE 3ZSHA 2FVDA 3EQPA 2J5EA 4CQGA 3I6UA 5BUIA 4L3PA 3BU6A 3NYXA 2HELA 3G2FA 5A3XA 2IO6A 3E93A 3V01A 1F3MC 3FSFA 5EM6A 1SNXA 4FVQA 3Q5ZA 3FLNC 2NP8A 3OBJA 4L46A 4IM2A 1YHVA 4WSYA 2I1MA 1M7NA 2PVMA 2W1ZA 4I4FA 5JGBA 4IM3A 4CT1A 5HLWA 3FQEA 4PV0A 4ZTNA 1NXKA 4M69B 5J95A 3F2NA 4L3JA 4XX9A 4U81A 4ANBA 4BDCA 4I23A 4MNEB 2PY3A 2A0CX 5DI1A 4ZS0A 2X7OA 4PRJA 3Q9WA 3VS1A 3R21A 1H0WA 2BDJA 3A4OX 3R71A 2IVVA 4LMNA 4IXPA 5DR2A 1YI6A 1MRVA 4X6QC 1WBVA 3EFKA 3U6HA 2YA9A 3ZLYA 1ZARA 3BYOA 2ETMA 3SXFA 5AV0A 1YKRA 4QQTA 4YR8A 4R6VA 1H1PA 3LQ8A 4LOOA 5CY3A 5CALA 5AFVA 3FMMA 3QC4A 4R7BA 4DEHA 1EH4A 4GVAA 3LCKA 4TXCA 4DH5A 4BCNA 1J1BA 3TEIA 4GYIA 4L01A 4DF3A 3DK6A 2FA2A 2J0KA 4KIOA 2VNWA 2XMYA 4YBJA 4G5PA 1TKIA 4U97A 3S2PA 2HZIA 2IWIA 4HW7A 1XO2B 2PVLA 2NPQA 1YXTA 1GZKA 3RPVA 3QZFA 2OJJA 5L6PA 1YHWA 3C5UA 1YXXA 4O0UA 4M67A 3TCPA 2IW8A 1ZY5A 2J0LA 1PXNA 3F2AA 3NNVA 3FI4A 4U80A 1OKZA 3GU4A 4XV3A 2R4BA 3MFTA 1PXKA 3FKOA 3B8RA 4DH7A 2Y0AA 4KA3A 4FV6A 2BRBA 4BHNA 2YJRA 2CGVA 2WQEA 2W1GA 1PY5A 4O2ZA 5DRDA 3UBDA 3F88A 3VWAA 5HESA 2PZYA 5LVMA 2GTMA 4FMQA 4IB1A 1OBDA 4OGRA 3D5VA 3DK7A 2PZPA 4AQCA 5AA9A 5LMBA 4U5JA 5H8GA 3VVHA 1Y57A 2XK4A 4HYUA 4RMZA 2VGOA 5ANIA 2FSTX 3BYVA 3WOWA 4QTAA 3LMGA 5FLFA 2B9FA 2OH0E 3KXNA 3TT0A 1RW8A 3TUBA 2X7GA 3C4FA 2CKOA 3KREA 2YACA 1JNKA 4FKGA 4F0FA 4DFXE 4C36A 3U55A 3WZJA 1PXMA 5FP5A 3A7JA 3IO7A 3DV3A 3PPKA 3PPJA 4MWIA 4I92A 3N4UA 4MD9E 4E3CA 1WAKA 4KWPA 2ITZA 2XZSA 4J53A 4ZZOA 3QC9A 5B2KA 2XB7A 3HAMA 4L53A 4Y83A 4E73A 4EONA 3FJQE 2JDVA 2BR1A 4UWCA 5T3QA 3C4CA 3FXWA 1W98A 4FSYA 4L45A 1IASA 3ANQA 4YPDA 1YW2A 4RPVA 2ZVAA 1Y6BA 3KRJA 2YLFA 4DTAA 4ANMA 3CQUA 5CU4A 2HZ4A 4MAOA 2B55A 1WZYA 3P9JA 3W55A 3Q60A 3GVUA 4TNBA 4M84A 1Q5KA 4QP9A 3LCSA 2JDOA 5EQEA 1FQ1B 2Z7RA 4QMNA 2HIWA 2FYSA 2B54A 4OBQA 5FRIA 4ASEA 2PMIA 4YSMA 4CFFA 5A9UA 3UIBA 4G3EA 3TJDA 5IQBA 3NEWA 2NRUA 2WD1A 5I3OA 2A27A 2Z7SA 4ANOA 2RKUA 1MQ4A 5A6OA 4D1SA 5E91A 3NIEA 3OROA 5KMNA 4G2FA 1NY3A 2J51A 2RSVA 3KXHA 3MH1A 4Z7GA 3AC4A 2P55A 4MWHA 5L6OA 3I0QA 4WHZA 1DAYA 3COMA 2JIVA 2YIYA 3PLAE 4FSTA 4BDHA 3D7TA 3C4EA 3P7CA 5HNIX 2FO0A 4ZSAA 2JDRA 4IAAA 3II5A 5CZIA 1I09A 4RWJA 2XYNA 4BBMA 5K0XA 2WEVA 4OW8A 3OP5A 5CQUA 4NFMA 5AP0A 2ZV2A 3PE1A 5LMKC 3FYKX 4TWPA 5FDXA 3QAME 4AAAA 4QMWA 4RC4A 3PXYA 4EHEA 5L6WL 2VTLA 1T46A 4J52A 3C4ZA 3R2BA 5J79A 4GEOA 4RJ3A 3R30A 1KWPA 3JXWA 4W4WA 5BMMA 2UZVA 1ZOEA 3FDNA 4C2WA 2QCSA 3OXTA 1J91A 5E8VA 3BQCA 4NKAA 5LCKA 5DFPA 4O0RA 2C6KA 1JKTA 4EK3A 4ZTMA 4C3PA 4F9CA 4I5HA 2AYPA 1FGKA 4BC6A 1Z57A 3RCJA 5M56A 4GJ3A 4LQMA 4BZDA 1XH8A 1ZY4A 4MX9A 4X3FC 5M08A 4BKJA 2HWPA 1OUYA 4CMUA 3P86A 4C59A 1WBNA 2UW6A 5L2WA 2X7FA 2J6MA 3SD0A 3FV8A 4GT3A 4KS7A 4BGHA 5HTIA 4HVSA 3HA6A 5F20A 3KXXA 5CZHA 5ACBC 5IH5A 3OTUA 1OL7A 4AA4A 4II5A 3TN8A 2GNLA 3QHWA 3BQRA 4IBMA 2PVRA 1ND4A 4G34A 2OXDA 3DAJA 4L44A 4X0MA 5AX9A 2WMUA 4JR3A 3SW4A 4H36A 3T9IA 3R8MA 4FKIA 3U8WA 1PHKA 4R1VA 4MCVA 3RALA 5A4TA 1ZLTA 4WIHA 3GC7A 3GENA 4R7HA 5L8JA 3FY2A 2LAVA 5K4JA 2C5XA 2UUEA 3DJ6A 5HNBA 3R00A 4RFYA 2CMWA 1K9AA 3WI6A 4C4HA 1TVOA 2C69A 4B6LA 1UU8A 3VO3A 3O50A 2GNJA 2XNNA 4ENXA 2OLCA 2WMTA 4EUTA 2R7BA 1VYWA 3OXZA 4NK9A 4FIJA 4A4OA 1URCA 4GT5A 1OIYA 3Q4CA 2A2AA 2J7TA 4MKCA 2J90A 4W4XA 3HV5A 4WRGA 5K5NA 3HMOA 4MBIA 4JI9A 1S9JA 5AMNA 4BCPA 4U6RA 4RVTA 2VWUA 2Z2WA 3TNHA 5G1XA 5AAFA 3G51A 5CVHA 2VRXA 5CEIA 3M11A 2R3RA 4EWQA 3QCQA 3RKBA 5IH4A 3EB0A 5I9XA 3MJ2A 2I0EA 4EOKA 1ZAOA 1V0PA 4EL9A 4BDBA 5BQ0A 3RJCA 3F66A 4YNEA 2PE2A 3WF9A 3NDMA 2R3GA 4JDIA 4ZSGA 2EB2A 4DEDA 3MH2A 4RJ5A 4L3LA 4FTKA 4ALUA 3OHTA 1PRYA 4FG8A 1ZMWA 3ZEWA 3DBFA 2XVDA 3MSSA 3POOA 1CKPA 1LUFA 4AZFA 4MF1A 4F7SA 2BRMA 3CBLA 2Q83A 1YDTE 2YEXA 4QP4A 2WMQA 5CU3A 3SRVA 3UNKA 4BCGA 4O96A 2PSQA 4GMYA 5A54A 2UW4A 3KMUA 2Y7JA 3BLHA 2ZOQA 4IZYA 3AD4A 3BV3A 4C4GA 4M0ZA 3B2WA 3KRLA 4EBWA 4JDHA 4NZWB 3AG9A 1U54A 2H6DA 4XP3A 1Q97A 2W1HA 4FA2A 5HG8A 3NYOA 4QMYA 3HP5A 2WO6A 4O7RA 4QT1A 3VS2A 2RFSA 3VS6A 5JSMA 3PWDA 3ROYA 4AUAA 3IECA 4IC8A 2C3KA 3PVWA 3EZVA 3RPYA 4DHFA 3RNYA 5CAUA 3R9NA 2W1DA 2Z7LA 1WBOA 2BAJA 5HG9A 2XRUA 3PA4A 5GHVA 5ANGA 3LFCA 2OJ9A 3R2YA 3ZCLA 3ZO3A 2C5NA 3QCSA 3CIKA 3KRWA 2C6EA 4U43A 1PYEA 4B9DA 3PVUA 4XMOA 1GIIA 4E4LA 4UYAA 4JQ7A 3MTLA 3ZDIA 3RINA 3F5GA 3QQKA 4A9UA 3NUXA 3RAWA 5FTQA 1OKVA 4UMTA 2VTMA 3QU0A 4IC7A 3O23A 4FIHA 3NUSA 3RM6A 3ZC6A 4AOJA 2BZKB 5CXZA 5AR2A 4J8MA 5BYYA 5CU6A 3FMEA 4G9CA 4F0IA 5I9WA 5KX8A 3FC2A 2PVHA 4BZOA 2ZYBA 3UPZA 1J7IA 2OWBA 2R9SA 3EKKA 2B9HA 3QRTA 4FF8A 4KIPA 4RFMA 4PQNA 5EKNA 3UQGA 2GS2A 1XR1A 4IEBA 1BX6A 3DBCA 4YJSA 5CSXA 3FQHA 4RA5A 5F4NA 5IMXA 1CKIA 2GNIA 3UQCA 4ZJVA 4EZ5A 4ZXTA 3MV5A 5F95A 3EN9A 2XUUA 4BCJA 2QO2A 3HMPA 2OJGA 1R78A 3C50A 2VWXA 2VTIA 2W96B 2OKRA 4GUEA 4IANA 5DEWA 4QMVA 5EOLA 2X0GA 4ZZMA 5A46A 3W2PA 2UV2A 3FZRA 4IJ9A 4NFNA 3TZ7A 3UIUA 3CY2A 3KXGA 3GU5A 5FXRA 4WBBB 3ALOA 3LXKA 4ALVA 2OG8A 4TPTA 4BTMA 4ZY4A 4QPMA 4AGDA 3ENHA 2VO7A 4MXXA 4FKTA 3WF6A 3VW8A 4IIRA 5DPVA 3K3JA 3LIJA 3QWKA 3AMAA 1QCFA 4EBVA 4A7CA 2BDFA 1DI9A 1OL2A 5IEXA 3QRUA 4RX8A 2C3IB 5KNJA 3IOKA 3PY1A 5DYJA 5F1ZA 4CVAA 2C3LA 1H8FA 3AXWA 4RQVA 4GG5A 2C6TA 2ITVA 4JLCA 3C51A 2P33A 1FOTA 5ETAA 4AZEA 3FZSA 4FSQA 1H28A 3QFVA 4XP0A 2JIUA 3PVGA 3MFSA 3QGYA 4IAZA 1UWHA 4RFZA 5FQDC 3O17A 4UZDA 3ORXA 3U6IA 3LAUA 4MQ1A 4ZTSA 5EYDA 4F1MA 1YI4A 5JGAA 5KMIA 1DM2A 3HYHA 3O8TA 5K5XA 3SVVA 3KC3A 1SM2A 4WNPA 2WMAA 4I24A 3SAYA 3KULA 3SOAA 2OK1A 2R3HA 5HVJA 1ZZLA 3LFDA 3ORPA 4A4LA 5H9BA 4EORA 4YJPA 4WG4A 3D4QA 3PG3A 2HAKA 1R3CA 4MXCA 3FPMA 3SXSA 2OIBA 2UVZA 5DR6A 3VUMA 2VTRA 1JLUE 3ZSGA 4FNWA 3RHKA 3R7EA 3W2CA 5LVOA 3O71A 2JIIA 4FT7A 2RFEA 4PTGA 2VTPA 2A1AB 2P4IA 3PIYA 1MRUA 4FKSA 4DITA 5IA3A 5LCJA 4Q2AA 1GZ8A 5CAOA 4O82A 4D9UA 3CKWA 3NCGA 5CEQA 4PP7A 2HY0A 4R3CA 5DT0A 3W10A 1SVHA 2YDIA 4E4MA 5JEBA 2ITOA 3I5NA 3ZO2A 3OW3A 3UG1A 4YTFA 1UKIA 2C68A 5GJFA 4O83A 2ZM4A 2EXCX 5HIBA 4JBVA 4ZP5A 5BVFA 4QNAA 4F08A 2PL0A 4I0RA 2PULA 4ASZA 4USEA 4YJNA 5AV2A 4NIFA 4G3GA 4AP7A 3VRYA 4AZVA 3P5KA 3BIZA 4GFOA 3FY0A 3C5IA 2R3QA 2O65A 2BVAA 4Y8DA 4BB4A 3RAIA 1JKKA 3OW4A 4CKJA 2F7XE 1FGIA 3O8UA 3QLGA 3P08A 5AUTA 2PZ5A 3NNWA 3QXOA 5FXQA 4EQUA 3W33A 4OTQA 1ZYSA 3MI9A 3Q2MA 2O8YA 2WZJA 2YCQA 2YM4A 4FIIA 3UMXA 1JOWB 5HTCA 5IDPA 1ZMVA 4OBPA 4BR3A 4BDGA 1ZRZA 2CKQA 4JBQA 5T68A 4L9IA 3NYVA 1XJDA 3L9LA 3CY3A 4YHTA 3T3UA 2Y6MA 3R6XA 2GQGA 4XG7A 2WGJA 4Y46A 3QQGA 2FSMX 5DT3A
chains in the Genus database with same CATH superfamily
3V6RA 4FZAB 5EDQA 4TWOA 4RWIA 5IMEA 4MBLA 5IQFA 2C30A 2W4OA 4XV2A 3ZXZA 4LFIA 4YURA 3BL7A 5EDRA 3AT4A 2JDTA 3D9VA 2XIKA 4U3YA 1KV2A 3ODZX 3JVRA 4DFUA 1CKJA 4IHPA 5A4CA 3DQWA 5DVRA 2OH4A 4TL0A 3I81A 4LOQA 4PMPA 3DLZA 1URWA 4C3RA 5LARA 3DB6A 2QG7A 1GZOA 5HIEA 3IONA 2J50A 4PX6A 2W5HA 3IPHA 5CNOA 3EQRA 4Z16A 2OZAA 3OG7A 1UKHA 1BL6A 4QP8A 2VTOA 3I5ZA 2LGCA 4I93A 4DG3E 3DK3A 3E8EA 4NCTA 2XALA 5FUTA 4ORKA 4NJ3A 3DOGA 1Q4LA 5EM7A 2XIRA 3CE3A 1LEWA 4IJPA 3A4PA 3FE3A 4C61A 2HXQA 2ERZE 5IA1A 3F5UA 2W1CA 4O0SA 4QMTA 3GT8A 4YC6A 3G6GA 2B52A 4ZK5A 3WF8A 4EZ3A 5HGIA 2XJ0A 3MY1A 4Q5EA 4PPBA 4JVGA 3VBXA 3D5WA 3DXQA 5HNGA 4DG2E 3E3BX 5DT4A 3VONA 4NU1A 5ANEA 4JS8A 3UDZA 5IPJA 4G6LA 4KSPA 4BWXA 2XAMA 3QKLA 1JSVA 2ZMDA 3HMMA 4YZMA 3VUIA 5HIDA 4F6WA 3RVGA 4PWNA 4FEXA 3FZOA 3OUNB 5EG3A 2PVYA 5I9UA 2O63A 4O38A 1MQBA 4BWPA 3WF7A 2F2CB 4ZY5A 2ETKA 2GPHA 2VO6A 1NA7A 4UMUA 5FTOA 3A2CA 3GFEA 4FT0A 3U9NA 1H1WA 5FM2A 2WQMA 5IUIA 5DA3A 4TYHB 3VS0A 3KK9A 4MD7E 3PA3A 3F3TA 5KZ0A 2OF4A 2XNEA 4G3CA 4PDSA 1W84A 1WVWA 3DDQA 3OF0A 3OXIA 4IDVA 2BCJA 3E8CA 5EYKA 5K3YA 2QOQA 4F7NA 3L8SA 5HX8A 5M51A 3LFEA 3ALNA 2XH5A 1BYGA 2ITTA 3LFNA 3EZRA 4KIQA 1KOBA 4F4PA 3P0MA 2EU9A 1M52A 4QYHA 2Z8CA 4QP3A 3OC1A 3PJ8A 3MGYA 3ZM4A 2YDKA 3W2SA 2XIZA 3ZBFA 4ACMA 3MW1A 3SC1A 4OTFA 4X3FB 4EOJA 3TZMA 1XKKA 2QC6A 1UA2A 2O3PA 4RJ6A 1BL7A 2XNPA 3PJCA 2JBPA 3PA5A 5AIRA 3DTWA 3JUHA 4K8AA 4DG0E 4D2VA 3TKHA 5CEOA 4DT8A 4XCUA 2DS1A 1TFFA 3NFGB 4RIWA 4FTOA 3NR9A 4QTDA 4OTPA 4D2PA 5EQPA 3ORMA 1FINA 3CPBA 5AIKA 4AN2A 4MYGA 3TDVA 3E5AA 4U79A 4XNEA 2DWBA 2ZM1A 4F65A 4IVDA 4JG8A 4I6QA 4RWLA 4YZNA 5AP5A 2XJ2A 4U42A 5J87A 4AW5A 4YO6A 5AP3A 3R0TA 3MPAA 2HWOA 5BVWA 3EFLA 3V8SA 2E9UA 3IOPA 1ZYJA 4CLJA 3CC6A 2PVNA 5JGDA 4YJRA 2Q0BA 3PUPA 3ZLWA 4D4YA 4Z55A 4DYMA 2CCHA 3E87A 4RIOA 4AA0A 5AUUA 1BMKA 5CYIA 3R8VA 2WMWA 5HBEA 2YCFA 4FV0A 2VTTA 3LM0A 3GC8A 5IUGA 4M68A 2Z60A 4UV0A 2X39A 2H8HA 4G5JA 3R1SA 4H1MA 4D5HA 3FMHA 4NYEA 5ETFA 2VX0A 2PE1A 2CPKE 3E64A 4P90A 3V5JA 3P23A 1CSNA 3A60A 3AD6A 3OZ6A 4OT6A 4JRNA 1KV1A 2YIRA 3KF4A 3KXZA 2FH9A 3OD6X 4HZSA 5AR4A 5ETIA 2IZSA 5K0KA 2OICA 3QD0A 4ANSA 4DH1A 5HLNA 5I9YA 3OOMA 4O6LA 4UZHA 2QOCA 1QPJA 3BU3A 2Y4IB 2VWWA 3AKLA 1RQQA 3PJ3A 4BFMA 5TR6A 1ZWSA 5AV4A 2QONA 2W5AA 4XV1A 4XOZA 1XHAA 3PFQA 5C8NA 2QKWB 4DEBA 3JR1A 3NUAA 3LE6A 3HUCA 3W18A 4IWDA 4NTTA 3DPKA 2CLXA 1BI8A 2WNTA 3KMMA 4USFA 3F82A 3FMKA 2R3PA 1KE8A 5M07A 5HOAA 3NUUA 4BDDA 2YAAA 3HRCA 3R02A 4Y5HA 2WQNA 3QF9A 3UYSA 4ACGA 1KE6A 2XK8A 3AT3A 4O0YA 3TDWA 4J1RA 2IW6A 2YFXA 5CI6A 2EXMA 3OVVA 3PTGA 5JRSA 4AFJA 3GC0A 4C34A 3AC3A 4NL0A 3CP9A 2GTNA 3NZ0A 4B99A 1OIUA 3TNIA 4F1TA 4FKOA 4NM7A 4L42A 4LGGA 4QEBA 1KE5A 4OAUC 3IS5A 3BV2A 2I0YA 4UXLA 3U4WA 5KMKA 2IG7A 3RGFA 5CT7A 3U4UA 5CAVA 2NRYA 3QYZA 2XS0A 2W7XA 3FEGA 1XBBA 4ACCA 3MYGA 4V0GA 5KMJA 2OBJA 4XOYA 3QRKA 3F3WA 4FTNA 4W8DA 3N4TA 2IVUA 3AGMA 3D7TB 1APME 5E92A 4HVHA 3L9NA 4IB0A 1M2RA 4J97A 2JDSA 3QUDA 3PY3A 4JIKA 4U7ZA 1HCKA 3TIZA 3V5TA 4BDAA 4DH8A 3MB7A 5L3AA 1DAWA 4KBCA 4DBNA 4DFLA 1Q8TA 3BWJA 5D1JA 2RFNA 4IFCA 1W7HA 2X81A 1BUHA 3LCOA 1AQ1A 2QOHA 5E90A 4FGBA 5BMSA 5E8ZA 1FVVA 5H8BA 1OIQA 4DLIA 2NNWB 4IVBA 1KOAA 3LPBA 1XH6A 4JX7A 3PFYA 2P3GX 2C3JA 3UNJA 3VS3A 5AUZA 2XKCA 2AUHA 4M15A 2X9EA 3VF8A 3ORNA 2UZDA 1V1KA 3KGAA 2C1AA 4U45A 1KSWA 2XAOA 4FV9A 5J8IA 3C13A 3GCPA 3UP7A 3WZUA 4XRJA 1JSTA 5A4LA 1T45A 4YJTA 3BI6A 5DGZA 3WYXA 1H1SA 4DGGA 5AP2A 4TYGA 2CJMA 3U9CA 3PRIA 3ZHPC 1QMZA 3SKCA 4JAJA 3MESA 4WG5A 5JFXA 4FTTA 5D7VA 4FRFA 2G2FA 4IM0A 3VS7A 3POZA 4BYJA 5IA4A 1WMKA 5AM6A 4WUNA 4XEYA 3FMJA 5LWMA 4KKEA 4AX8A 3EWHA 3O5AA 3UP2A 4IX6A 3QRIA 4Q9ZA 2X2KA 3QL8A 3R1QA 4DFNA 4J96A 5HBHA 3GU7A 4DLJA 4CEGA 4JAIA 4FV7A 3KN6A 4P4CA 3E88A 3P5JC 2R0IA 1YVJA 1J3HA 4XG4A 2PMOX 5DN3A 2ETRA 3QRJA 4UBAA 3MN3A 3Q9XA 2PMLX 5HX6A 3U6JA 3FSKA 5LVLA 3H30A 4AT4A 4FSUA 4HYSA 4D1XA 3KA0A 3FKLA 3EQIA 3ZO1A 4S34A 4IAFA 5C8KA 1OPJA 3CR0A 3R22A 4Y95A 4M7IA 4EH3A 3DB8A 1Y91A 4ZJIA 2B53A 2FUMA 2IVTA 4F0GA 3HLLA 3H10A 3CXWA 4ALWA 4W9XA 3A7FA 1OITA 5HHWA 4JNWA 2PYWA 4U40A 4AACA 2R3NA 1YQJA 2H9VA 2OXYA 4OUCA 4GSBA 4DEIA 5HI2A 5AV1A 4YHJA 3AT2A 4IB3A 3RP9A 1H07A 4CV9A 4E7WA 2C6OA 1Y6AA 5DR9A 3ZXTA 1S9IA 3TUCA 3GBZA 2VTSA 2XM9A 5M55A 2BFXA 4O0VA 3ZMMA 4O27B 5IZFA 5KMMA 5CEKA 2IJMA 3N51A 2EUFB 1F0QA 1GIHA 5CTPA 5D7AA 2QODA 3KU2A 1P5EA 3DAKA 4C02A 1MRYA 1LEZA 3L8XA 4FZDB 3QWJA 4DCEA 3UDSA 2AEGA 4QMQA 4RX5A 1G8AA 3HV7A 5TF9A 3F3UA 3FXZA 5M09A 4C3FA 4HNIA 5LMAA 4JQEA 1JWHA 2V55A 4KIKA 3UIXA 4FODA 5AP7A 4DEAA 4DT9A 4FKVA 5L2SA 2ACXA 1WBPA 4N6ZA 2XNMA 2VWVA 3BGPA 4BICA 3LFQA 4Y85A 2VO0A 3I7CA 3E92A 2YWPA 3P7BA 3PSDA 4FNYA 3RI1A 3V5WA 5FDPA 4AXFA 3GU6A 5AR3A 3U54A 2OW3A 4TRLA 4C4FA 4LV8A 1VJYA 1F5QA 3DNEA 3KRRA 5HCYA 2VV9A 4AS0A 2ONLA 4PL4A 4EKLA 3NCZA 3SRVB 4E6AA 5I9ZA 2YM5A 4XUFA 1XH7A 3QD4A 5JMSA 3LCDA 4FTCA 3ML1A 3N4VA 5AP4A 4BN1A 3SDJA 3A62A 3E8DA 3G9LX 3MVLA 3DT1A 3G5DA 3UG2A 4BTFA 4O0XA 3QALE 3M2WA 4FL1A 5EI2A 4E5BA 3DBEA 3PDTA 3A61A 4O22A 3BZ3A 2B0QA 4XG9A 5I0BA 2ZDTA 3R9OA 3HRFA 4FUYA 5GZ9A 2WTWA 5TOZA 3ZONA 3NMUF 2QOFA 3TXOA 5IH6A 4RSSA 4DFBA 4BTKA 4EH5A 3C4WA 4QMOA 5L4QA 2EB3A 3ORIA 2BALA 3FAAA 3MH0A 2GNGA 2QURA 3BHHA 2AC5A 2C6MA 3GCSA 3GC9A 3IG7A 1PMVA 4FOCA 4UEUA 1R0EA 5JT2A 2VTAA 5BVDA 1PYXA 4C37A 3T9TA 2R3MA 3EJ1A 4CZTA 5AUXA 3TNWA 3VS4A 4C62A 3NFFB 2BPMA 4G6OA 4BBEA 1K2PA 2Y6OA 5CF5A 2UW3A 4BIDA 4IAKA 4QYFA 4LRKA 3MPTA 5E1SA 2ERKA 3MDYA 3EQGA 3R04A 3BE9A 4FK6A 5DG5A 4F9BA 4IVAA 2CCIA 4KNBA 4I0TA 3EQDA 4BBFA 2XEZA 4HGSA 3K5UA 5E8XA 4MXOA 3W8LA 4FE2A 1J7UA 4RX9A 5EW8A 1WVXA 3PE2A 1QPEA 3F5PA 4QTCA 3KEXA 1KE7A 4D58A 1J1CA 4R3RA 3LKMA 4C0TA 3DCVA 4MXAA 3P78A 5HE3A 5GJDA 2R2PA 3C1XA 1OUKA 3QTIA 1UU7A 2Y4IC 3NUPA 5EDPA 3QX2A 1FMOE 4FKJA 4O1OA 5CX9A 4BKYA 3SOCA 3L8PA 4MEDA 5B2MA 3LJ0A 1H01A 3LQ5A 3IW5A 3HL7A 2RIOA 2PZRA 3QUEA 1YWVA 3NNUA 1TZDA 2ZM3A 3SHEA 1IEPA 3QXPA 3VN9A 4CV8A 4IQ6A 4EEVA 4C4JA 2OIQA 4JBOA 3TL8A 1MUOA 5EH0A 5BPYA 3C7QA 2J0MB 2C6IA 2W4JA 4FKRA 3O0GA 4XG3A 5AEPA 4F64A 2VWYA 2WU7A 5JZNA 2J0IA 4C38A 3Q2JA 4J95A 4U3ZA 5F94A 5J7HA 5FBOA 3GXLA 3MJ1A 4GUBA 4RVKA 2O0UA 4J98A 1AD5A 2IN6A 4FTJA 4YPSA 3UOHA 5E8TA 4BZNA 1GJOA 4RGJA 3TACA 3PUFC 4GCJA 4YUQA 3RMFA 4WKQA 2VD5A 3OFMA 5EI8A 1DS5A 3UPXA 4EH4A 3FHIA 1OMWA 5DRBA 4FTRA 2YDJA 4AXDA 4C4IA 5HVYA 4BYIA 1R1WA 3DZQA 4WD5A 3D83A 2JKOA 2UW9A 1YOJA 4QMUA 5CF8A 4RLKA 4I5MA 4I5PA 2XA4A 3KKVA 2G15A 5FBNC 2BZHB 3ATSA 3OWKA 4MVFA 2RL5A 5E8UA 3QLFA 4YC3A 2XK9A 2W9ZB 3QQHA 4LI5A 3OY3A 5DBXA 5TE0A 2BMCA 4DN5A 4QNYA 3MBLA 1SZMA 3DBDA 4RIYA 3TTJA 3ZU7A 2X2LA 2A98A 3HV6A 2CHLA 1Q8UA 3KULB 3E63A 5A4QA 5LJJA 4DHIB 5AM7A 3W2RA 2JFMA 2OI4X 4J71A 3WZDA 1H24A 4BCQA 4I6LA 2YABA 4X2JA 2VTHA 3RK7A 3S0OA 2BAQA 2R3LA 3PIXA 3PSCA 2YN8A 4FVRA 3TIYA 1LR4A 4IWOA 4D0WA 3BLAA 4CRSA 2UW8A 3ET7A 3VAPA 3R9DA 3JS2A 4S33A 3SLSA 4M12A 4R78A 3Q9ZA 2XNGA 3DA6A 1OKYA 1O6KA 1CDKA 3RPOA 1XH9A 1XH4A 4M0YA 3H9RA 2BIYA 2CN5A 3NYNA 4AAYA 3ERKA 2HK5A 1XWSA 2QOIA 3Q3BA 4RJ7A 2GNHA 3MS9A 4GRBA 3QD3A 3OEZA 4LYNA 3K3IA 4QMMA 3Q52A 3UVPA 2IZTA 2ZMCA 3W8QA 3BRBA 1YDSE 3IGOA 4GK4A 4O0WA 2GCDA 5DWRA 3AC5A 2BRGA 4ID7A 4UWBA 5DEYA 2WKMA 5AP6A 3MVJA 5ETCA 4DH3A 4CLIA 1XBCA 2QOLA 4RZWA 3OCTA 2ZB1A 3IW8A 5JFSA 4EOSA 3MA6A 3VNTA 2QHMA 4H58A 4NIFB 3BCEA 3C9WA 4U41A 3A7HA 2VN9A 3OCBA 2RFDA 2A19B 3G0EA 3QTZA 4ZTQA 3L9MA 5FGKA 3ZFXA 5G6VA 2A4LA 4D2SA 4Z7HA 3AKJA 5HCZA 2HYYA 2PVKA 3A7IA 3PRFA 4QPAA 4AW0A 5I9VA 5KMOA 2HZNA 5FXSA 1R0PA 4CTBA 2PE0A 3V04A 3FI2A 1GZNA 4RC2A 1W82A 4IVCA 1V0BA 5AX3A 3UO4A 3HECA 2QOBA 5CF6A 4PDPA 3LLTA 4B8MA 4PP9A 3KFAA 2OGVA 2WTKB 4FL3A 4UMQA 4IX4A 4JJRA 3W16A 4A9YA 5FWKK 5HVKA 4PUZA 3TI1A 4FEQA 5M4FA 3W0QA 3M1SA 1OECA 4HPTE 4KABA 3ZZEA 3FBVA 5KMLA 2VX1A 2I0HA 4DGMA 2IW9A 4HCUA 4IE9A 2PPQA 3EFWA 3HDMA 4AFEA 3G0FA 3FWQA 3D7ZA 3F9NA 3FLQA 2W5BA 4JX3A 4GKHA 3MPMA 3BGQA 3OY1A 3FC1X 2HW6A 4IB5A 4CGAA 3TNQB 3ZRKA 3COKA 1WCCA 4EUUA 3UVRA 5E1EA 4RIXA 4O84A 5D11A 3FPQA 2I6LA 4EQCA 3G15A 2WEIA 3E7OA 1HOWA 3DDPA 3P79A 4GV1A 4M66A 1U4DA 3RAKA 4EZ7A 3NWWA 2UZUE 1YI3A 2EVAA 3QQUA 4K1BA 5FM3A 4F6UA 2BHEA 2VX3A 5EM5A 1REJA 4BI1A 4X2GA 4W8EA 1YHSA 4JL9A 2VGPA 3IK3A 4FEWA 4ZMEA 3PXZA 4BCHA 4G16A 4LRMA 4UY9A 5AP1A 3EN5A 3FMNA 1WFCA 3QUPA 3VHEA 4AW1A 4IAIA 2XIYA 4EHVA 3ITZA 2VWIA 4FTAA 4O7YA 1V0OA 3OOGA 4ARKA 1G8SA 2ZJWA 5EHYA 3TZ8A 2RF9A 4D55A 4DINA 3AQVA 3MY5A 4IZ7A 5C26A 4YJOA 2O5KA 4QYYA 3N9XA 2H96A 2WQOA 4PMMA 3UTOA 3F3ZA 3DTCA 3UC4A 3LZBA 4DE4A 3RWPA 3L1SA 3RZFA 2VUWA 3VBQA 1OGUA 1OPKA 3ZSIA 2QLQA 4NM0A 4IDTA 3ORKA 5EYMA 3OUKA 4N4SA 1Q3WA 3BYMA 4YTHA 4D4VA 2QG5A 4Q9SA 4XYFA 5M4IA 5E4HA 3W0MA 3G9NA 3NW6A 4JDKA 4CCBA 4CMOA 1NW1A 1OPLA 3PXQA 3CCNA 4AW2A 2WTCA 3ZTXA 3CLYA 1ZOGA 5E9EA 4A4XA 4RJ8A 2GQSA 2WIHA 5J5TA 3F7ZA 1ERKA 5FD2A 4ZMFA 4O86A 2CGXA 3QTRA 3I0OA 4FIEA 4GVJA 3EQBA 4I4EA 3RK5A 5IQHA 5IQEA 4APCA 4FK3A 1M2PA 3ZUUA 4EYJA 2NO3A 3QHRA 3TZ9A 4WNKA 2P2IA 4FT9A 5JQ5A 2E9PA 3O7LD 4FKWA 4FKUA 2PK9A 4I22A 5DE2A 1U5RA 3NIZA 4O2PA 5ITAA 3CQWA 4CT2A 1OZ1A 3ZRLA 4JR7A 5JKGA 4TNDA 1YWRA 3NX8A 4FNXA 5BVEA 4BDKA 4GJ2A 3V8WA 5BVKA 4FKQA 5KBQA 2EWAA 2BUJA 1HCLA 3NUNA 1Q62A 2W0JA 3EN4A 4R77A 4FTLA 1ATPE 5AUYA 4JBPA 4KUJA 1SYKA 2G2HA 4KRDA 3MFRA 4F9WA 2GNFA 5CEMA 3EYHA 2X8DA 3EFJA 2J5FA 3ZZWA 3GOKA 4HGEA 1P4FA 3DXPA 4PDYA 3F2RA 2UZTA 4YJQA 1ZYCA 2C5OA 4K77A 4DEEA 4EHZA 5GZ8A 4AN3A 4E5WA 4BL1A 5LVNA 2WPAA 4QO9A 2PUUA 5CAQA 3Q96A 4BI0A 5IQDA 3COIA 3CEKA 4O1PA 3EYGA 4PDOA 5D10A 1PKGA 3BHYA 4L52A 4JIAA 4RIWB 3NAXA 2IVSA 2GHLA 3ATTA 3SX9A 2E9NA 1E1XA 3F3VA 4GIIA 1UNGA 1OL5A 4S30A 3ID6C 3R28A 1PXJA 3NAYA 4XRLA 5J9LA 3F6XA 3KCFA 4FYOA 4KAOA 4AE9A 4EH2A 4S31A 2JAVA 5ANJA 3GNIB 3VJOA 1FMKA 1M14A 1U5QA 5HCXA 3R8LA 4EOLA 3R9HA 5CXHA 4ZSEA 3UVQA 2UZLA 1XH5A 3H0YA 4FX3A 4TZRA 4NTSA 3LOKA 4BDIA 4V04A 1AGWA 3QZHA 2VAGA 3NUYA 1H1QA 3FL4A 3SQQA 4XH6A 3AMYA 1OKWA 2VO3A 4CFVA 4NWMA 3A99A 2W06A 4FVPA 3IKAA 4LMUA 5AAEA 4KINA 1Q41A 3KF7A 3ACKA 3UO5A 2VWZA 1OB3A 2GHGA 3I60A 1OM1A 4FG9A 2XP2A 4HZRA 2OSCA 3QA8A 5H3QA 3UODA 3F5XA 4K11A 4R1YA 2F2UA 3FLSA 4NW6A 4XBRA 5HORA 3LMIA 4BRXA 4HGTA 4OR5A 3WBLA 2BRNA 5B7VA 1ZZ2A 4KSQA 3QQLA 4DTKA 2IF8A 5M44A 4U0IA 2X6DA 2F7EE 1IR3A 2E9OA 1I44A 3B2TA 3AC8A 4D9TA 3ELJA 3NW5A 4GFMA 3ZUTA 1NVQA 4I41A 3HNGA 4C4EA 3E7VA 4W9WA 4H05A 2PWLA 3EQHA 3Q4TA 4TKSA 4NEUA 3VBTA 2PZIA 3Q53A 4CCUA 3UIMA 3BE2A 4MK0A 3WE4A 3K54A 4CKRA 1YXSA 2UZBA 3WZEA 2WELA 4FZ7A 4LRJA 5BYZA 5JH6A 5K4IA 3QGWA 4RJ4A 3O7LB 4D2TA 4FSWA 5FEQA 2WTJA 2C4GA 3Q5IA 4CMTA 4HNFA 3NSZA 4O7LA 4QRCA 2ZDUA 5D41A 3T3VA 3GGFA 5B0XA 1Q99A 2ITXA 5TT7A 3TKIA 4DCAA 4FT5A 4YZDA 2YWVA 4WBOA 1W83A 2I40A 4LG4A 4EH8A 5E7RA 5K9IA 3D94A 5TKDA 3GP0A 2WFYA 4CRLA 1L8TA 3T8OA 4G3FA 3OMVA 3CTJA 3SV0A 4D28A 2Z02A 5M4CA 4FGRA 4D2RA 3CPCA 4J99A 4RG0A 3V5LA 3KY2A 2RG5A 4CZUA 5CT0A 3EMGA 3ZYAA 2OJFE 4E8AA 4O81A 3TNPC 2HY81 3TG1A 2P0CA 5CLPA 4ZJJA 3RCDA 1QL6A 2XK6A 2QI8A 4O91A 4V0GB 3VC4A 4CYJA 4B0GA 4N57A 3UZPA 4L68A 3WIGA 4BTJA 2X4FA 4E20A 3OT8A 3BHUA 1NVRA 3GFWA 4O21A 3UOJA 3SG8A 1Y8YA 1NT2A 5IA0A 4F9AA 5C4LA 5HLPA 3LFFA 3V5QA 3LJ1A 4YTCA 3NVKI 3VQUA 3FUPA 2E2BA 1P14A 4BCIA 5AR5A 3NVMB 1QPDA 3MIYA 3Q32A 3G33A 4P5ZA 4E6CA 3S3IA 3BEAA 4WNMA 2WTKC 5HG5A 3QCXA 4YNOA 4HOKA 4RQKA 2R3IA 3W32A 4F9YA 2UW0A 1VR2A 2YM3A 3TWJA 5L2IA 3H9OA 4A9SA 2YIWA 3GQIA 2KTYA 3OCGA 4ZOGA 2QR7A 3VS5A 2C0IA 3FZPA 4GH2A 1B6CB 4FTUA 4IZAA 4U8ZA 5GJGA 3RWQA 3TKUA 4PNKA 3NW7A 2QHNA 2XKDA 4QQ5A 5FP6A 1STCE 1OVEA 3PXRA 5I3RA 2PVJA 5IDNA 2FGIA 1SMHA 3UDBA 4UX9A 4DA5A 3LXNA 5EM8A 2CNVA 4ZS4A 2X8EA 4PL5A 4FSRA 1OI9A 4D0XA 4NT4A 5E8WA 4O7SA 3DGKA 5L2TA 4WT6A 4I94A 3CD8A 1O9UA 4RZVA 3DQXA 5IA2A 4DBXA 2WHBA 5ANOA 4AXAA 5BUEA 2BZJA 4RVMA 2DYLA 1OGYA 2JAMA 2B4SB 2XJ1A 5DH3A 2WTVA 3NLBA 2WXVA 4OTHA 4GK3A 3QA0A 5IEVA 3UMWA 3QZGA 1IG1A 3R7GA 4WRSA 3MY0A 5AR7A 5L8KA 2XNOA 3QCYA 1BKXA 4CZYB 3SGCA 3PP1A 5GNKA 3OTVA 1H00A 3UOLA 3W1FA 4BF2A 5CSPA 3PJ1A 5HO8A 4I6FA 1YXUA 2CLQA 2F57A 3FHRA 3FYJX 4ZLOA 3VBWA 4I5CA 3R83A 2UZWE 1RJBA 5KO1A 1M17A 2R7IA 4PTCA 4NCTC 2YM7A 4WSQA 3AMBA 5LMKA 2PUPA 2OIDA 5HKMA 2REIA 1FVTA 4TYHA 4P2KA 4ZSJA 4KS8A 2JITA 2XIXA 5M06A 4PMSA 3NS9A 3TV6A 2YZAA 4CFXA 3AD5A 2JC6A 2ZAZA 5AUWA 4DC2A 1RDQE 3S00A 4EOPA 2ITPA 2O2UA 1R39A 2E9VA 3LJ2A 3PY0A 4IMYA 5HG7A 4ASXA 5IISA 5IUHA 2WMVA 1H08A 3QKKA 3LW0A 4XHKB 5JFWA 4DTBA 3VIDA 1WBTA 4GKIA 4EK5A 2B1PA 5BYLA 3NGAA 2WQBA 1P2AA 4X3FA 5CWZA 5AR8A 2BILB 4DGOA 4QTBA 3D5UA 1A06A 4FG7A 5T6KA 4CG8A 2JGZA 3I7BA 2YM6A 3WARA 4ZLZA 4UYNA 2F9GA 3DLSA 1PMEA 4CFWA 4R3PA 3IQ7A 3V5PA 1PXOA 2JD5A 3HVCA 4EK6A 5HD4A 4FV8A 1IAHA 4AF3A 4X2NA 2JKQA 3LFSA 3QX4A 4ZY6A 4ACHA 2OU7A 4PF4A 2CDZA 2PTKA 3RK9A 2J9MA 4XG2A 2HOGA 3HDNA 3Q6WA 4NW5A 4KIKB 3VBYA 3ENMA 4EK4A 5D12A 3AKKA 1ZOHA 4L8MA 3BYUA 4QQJA 4QMLA 4AGCA 3RPRA 4LGDA 3F61A 3EQCA 3QZIA 5HE2A 4LL5A 3CGOA 3KQ7A 3EN6A 3V51A 3HAVA 1JAMA 4WUAA 4DAWA 4MHAA 1H4LA 4EOOA 1JKSA 2QO9A 3SXRA 1GOLA 3C0HA 4K33A 1LPUA 4N6YA 3O8PA 1GNGA 4KKGA 4FV2A 4Y5QA 3GQLA 4RC3A 5KHXA 4XS2A 2JKKA 2C1BA 3LHJA 2WMSA 2V7AA 4CD0A 3P4KA 1Q24A 1Q8YA 3KB7A 4RLLA 3PZHA 5L2QA 4CQEA 4BCKA 4GIHA 3OT3A 1WBSA 4B4LA 4OTGA 3S4QA 4B8LA 4JQ8A 3BLRA 4S2ZA 3PJ2A 4B7TA 2HZ0A 4EKKA 5AV3A 4RA4A 4FKPA 5EYCA 1JQHA 4G3DA 3W2OA 3RAHA 1IAJA 3I79A 4M69A 3WILA 3ZDUA 1VEBA 4WO5A 2QKRA 4MNEA 4BWKA 5AWMA 2XCKA 2OJIA 4ANQA 4LDTA 2WIPA 2FSLX 2JBOA 2C5VA 2W99B 2XNBA 4FL2A 3BHTA 1TQMA 5ANKA 3JY9A 3PXKA 2XK3A 3W0PA 3GOPA 3CTHA 3R9RA 3PG1A 4BI2A 2QLUA 4QQCA 2OXXA 4IACA 4EOQA 4CTCA 4O4DA 5LOHA 2W4KA 4I0SA 4L43A 5EW9A 3OEFX 4X7QA 2YITA 4C7TA 4AGWA 2UW7A 3REPA 1XQZA 4EHGA 3DKOA 2IZUA 1PJKA 4UN0C 2WU6A 4HYIA 1VLRA 4LUDA 3HMNA 3BWFA 4WA9A 1Q3DA 5BV3A 3JPVA 3B8QA 4G9RA