2NRUA

Crystal structure of irak-4
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
293
Chain Sequence
RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of IRAK-4 kinase in complex with inhibitors: a serine/threonine kinase with tyrosine as a gatekeeper.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Interleukin-1 receptor-associated kinase 4
total genus 86
structure length 293
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2nruA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2nruA01
2EB2A 5CAVA 4FZ6A 3T9TA 3MI9A 2UW5A 2YN8A 1W83A 2QURA 2YM3A 5IH5A 3ZC6A 2G2HA 2UW9A 1E9HA 3QWKA 3KXZA 1BI8A 3QRJA 4J71A 5CEMA 2WOUA 1V0PA 4JS8A 3R7IA 3CJFA 4O0SA 3ZM4A 3BHYA 5LQFA 4PNIA 4N0SA 2R3OA 2WMQA 3OOMA 5HLNA 1H01A 4IQ6A 1IA8A 3LMIA 3Q5ZA 4FEQA 1Q61A 4DINA 4L3LA 3GB2A 2VTIA 4AA0A 2ITWA 4R3CA 4QP2A 3CQUA 2J5FA 4IZYA 3V6RA 3U55A 3FLYA 1H0WA 1ZZ2A 2HXLA 2UUEA 2XK4A 3BGPA 3NPCA 4FT3A 4X6QC 4MXCA 5J8IA 4C36A 4M97A 4YLKA 5AJQA 2W4OA 4IVDA 5DIAA 2P0CA 3DKFA 4KSQA 3VHKA 2FO0A 2JFLA 1XH8A 3R83A 2FSTX 5CSPA 4JDKA 4YNEA 3E93A 4EZ3A 5AA8A 5AADA 4YJPA 2CPKE 5ITAA 3TJDA 4ENXA 4E4MA 3DCVA 1NA7A 4FV8A 1K9AA 1EH4A 3TL8A 2UW0A 5IQAA 3DQWA 4IB0A 3ZZEA 4DHFA 2QLUA 1ZOEA 4BZNA 2C0OA 3KF4A 4M3QA 1CDKA 3CTQA 4PTCA 4R78A 4DF3A 2X81A 4YSJA 3BYOA 5I5ZA 5JQ5A 4MVFA 4ACMA 1U54B 4IM0A 3ZXZA 5HIEA 1L3RE 4JG6A 4CQGA 3R73A 3FMLA 3CE3A 3L9LA 4EKLA 4PPAA 5HG7A 4L7FA 4AG8A 4L00A 3HDMA 3UOLA 1LEZA 2YISA 4M69B 4CRSA 3HP2A 4X0MA 3ZONA 2IZRA 5JMSA 4JXFA 4BCQA 1RE8A 3LFNA 3FJQE 2BHEA 5CX9A 3GCQA 4G31A 4GV1A 4F7LA 4QYHA 4S34A 2GTNA 2YEXA 3GEQA 3HZTA 1STCE 3O17A 4QQCA 4UY9A 4R8QA 5DA3A 4IAKA 2JD5A 4EZ5A 4F6SA 3ZH8A 4V0GB 3FY2A 2PVYA 3VS5A 5LVPA 4AGDA 3DFAA 3NNVA 5DYJA 1UWHA 5LJJA 1KE7A 5HKMA 5BYZA 5BVWA 4YJVA 3FL4A 2PL0A 2PUPA 4F7JA 2ZB1A 4USFA 3SXFA 3TEIA 4FVPA 4EOLA 3T3UA 5TR6A 3BV2A 2WTDA 3G51A 4J1RA 2DYLA 5FXSA 2UZNA 3LOKA 4LOOA 3VO3A 4QMOA 3VF8A 3EKNA 3PXKA 4CT2A 3DJ5A 3ALNA 1BMKA 3AC4A 3MN3A 1ND4A 2O64A 3ORIA 4QMMA 4EC8A 5AAGA 3CGFA 2OSCA 4P90A 4ANOA 5H3QA 3VJOA 4F0FA 4WNOA 3NUXA 5LXMA 1UV5A 3BPRA 4D2VA 2OU7A 3O71A 4NCTA 4F99A 3BYVA 4GJ3A 3FXWA 2QG5A 3T3VA 5IQIA 4MAOA 4O6LA 3BU5A 3REPA 4ERKA 4NTSA 4CKIA 3ZSIA 3BYUA 4C37A 5CT0A 3PSDA 4BRXA 1NW1A 5J5TA 4ORKA 2IVSA 3V5LA 4IMYA 2ITTA 3CKWA 3COKA 3L9MA 4UV0A 2OI4X 4MBIA 3MS9A 4FTMA 4O38A 3HX4A 3TWJA 1PW2A 4ZJVA 5CEKA 2CNQA 3DTCA 4IFCA 5AEPA 2PMLX 3E8NA 4ZTSA 3SW4A 3ELJA 5HBEA 3HRBA 5DR6A 2ZYBA 2F57A 1XH4A 3AG9A 4CTCA 4O0XA 4IJPA 1U46A 2PE0A 3G2FA 3P9JA 1WBOA 4IVBA 3TNWA 4H3PA 1UU8A 4C62A 1A9UA 5IU2A 2C4GA 1FVRA 2JC6A 3QTRA 4XCUA 5HG5A 3U9CA 3BLHA 2IVUA 3QALE 5AP3A 3UC3A 2GS7A 4BDBA 3WF9A 2ETMA 1JKLA 4BDCA 3P7BA 5HIDA 3E63A 4P4CA 4FEWA 2WHBA 1Y57A 5AP6A 3FUPA 2WAJA 1XJDA 4AT3A 2EUFB 2VTQA 3D2KA 4R7HA 4BDKA 1SVGA 1H8FA 2BRBA 4ZTHA 3HMMA 4A07A 4EWHA 4QMUA 1IG1A 4J52A 5ANOA 4ASEA 4EORA 4D5KA 4RRVA 4E6CA 2H96A 1B39A 3MPTA 1REKA 2A1AB 2QU5A 1REJA 1T45A 3C13A 3RZFA 5C4KA 3BU3A 3MFRA 3MW1A 3NZ0A 3Q9YA 3WIKA 5K4IA 5D10A 4YR8A 3EKKA 4ITJA 4XLIA 4BTKA 3PY1A 1B38A 4NU1A 1SMHA 2ONLA 3QKKA 4FTTA 2ZV8A 5BVKA 2B52A 4FTKA 1M2PA 4GCJA 5ANDA 1KE5A 5CXHA 4I23A 5DOSA 2C5YA 5AR7A 4GW8A 3ZU7A 3PYYA 5J95A 1Q41A 5DFPA 1YDRE 3GGFA 3Q60A 3QWJA 5KHWA 3DBFA 3I4BA 2Y0AA 4MHAA 4TY1A 2Z7QA 3V3VA 1OL5A 4Y8DA 5IPJA 5L2WA 5BUIA 2CSNA 4IVCA 4RC3A 4NM5A 4PL4A 4AZEA 4HVDA 4O7YA 4PDOA 3LFBA 4AZFA 4GU9A 1IA9A 4LMUA 2YACA 5GZ8A 2VTAA 1WVXA 4W4WA 4A4XA 5JT2A 3QYWA 4YHFA 4HVHA 4Q2AA 4R1YA 4QMQA 2BFYA 3LLAA 3IW5A 5AR2A 2Y6MA 4RPVA 2E9NA 4MWHA 3D9VA 3U8WA 1RQQA 1ZYCA 2HOGA 5AP2A 4DEHA 5ANGA 4A7CA 3WZUA 1Q4LA 3NDMA 4H3QA 1R39A 3ZLSA 4R1VA 4UWBA 5CQWA 3V6SA 5C8KA 5J79A 3F5UA 1SM2A 2WIPA 2I0EA 2PVFA 4ZSLA 4DG0E 4I22A 4QYGA 5HI2A 4XH6A 4RBLA 2J0IA 3OD6X 5L2TA 1OIQA 4YO4A 3AD5A 2CN8A 3V5TA 1R0EA 3IGOA 2XVDA 4IZ7A 1ZXEA 5E9EA 3D4QA 3NR9A 2VO6A 2FB8A 1SYKA 4NH1A 2C0TA 3FMJA 1WBWA 4G1WA 5HO8A 4BC6A 4OTDA 1GIHA 1ERKA 3I81A 4JLCA 4OR5A 3LW0A 2VU3A 3BKBA 3EN7A 3R8MA 4HGLA 3D5UA 5CAPA 4M67A 3W16A 4FUXA 4CG9A 2UZLA 2WU7A 2VX3A 4QP9A 4A06A 2HAKA 4E26A 1KUTA 4M13A 4FC0A 2B53A 3LM0A 5LMKA 4FKJA 2RL5A 3KMWA 3NSZA 3C5UA 5KMMA 3O2MA 3DOGA 3AD6A 1FOTA 1I09A 2IZTA 5HOAA 4C4GA 2P55A 3RHXA 5EM5A 2W5AA 4C3PA 4Q5HA 3KCKA 3F5PA 4EHEA 1H00A 4W8DA 1H08A 2XNGA 4PF4A 2QC6A 2JKMA 2NP8A 1ATPE 2BZIB 3LFAA 3UGCA 2DS1A 3LFCA 3R7GA 5L3AA 4IX5A 1JKKA 4IX6A 4ALVA 4JDJA 3KQ7A 3O7LB 1W98A 3IECA 2I7QA 4FT5A 3O8UA 4BN1A 3V8WA 4IW0A 1ZWSA 1JPAA 4AGWA 3UG1A 4AOTA 1BLXA 3R9HA 3L8PA 4QMZA 2BVAA 3GP0A 4RZWA 3QLFA 5K9IA 3UQGA 4H05A 5CU3A 2XF0A 3ZUVA 2R7IA 2XBAA 3RM6A 1DI8A 3QZFA 2AYPA 3P23A 4D4RA 3KULA 5GJFA 2FSOX 3Q52A 1OBGA 4FEVA 3FQEA 1GZOA 2Y4PA 3PP1A 1FVTA 1YI3A 2E9OA 5GINE 2W1CA 4OTIA 2PSQA 3OWJA 1GAGA 4FL1A 4FV0A 3FHRA 3U6HA 2XS0A 4E8AA 3IOPA 1XH5A 2OF2A 2AC3A 3MPMA 3O23A 3KL8A 3QC9A 3VUDA 4CZYB 5AUTA 5JKGA 4CEGA 3EQCA 5I9YA 4CT1A 1VZOA 1BYGA 4TWCA 4UMUA 4W4YA 4EOSA 2C3JA 1YHWA 4N70A 4CSVA 5HE2A 3NYOA 4RSSA 2PZPA 3FAAA 4UWYA 5HNGA 3ZFYA 3MTFA 4YJRA 2QOQA 3UZRA 2GS6A 5AR3A 3Q04A 1ZRZA 3DLSA 1XBCA 3MJ2A 2WTVA 3AC8A 3EIDA 3CQEA 3TZ9A 4BDEA 2GHLA 3DNEA 4KBAA 4X3FC 4XP3A 4ANMA 4FA2A 2RIOA 2YWPA 5I9WA 3UOJA 4RG0A 1G8SA 2R0IA 4C38A 1BL7A 5HG9A 1RDQE 1YQJA 4LL0A 1CKJA 4DH7A 3GCPA 3GQLA 5IEVA 2PPQA 3RAIA 1P4FA 4QQ5A 5F20A 2HW7A 1BL6A 4ZY5A 3AC3A 4FZFB 3HV5A 3MB6A 3HL7A 3ORPA 3CP9A 1L8TA 3ID6C 1WBNA 2UV2A 3RWPA 4CCBA 4GYGA 2XB7A 2EXMA 5E8XA 4ASDA 3VNTA 1OL2A 1JLUE 2FH9A 4L9IA 4U43A 5AP7A 4F1OA 2G01A 5E8SA 4EL9A 3IKAA 2ITPA 3R1YA 4QMWA 4TYHB 4BI0A 3WBLA 1UVRA 4ID7A 1J1CA 2F2UA 2WPAA 3JUHA 3TG1A 3UG2A 4CFVA 2XK9A 4QOXA 4EK4A 4OGRA 2C6LA 3IS5A 4EOOA 2WTJA 2R3PA 4QP8A 2VWYA 2VO7A 2IVTA 2XYNA 4GVJA 3NNXA 5CSWA 3RNIA 5I3RA 1U5QA 3CLYA 4FEUA 4S2ZA 4IDTA 4MXZA 2HENA 2Z7SA 3IO7A 4QYFA 4ZTNA 1M14A 4FG8A 4QTEA 5B2MA 3CSVA 3DT1A 2FUMA 5CVHA 4C2WA 4FUYA 3UMXA 4M0YA 5JN2A 3QTZA 5CF8A 2XH5A 4DC2A 4E6QA 5AR4A 2UW4A 4E3CA 4QO9A 4BKJA 4BR3A 3TXOA 5CZHA 3I5ZA 3U6JA 3VRZA 4LGGA 4DYMA 4TYEA 3IGGA 2QOCA 2YIRA 1YWVA 4U79A 2XKDA 4I41A 2I1MA 4U97A 4WT6A 3ZBXA 4EZ7A 1FMKA 4EOPA 3W10A 2J50A 4MKCA 4BDIA 4BHNA 5FRIA 1OMWA 2OKRA 1YDTE 3FKOA 5KMLA 3A4OX 3NRMA 3NAXA 1UNLA 1JOWB 1ZOHA 2NPQA 4OTRA 2C47A 4YHTA 3UYTA 5EW3A 5CNOA 4DFLA 1V1KA 4BYJA 4BB4A 4O84A 4U6RA 2IW9A 3W2OA 2VO3A 2X8EA 3RM7A 3OCBA 4FKSA 4N6YA 3F3WA 4OUCA 3OZ6A 4FTOA 2Q0NA 2O3PA 2WMSA 3G9NA 1GOLA 2X1NA 4FNZA 2CCHA 3FC1X 3NIZA 3EOCA 3EN6A 5A4EA 2BZKB 4YC6A 5AM7A 4ACCA 3VS7A 4V01A 3PJ2A 1F3MC 5DMZA 1U4DA 3Q9WA 3THBA 4AXAA 5BUEA 3FMEA 4NSTA 4CNHA 3UO4A 4KIOA 5J9ZA 2VRXA 1GIJA 3EN9A 4WNKA 2QODA 5IQGA 1XH7A 3QBNA 2OXDA 4CGAA 4O0VA 3D7TB 3KVXA 4ZTLA 5K0XA 3ORTA 3OWPA 5D7VA 4QP7A 4DTKA 3ZM9A 3ANQA 3SHEA 4BICA 5EI8A 4GMYA 3R6XA 2HY0A 4C4HA 4FIIA 5KO1A 4RX8A 2ZDUA 1Z9XA 3QD3A 4AUAA 3GOKA 4FSYA 1NY3A 5A4LA 4S30A 4J98A 5FTQA 5HO6A 1E1VA 3GOPA 4L7SA 2R3MA 3KXHA 4DGOA 4K11A 2R3FA 2HK5A 3BI6A 1IAJA 2G9XA 4F9CA 5M4CA 4BVUA 2UZOA 2DWBA 4HGSA 2JDSA 4M84A 5HLWA 4C3RA 5FM2A 1Q3DA 2VWZA 4YJNA 4XMOA 3R00A 3TKHA 3A61A 4L01A 5L8JA 3DZOA 4J97A 3MH2A 3LMHA 2ONLC 4ZLOA 1XBAA 5T68A 4ALUA 1S9IA 2VTPA 3A62A 5EW8A 5IKWA 3UP7A 5E8YA 4IAYA 2ITOA 3QKLA 4YNOA 3PVBA 4WA9A 2B9IA 3VUMA 2Y7JA 4E6AA 5L2SA 4IH8A 3MTLA 3FDNA 4RIYB 4GS6A 3KK8A 4QP6A 2O8YA 3NUPA 1DS5A 3NUAA 3I7BA 4GT5A 5CTPA 3VC4A 3PXRA 5FEDA 3VQHA 4G9RA 3FYJX 5LVNA 1APME 3NUYA 1URCA 5AAEA 3VF9A 4ZZNA 2XK8A 4MXXA 5J1VA 3A8WA 3PY3A 4PPCA 3V5QA 4DEGA 2WELA 4IAFA 4M66A 4ZIMA 5HU3A 3QC4A 3LFSA 4G6LA 3ZBFA 3OT3A 3OCTA 3UVRA 2DUVA 1PXMA 4EHGA 3HMIA 3HAVA 4FSNA 2FSLX 2YJRA 2ZB0A 4CKJA 3KRRA 3FKNA 1IR3A 3PJCA 4HPUE 3ZRMA 4KWPA 4DEAA 4EUTA 4OBQA 2WQMA 3SD0A 4ACGA 4BY9E 2RFSA 1XH9A 5IA2A 1MQBA 3EQFA 4IM2A 4PUZA 3O50A 3PVGA 4RIYA 4WBOA 5FDPA 3IDCA 3A60A 3E7OA 3DBDA 3QCYA 4RIWA 3R7OA 4S33A 4TYHA 5HD4A 5IDPA 4YJTA 1UU3A 1PXPA 1M7NA 4FKIA 5I0BA 4PL3A 1YWRA 2HZIA 2ITVA 2BHHA 2PWLA 5L4QA 2IWIA 3BX5A 1ZMWA 3VS0A 3DK7A 5CU0A 3VAPA 5A4CA 1IRKA 4ONAA 2X2MA 5C9CA 4QMLA 3QTUA 4YZMA 4O7RA 4D5HA 1OECA 4GL9A 5CEQA 3LVPA 4Y5QA 3MWUA 5EOLA 4N4SA 5IQCA 4KIQA 4RFMA 2XA4A 4U9AA 1YI4A 5C01A 3ZSGA 3JR1A 2P2HA 3H9OA 2VV9A 4GU6A 2W1EA 4B4LA 4GG5A 3DXQA 4C57A 4IB5A 5FTOA 1PXOA 2FYSA 5IA3A 4S32A 4DT9A 3FL5A 5FTGA 2GFSA 1ZY4A 3D83A 4J99A 3P1AA 5JGDA 2I6LA 3AC5A 3BQRA 3VQUA 5HE3A 3EHAA 1BX6A 4ZSGA 3DV3A 3R30A 2VNYA 4V0GA 3QZIA 3HNGA 4U41A 3UNJA 4FNXA 3LKMA 3UJGA 4G6NA 2BDJA 3FLNC 3R63A 3CY2A 4PDPA 4KS7A 3RWQA 5BYLA 4KINA 3EQBA 4O0UA 2Y8OA 2JEDA 3MY1A 2X4ZA 4QMSA 4EH7A 5KKRB 2W4KA 3FHIA 3Q4UA 5EKOA 2Y9QA 3W32A 4AWIA 5T3QA 2ZM3A 4K8AA 4X2FA 4I6BA 3V8SA 3W8QA 3S95A 3PA4A 3ZEPA 3R71A 4GUBA 2W9FB 3HDNA 1OKYA 3W55A 3P86A 2VWIA 4NEUA 5JRSA 4JIAA 1Y8GA 2UW6A 4F64A 3EWHA 3PJ3A 2R3NA 4WG5A 4YPDA 4A9UA 3GXLA 2GHMA 5GZ9A 3L8XA 5ETAA 2WZJA 2W05A 1YXTA 3PXYA 4FR4A 1PXIA 4FIJA 3AT2A 3G9LX 5CQUA 3S1HA 3QA8A 4OAVB 1Z5MA 5KUPA 4PMMA 2VTRA 4D0WA 3GFEA 4NK9A 2OJFE 4MBJA 2XIYA 1FGIA 4ZXTA 4ANBA 3I7CA 2QOFA 3KMMA 3OHTA 4I94A 4N6ZA 1J1BA 4WUNA 4ZOGA 5HZNA 4XV1A 1Q99A 4IANA 3HRCA 5CI6A 3F2RA 2ZOQA 3KY2A 3AT3A 4JRNA 3BEGA 4N57A 3EFJA 2X4FA 3PFQA 3OC1A 3VBVA 2B1PA 3B8QA 4BCOA 4YC3A 3MY0A 3ORNA 4FGRA 5DN3A 2JDOA 5HG8A 1YDSE 4QTBA 2XEYA 2C6MA 2UZVA 3GUBA 5JQ8A 4RA5A 4CZTA 1J7UA 3ROYA 4BGQA 2JDRA 3AGLA 3VBTA 4BKZA 1YRPA 5M53A 1JSVA 4G3GA 4CFXA 4I92A 3FLSA 4AQCA 3BELA 5BVNA 1UU7A 1URWA 2QU6A 4JBQA 4F7NA 4KABA 2WOTA 2HZ0A 4AA5A 1H28A 3PSCA 5TO8A 5E90A 2O63A 5CVFA 4JBPA 2QVSE 2C3LA 3UIBA 3ZHPC 2F7ZE 2SRCA 4CVAA 2X39A 2UZBA 4L6QA 3OWKA 5J7HA 1VJYA 2QONA 4FZ7A 3M2WA 5AUUA 1ZZLA 3OUNB 4W9WA 3ZO1A 2R3LA 2GMXA 3WE8A 5A3XA 3NMUF 2ESMA 2RKUA 4OTFA 2WO6A 2IW8A 2QG7A 3MIYA 4G3DA 4M69A 5HX6A 2GNFA 1WBVA 2FA2A 2AC5A 1YXXA 2JBOA 2E9VA 3VUGA 2NO3A 4DFZE 1U5RA 4TKSA 2V62A 3COHA 3PUPA 4HVIA 2YIYA 3F7WA 4PP7A 4EUUA 1QL6A 3RK5A 4E4NA 4BCKA 3RHKA 4L3JA 3CXWA 4I0RA 4UYNA 1UU9A 3D7TA 5E8ZA 3GU8A 4YZ9A 3SKCA 3FQSA 3WZJA 4FKGA 1H1RA 2CNUA 3NCZA 4RC2A 5HVJA 1SNXA 2QLQA 2UVYA 3T8OA 4D1XA 2W1ZA 2QOLA 4GG7A 3RJCA 3QXOA 4W9XA 3W33A 3FZTA 4PPBA 4HGEA 4Y73A 3ORXA 4BZDA 4E4LA 3QHWA 4WUAA 5CAOA 3A8XA 3FLWA 2YHVA 3ATTA 1E1XA 3OXIA 3QQJA 4CFUA 1FQ1B 3MDYA 2VTHA 3KF7A 3CJGA 3HV6A 4RWIA 3R7UA 2W17A 4FTIA 5AUVA 4RQKA 2PVHA 4W4XA 2Q0BA 3F82A 4XX9A 2YZAA 3E8EA 4IFGA 5FWKK 2OLCA 3WI6A 4E93A 1FINA 4NT4A 3TV6A 4U80A 3UO6A 4Y83A 4JAJA 4NJDA 3WARA 4FKWA 2IPXA 3LJ1A 4I4FA 4AFJA 4EBVA 4NFMA 3Q53A 4QTCA 4L42A 4WG4A 3QD2B 4XLVA 5ETIA 3SGCA 4F65A 2C1AA 2GHGA 5EW9A 2CKQA 3P7CA 5CU6A 2WQNA 5EQYA 1RJBA 3DA6A 1H26A 4IE9A 4TYIA 2H9VA 4MD7E 3N51A 2I0YA 3TM0A 4H58A 2PYWA 2OBJA 5IQFA 2JGZA 4TWNA 3R0TA 4CYIA 3DK3A 2CJMA 1OI9A 4E5WA 2Y4IC 3BGZA 2IZSA 2XNNA 1J7IA 3FZSA 4ZZOA 2F2CB 4JBVA 4W4VA 1BKXA 3CEKA 3F88A 1OKWA 3BWJA 2Z2WA 4PRJA 2OJ9A 4X2KA 4RC4A 1FBNA 4HZSA 2HXQA 2X9FA 3E92A 3GC8A 3NEWA 4KA3A 5H8GA 4GUEA 4USDA 4PTGA 3ZDUA 3Q4TA 4YO6A 3A4PA 2CLQA 3OMVA 3DNDA 5J9LA 4GT3A 5M08A 3PWDA 3EZRA 3DKOA 1H0VA 3FLZA 3FZOA 2C5OA 3NW5A 3QUEA 4KAOA 5D7AA 4DLIA 3L9PA 4EOKA 3FEGA 3R22A 2W5BA 1GZKA 2H8HA 3FV8A 3TZ8A 3W8LA 4FIEA 4C61A 4GKHA 4AAAA 3U4UA 4IB3A 1P14A 2VWWA 1M2RA 2XRWA 3HGKA 3R8VA 3SXSA 3V5JA 1HCKA 3HLLA 4FKVA 3V01A 4DH5A 4ARKA 3TKIA 5LWMA 4ZMEA 5DR2A 3OEZA 3UOHA 2YZLA 5LMAA 4P5ZA 4P2KA 2VX0A 4FMQA 3UIUA 4R6VA 5KMNA 4HNIA 3K3IA 3N4TA 1OIRA 4GFOA 4YTIA 4RX7A 3Q4ZA 1PMUA 2YFXA 2X9EA 4YLJA 3ZRLA 1KWPA 5C8NA 5FEQA 4ASZA 1CTPE 2VTOA 1WMKA 4RWKA 4DFUA 3EL8A 1VEBA 2XM9A 4OLIA 5HD7A 4FOCA 3SRVB 4ZLZA 4WNPA 3ODYX 3EH9A 4NYEA 2PZRA 4F08A 4DTAA 4UWCA 3LCDA 1OM1A 4K6ZA 4Y85A 4BCPA 3BEAA 3RPYA 4MXAA 2YIWA 3NWWA 3BE9A 3FXXA 1PJKA 5H2UA 4ZEGA 4A9YA 4E5AX 3ZO3A 2WMVA 4BIDA 4EH2A 4CTBA 3KB7A 3QKMA 2WTKB 1XR1A 3OW4A 4RWLA 4FTRA 2XK6A 3ZC5A 4YBJA 5I9XA 3HV7A 1S9JA 3P7AA 4D55A 1NVSA 4F70A 3AOXA 3PPKA 5IQEA 2BIYA 3QGWA 2YA9A 4F0IA 2CCIA 3UNKA 4MNEB 3IW7A 3MGYA 3QRUA 3ZZWA 4EK6A 5M51A 4HOKA 3FI8A 5JGBA 4EYMA 3LXKA 3EQGA 2BR1A 1OL7A 2HZNA 4EBWA 2WMXA 5M09A 3MFTA 4JR7A 5LWNA 3R21A 3KRWA 3IK3A 2DQ7X 2QHMA 3ZDIA 1QPJA 5D12A 3ODZX 1GJOA 3FE3A 5FP6A 2JAMA 1V0OA 1Q8YA 1UA2A 5HEZA 4AS0A 5KX8A 4FZAB 3OEFX 5HESA 3OFMA 5HICA 4ZY6A 3P5KA 4U45A 3VN9A 4Z7GA 2QI8A 5IZFA 2Z02A 3LJ2A 4EH9A 3UQFA 1PKGA 3OOGA 4IHPA 4TTHB 5AX9A 5HE1A 3UBDA 1MRYA 3K3JA 2R4BA 3VS4A 5DI1A 3ZUTA 2HY81 4FEXA 3OG7A 3LAUA 1PXJA 3OROA 1IEPA 4FNYA 5D11A 5A4QA 2VWUA 5IQHA 2BALA 2R7BA 3QZGA 2W1FA 3BHTA 2BDWA 3LCOA 5AV4A 3G6HA 3R1QA 4XG4A 1CSNA 4AP7A 2QO2A 3LFQA 4QRCA 5KMKA 2VWXA 2YJSA 5JK3A 3E8CA 1QMZA 4O1PA 4O0YA 3E62A 4NM0A 5DGZA 2VNWA 4IDVA 5FEEA 4DEDA 1R3CA 2GNJA 4IAIA 2IO6A 5H8EA 3D5VA 4FSWA 4LRJA 2BCJA 4D9UA 4CLJA 2R5TA 3RTPA 4AU8A 3C4WA 3QCQA 4FIHA 3VWAA 3ZOSA 3QXPA 5JFVA 5D41A 2W4JA 3FXZA 4AACA 2PZIA 1SVEA 2OIQA 2V22A 4I3ZA 4ITIA 2OWBA 3Q3BA 2QO9A 3RVGA 1Q3WA 4FG7A 3ORZA 3E64A 1JSUA 5BQ0A 2J7TA 4RJ6A 3S4QA 4AZSA 3NVKI 3DLZA 4WSQA 4Z55A 1OBDA 3PWYA 2QKWB 2ZAZA 2F9GA 3WYXA 4R7BA 3VJNA 4F9WA 5CT7A 3ULZA 3OP5A 1GNGA 5L8KA 4H36A 5CU4A 3DS6A 2W5HA 1P2AA 1ZARA 3ENHA 4FOBA 2A2AA 3POZA 1PYXA 4FKRA 2W96B 2B54A 4TRLA 3O96A 2ZV9A 4JR3A 3ZTXA 2VTLA 4G9CA 4MF0A 1TVOA 4BWXA 4C34A 4AOIA 2XRUA 5FM3A 5TOZA 2YIQA 2X8IA 3UPZA 3EL7A 4U44A 3IQ7A 1YHVA 4TXCA 4U40A 2ACXA 3GC0A 4HCVA 5DHJA 3UE4A 5E8WA 4DFXE 3VBYA 4EYJA 4GIHA 5L2IA 2R2PA 3CQWA 3DGKA 3TZMA 2B9HA 2JIIA 3G6GA 2YITA 3BHUA 4OAUC 5F94A 4EOJA 3PE2A 3CPBA 4JQ8A 2Y6OA 3TNPC 2GQRA 3DJ7A 4DLJA 4E5BA 3FPQA 2UZTA 2YM6A 2IJMA 3C5IA 4NIFA 4U3YA 4IM3A 3FYKX 3H10A 4ZJJA 4IVAA 4ZS0A 2BAJA 5GZAA 3BU6A 3A7JA 5FGKA 4QP4A 4AW1A 4CXAA 2VTMA 5CYIA 4BWKA 2JKOA 4JBOA 5EYMA 2X7FA 2PUUA 2BIKB 5CY3A 2CKEA 4XP2A 3DY7A 4YZNA 4XYFA 4BI1A 3DJ6A 3H9RA 3ORLA 4XV3A 5L2QA 2W1DA 4NM3A 5JZNA 3UPXA 3W2RA 2XCHA 3I6WA 3SW7A 1SNUA 2BTRA 4FK3A 3H30A 5ANEA 3W2PA 5KHXA 3M1SA 5JFWA 3Q9ZA 2OXYA 2BRMA 2J9MA 3R2YA 5BNJA 2XKCA 5IG1A 5EHOA 3MA6A 2GSFA 3U54A 3IDBA 4JRVA 5FBNC 3E8DA 5DRBA 3UZTA 3PRFA 4ANLA 4TPTA 2XNPA 3FMMA 3ITZA 3PJ1A 4I5PA 3ORMA 4L46A 4FL3A 4MX9A 3O7LD 5CU2A 4DGGA 2YERA 2RF9A 4JQ7A 5DEWA 5M57A 4HYHA 5KMJA 4MXOA 3MSSA 5CSXA 4EH6A 1XQZA 4NW5A 2Z7RA 3SRVA 2BZJA 5CZIA 3H9FA 1NVQA 2WTCA 2A27A 3HMNA 4KSPA 3TUDA 1G8AA 2OICA 4R3RA 4ZK5A 1ZOGA 4WG3A 4O86A 3FWQA 3FI2A 4IBMA 4L44A 4DGNA 3LPBA 4ZY4A 4AE6A 1Y8YA 3NGAA 3ZO2A 1UWJA 5DVRA 3RALA 3TV4A 4IZ5A 4XG8A 4YMJA 5EHYA 3A7IA 3OCSA 4K77A 5EQPA 1U59A 1W8CA 4NJ3A 5FXRA 1JQHA 4NWMA 2BILB 4XNEA 2ZM1A 4KBKA 4FG9A 4DEIA 5A6OA 4NL0A 4KS8A 1Q8UA 4QMYA 4LI5A 2J6MA 4FTAA 4YLLA 4QNAA 3QCXA 1GY3A 3EQDA 4EH4A 1OL1A 5LVMA 1PMVA 4WKQA 3PRIA 5CS6A 5BVFA 5JFXA 2JFMA 5HNBA 4Z3VA 4AT5A 2XIZA 2XNOA 3B8RA 3SXRA 4D1SA 3ORKA 3QRKA 4IC8A 1LUFA 4EQUA 4F1MA 3TTIA 4FV4A 1JKSA 4LV8A 4QMTA 5AV0A 5T6KA 5LVOA 1PXKA 1NVRA 2XZSA 4NKSA 5J5SA 3K5UA 5EDPA 5IEXA 1SZMA 3KKVA 5GJDA 4FT9A 4FTQA 3JVSA 3MJ1A 4IWDA 4KIPA 5HBHA 4C58A 3EN4A 4MF1A 4FKLA 4NCTC 3FMDA 4XOYA 3UDBA 4FT0A 3PG3A 4O2ZA 4D2WA 4B6LA 4JVGA 3PIYA 4IXPA 4CFFA 4IIRA 3DBCA 4KB8A 4FKQA 4MNEA 5EH0A 3W1FA 4YU2A 4O22A 3WZKA 4G17A 4BBEA 3PLAE 4MYGA 4L43A 4I21A 5CSVA 5F4NA 2ZM4A 4QPMA 4RT7A 2R3IA 2VGPA 2BFXA 2ERKA 4F09A 2Z8CA 1P5EA 3D15A 4HYIA 5HQ0A 1PF8A 4X6RA 3WF8A 4BYIA 2QOHA 3MH1A 4M0ZA 3WYYA 1YOLA 1KOAA 2R3RA 1XBBA 3I6UA 1DAWA 4DGLC 5B2LA 2CKOA 3S2PA 1R1WA 4RGJA 4U5JA 2OO8X 2X0GA 4U81A 3PG1A 2YCQA 4IEBA 5HORA 5FXQA 3EN5A 3KRXA 4BDFA 4X7QA 3DBQA 4L45A 1J7LA 2QNJA 4B99A 4FV7A 3R8ZA 4QYYA 4O0TA 3ZLWA 3E87A 3DBEA 4EH3A 4BKYA 3HKOA 4FF8A 3G33A 5LMKC 4IWOA 3LFEA 3PP0A 5IA1A 4QP1A 2WEVA 4QMXA 3DPKA 5BX0A 3B2TA 3N4VA 3QTXA 1Y6AA 5CVGA 2PVKA 5AWMA 4TNDA 2WQEA 1ZYLA 4KKEA 5DNRA 2RGPA 4TL0A 3TNIA 4GRBA 4KRCA 1TQPA 2FVDA 4FTNA 3NLBA 4DEBA 4Q9ZA 2X6DA 1KV1A 2B7AA 2EXEA 2HYYA 4FYOA 5EM6A 3W2QA 2OFUA 3FMHA 4FODA 3V04A 3KXGA 3FMNA 2FGIA 5ANJA 3AMAA 3L8SA 3RPRA 4IAAA 5M4FA 3BWFA 4O7VA 3LLTA 3KEXA 4RQVA 4XS2A 2X8DA 4E1ZA 4HW7A 5AUYA 2C6TA 3I60A 3VBXA 3G90X 4DFBA 3F5XA 3COIA 3TIYA 1QPDA 5BMMA 3WF5A 4ENYA 2ETRA 2VZ6A 2OG8A 4KIKB 3Q5IA 4BCJA 3W18A 2R9SA 2XK7A 4U7ZA 5AUXA 4C33A 4EH5A 2ITZA 2A0CX 3CR0A 5EYCA 3IOKA 5ICPA 5GNKA 4B0GA 2GNGA 4EHVA 2BRNA 3AMYA 4BWPA 2A19B 1ZMVA 5I4NA 5K0KA 4BCHA 3E7VA 1QPCA 2UW3A 2XIRA 3MFUA 4KD1A 5CF4A 3HP5A 5AUZA 3LXPA 1VYWA 4GYIA 5CF5A 3F66A 5DPVA 1H1WA 3F3VA 4II5A 3RCJA 4ACHA 2OZAA 4OT6A 4EK5A 5BPYA 3MIAA 3U6IA 2WMBA 2VWBA 3IDPA 1Q8TA 3GC7A 4JI9A 1J3HA 4D2RA 5L8LA 4H1MA 4QTAA 5B2KA 5IQBA 3NYNA 3BHHA 3PZHA 2XUUA 3U9NA 4XP0A 3SX9A 4FSZA 3IW8A 3R8PA 2GNHA 3EFLA 4DG2E 5M44A 3MPAA 4HJOA 4MH7A 3DB8A 3QL8A 1F0QA 3CD8A 5HCXA 3R9NA 3QRIA 3MVHA 4XEYA 2CGWA 4H39A 5CEPA 4JNWA 4O0RA 4OBPA 3ZXTA 4RVKA 4WBBB 3QAME 5HTCA 2J0LA 2GS2A 4R5YA 1R0PA 1YOMA 2QOBA 5JEBA 4DCEA 4A9RA 4LG4A 4BI2A 4RX9A 2XBJA 3QLGA 3QUPA 4UZDA 3D7ZA 1O6KA 4YJQA 4X3FB 4E4XA 4AN2A 5CLPA 3DXNA 3EYHA 3QQFA 2YAKA 3GVUA 3R8LA 3LCTA 5L6WL 4R5SA 2QO7A 5EDRA 3UQCA 3QHRA 1LPUA 4XBUA 5F95A 5G1XA 3TV7A 3EQPA 3WIGA 1MP8A 2OF4A 4DGMA 4LUEA 2W1HA 3R01A 4Z16A 3OXTA 5FQDC 4K18A 3SDJA 4AN9A 3TN8A 3R28A 2XKEA 2C30A 2CGUA 5C1QB 1XWSA 3DFCB 3L9NA 2H34A 3PXQA 4PQNA 1KSWA 4FKUA 5D9HA 4D58A 4RLLA 4C4JA 3P08A 2YAAA 4TT7A 4I5CA 4MD8E 1YHSA 5AP1A 2JDVA 3R7EA 3RAKA 2GNIA 3OUKA 4CMTA 5LMBA 2CNVA 4EWQA 3R1SA 5J87A 3AGMA 2B9FA 2ITQA 3QQKA 2ITUA 1H24A 2IVVA 3PVWA 3D2IA 3C0HA 1FMOE 4AF3A 2OIDA 5FDXA 4C2VA 5HU9A 4EKKA 3R04A 2WGJA 3RPVA 4UN0C 3WE4A 2F4JA 5AFVA 1A06A 4EQMA 2WMWA 3IW6A 2V7OA 3D94A 1JAMA 3PJ8A 3ET7A 1UNGA 4IC7A 5IMEA 1ZY5A 4O7TA 3QTSA 4RFYA 2BRGA 2VTNA 1G3NA 3NAYA 1JSTA 3QD0A 2KULA 3F2AA 5E91A 4IB1A 4S31A 5AP5A 1OIUA 4I5HA 3RAHA 2XNBA 3FI4A 4D28A 4XG6A 5DT3A 3ZFXA 3HUBA 2NNWB 3PVUA 4LYNA 3DU8A 4DEEA 1OZ1A 3E5AA 4PTEA 4GK4A 3G5DA 3UO5A 4ZSAA 3GFWA 2EU9A 4HGTA 4Q9SA 3BZ3A 2Z60A 4MEDA 1Q8ZA 4FK6A 4L3PA 1NT2A 3R9OA 4F63A 2G15A 4H3BA 4D2SA 5DH3A 3PE1A 4WRGA 4NKAA 3QQHA 4XRJA 3BGQA 4LRKA 4D0XA 4HVSA 2EWAA 5E92A 5CSHA 3KGAA 4YHJA 5I9UA 2IW6A 3DDPA 3QD4A 1K2PA 2RG5A 2PY3A 2QOIA 3FY0A 2RG6A 3TIZA 4EC9A 4LM5A 1PHKA 3OBJA 4RJ8A 4EK8A 2UZUE 2XYUA 2Y4IB 4WOVA 2PUIA 3EYGA 4O7SA 3RMFA 2OH0E 2HZ4A 3CIKA 5TT7A 2JLDA 1B6CB 4TNBA 4BDDA 2UZDA 2BMCA 4BGGA 3Q2JA 4QMNA 2XNEA 3PTGA 3ZYAA 1BUHA 1PXLA 2GNLA 2WMUA 3CY3A 4I6HA 4QQJA 4NZWB 4RJ7A 4HZRA 5FD2A 3SOCA 3HMPA 4UALA 5IH4A 3G15A 3ACKA 3F61A 4G5JA 3UODA 4OTHA 2R3KA 2BAKA 2WNTA 3HA8A 4FKOA 1M2QA 3OT8A 2C0IA 2JIVA 4HYSA 3C50A 4FICA 3GCUA 4TWPA 1CKPA 1MUOA 4G34A 4C3FA 4Z7HA 3DK6A 5H8BA 4BCMA 4RJ5A 5LVLA 4OTQA 4CG8A 4DFNA 3Q2MA 2UVZA 4FIFA 5ANIA 4C35A 4FTCA 5HTIA 5I9ZA 5BVEA 1GZNA 1WBTA 4Y95A 1AGWA 3LE6A 3PXZA 5BUJA 3DXPA 3L1SA 4LUDA 4UYAA 4FT7A 4MD9E 1LP4A 3MVJA 5G6VA 2CMWA 2J2IB 3KN6A 3FMKA 3ERKA 3OBGA 2OJGA 4IX4A 4LGHA 2WMTA 4Z9LA 4YUQA 1WVYA 4AGUA 4CFMA 4XJ0A 5BVDA 5E7RA 2GDOA 4HVGA 5J9YA 1CKIA 3LFDA 3NNWA 3UVPA 4JG8A 2X6EA 4OTWA 3GU7A 3A99A 2C5XA 4LOQA 5ETCA 4L53A 3O8PA 1OL6A 3KXXA 5IUGA 4FV9A 1OUYA 5JGAA 3MB7A 3MH3A 1PMNA 4K0YA 4MXYA 3Q96A 1YI6A 3B2WA 3C7QA 4BCGA 4BDAA 4YSMA 1P4OA 2WB8A 3ACJA 3QX2A 4RIWB 5M56A 5LARA 4EOMA 2R0UA 4XHKB 3UYSA 4E20A 3WOWA 1R78A 3IW4A 4B8MA 3PIZA 4AGCA 3RGFA 3A2CA 3HVCA 1J91A 5FLFA 4ANQA 3QQLA 2RFNA 4DH3A 2JAVA 2VTJA 4ZMFA 1VR2A 1UNHA 3UOKA 1M17A 4FV5A 3KN5A 3BLQA 5IH6A 5I3OA 2OGVA 3OF0A 5EHLA 4DCAA 4BDGA 3EQHA 1H1PA 2PULA 1LEWA 2BAQA 2YDKA 4O6EA 4R77A 5AIKA 3ZMMA 5HGIA 3SAYA 4JIKA 4W8EA 4I6FA 2WMAA 4O21A 2BUJA 3H0YA 4FVRA 4RIXA 2WEIA 5HIBA 5A6NA 2WQOA 2V7AA 3PDTA 4DE4A 5LOHA 4BGHA 3GU5A 4F7SA 1ZYJA 4UEUA 5CWZA 1NXKA 4LL5A 4O7NA 4GKIA 2ITXA 4KKHA 4KRDA 4KIKA 3R9DA 2HW6A 2AUHA 1OKVA 5DLSA 3UC4A 3ZSHA 3H0ZA 4O0WA 4UMRA 4YTFA 2I0HA 2C6OA 2PE2A 2BZHB 1V0BA 5K3YA 3GNIB 3CBLA 3TCPA 4O7WA 3BE2A 4QPSA 4NTTA 4ZSEA 4DFYA 2HIWA 3PPJA 2OXXA 5HX8A 1Q24A 4YC8A 3GU4A 4FSMA 1X8BA 4RMZA 4A4OA 2J0MB 1YVJA 3MFSA 4APCA 1TQMA 4FI1A 3ZLYA 1ZYDA 4M12A 5LCKA 5ACKA 4YZDA 4IACA 3KU2A 4OT5A 3A7GA 3KFAA 5E4HA 4CV8A 2VWVA 5E8VA 1OIYA 3C4FA 3K5VA 5JH6A 3NVMB 3M11A 3VS6A 3Q4CA 2YWVA 3F5GA 2W1IA 2E9UA 3NUUA 3Q6WA 2PVLA 2F7XE 3EJ1A 4HYUA 4L8MA 3KA0A 5BVOA 5K4JA 3VBQA 3SG9A 1OGUA 4CMOA 2GU8A 4KNBA 2UZWE 4KBCA 5IUIA 3M42A 2BTSA 3D0EA 3F2NA 4DBNA 1UKIA 4B9DA 4DITA 1AD5A 3BLRA 3F6XA 3MV5A 2XMYA 3K2LA 3E88A 3LMGA 2RSVA 4F6UA 5A54A 2QCSA 5C03A 3ZCLA 4B8LA 2W99B 3MH0A 2O5KA 3PZEA 4FKPA 3WF6A 4DN5A 2P2IA 3RNYA 4GJ2A 4TYGA 2J0KA 4BZOA 2XNMA 3LJ0A 4X3JA 4BTMA 4AE9A 2EB3A 2BPMA 2E2BA 2JKKA 3OWLA 2ZMDA 4D2TA 4ZLYA 2ZVAA 2BRHA 2RFEA 3RK7A 4G5PA 5DR9A 2UW7A 3DTWA 4FV6A 4WO5A 3F7ZA 3HYHA 1XO2B 2I0VA 2QQ7A 2Z7LA 3H4JA 2CHLA 2C69A 4O83A 1ZMUA 3C1XA 3QA0A 3OXZA 1ZYSA 4D1ZA 5AIRA 4J7BA 2QOKA 4U8ZA 4E7WA 3TDWA 3RINA 4JX7A 2YDIA 1WAKA 3V51A 4UB7A 2W06A 3NX8A 3OY3A 4LQMA 1HOWA 4XUFA 4EEVA 2PTKA 4FTLA 1O6YA 1KE9A 4G2FA 4I93A 5CI7A 4ITHA 1G5SA 3ANRA 4NW6A 3KK9A 3OTUA 3T9IA 5CF6A 4OTPA 3ETAA 2ITYA 3KRLA 1VYZA 4O96A 2KTYA 4O2PA 1U54A 4OW8A 3VS1A 4O91A 1AQ1A 2VTSA 1H4LA 4QTDA 5J7BA 3BBTB 3CC6A 1UKHA 3DAKA 3LHJA 4GK3A 4IWQA 3NUSA 2Q83A 5IA0A 3HA6A 5ACBC 3V8TA 3N9XA 5FUTA 3EB0A 4FTJA 4D4YA 4UBAA 3KC3A 2VTTA 4FKTA 1YW2A 3SG8A 2WTIA 5IUHA 4YTCA 5EM7A 2J5EA 4JQEA 3C4XA 2VAGA 3DDQA 4RLKA 3BYMA 3JXWA 3TACA 4PP9A 3O8TA 5E1EA 2CN5A 4WSYA 2ZV2A 2OJIA 1WBSA 4C59A 4ZP5A 1FVVA 4I0SA 4PV0A 1TQIA 4EJ7A 3TI1A 4WD5A 2VX1A 4G3EA 4HPTE 5CAQA 5IA4A 2CGXA 2WMRA 2IZUA 4NIFB 4O1OA 4PY1A 2GCDA 4R7IA 3SLSA 3LFFA 3QU0A 2BKZA 1PYEA 4YZCA 5EDQA 4AW5A 3NIEA 4IJ9A 4MBLA 4AT4A 1T46A 3ENMA 4DH1A 4F6WA 3IPHA 1DM2A 5BYYA 4C7TA 3LQ8A 3C4CA 4PMSA 2JDTA 3JY9A 2PZYA 2R3HA 3QTIA 4U0IA 5H9BA 4MWIA 4WRSA 5L6PA 4MQ2A 1H07A 5JSMA 3VW8A 2C68A 4LOPA 1MQ4A 5KBQA 4O7ZA 4RIXB 5AUWA 4JDHA 1I44A 2XIKA 3MY5A 4HCUA 1ZLTA 3KULB 1OPLA 3HUCA 3LCKA 3W2SA 2X2LA 1WCCA 1YXSA 1OVEA 5DE2A 2XJ0A 4RA4A 3PA5A 3JYAA 5KNJA 4UMPA 2ETKA 1OKZA 2ERZE 4JX3A 2UZEA 4MK0A 2C5VA 4DG3E 2XK3A 3KXMA 4Y5HA 4C4EA 4BTFA 4BCNA 4ANNA 4FSTA 5I9VA 2G2FA 3FI3A 3P79A 4X2JA 1M7QA 2O65A 4RIOA 4EH8A 1XH6A 2A4LA 4IAZA 5IA5A 4BF2A 2YCSA 4TZRA 4NFNA 3Q6UA 3D14A 4C4FA 1DI9A 5C8MA 4D9TA 2RFDA 5AP0A 1YOJA 2CKPA 1XKKA 4O81A 3JS2A 3QRTA 4FSUA 4AX8A 5D1JA 3CGOA 4ACDA 2EXCX 5DBXA 4X3FA 3VHEA 3QQUA 4WNMA 3FZRA 4CFNA 4FE2A 5DT4A 5L6OA 5DEYA 2PVNA 4JJRA 5CEIA 4K2RA 4UXQA 3E3BX 3JY0A 5J1WA 3R02A 3VRYA 2O0UA 4AFEA 3BBWA 3QZHA 5KZIA 2B0QA 2YM8A 3PIXA 4YTHA 3JPVA 3R2BA 2PVMA 4BDJA 4O7LA 3FBVA 2VN9A 4V04A 5HVYA 3TUCA 4E6DA 2C6DA 4EI4A 5KMOA 3F9NA 2HCKA 3ALOA 1DAYA 5AP4A 4PX6A 3U4WA 3VUHA 1Y91A 2WFYA 4O27B 3TZ7A 2QHNA 3MYGA 4I6QA 2W1GA 4ALWA 2XKFA 2WQBA 2X7OA 4QT1A 4XG3A 1KE6A 4F9YA 4CLIA 5CASA 4D2PA 5HTBA 4I1ZA 1QPEA 4RVTA 2C1BA 3W2CA 4YJUA 1OB3A 3WZDA 5CXZA 4CKRA 2QR7A 3TNQB 3NYXA 4M7IA 4MCVA 4FX3A 5AR5A 4UMTA 4YPSA 1QCFA 3GENA 3DZQA 3UVQA 1H25A 2HELA 4U42A 4GEOA 5KZ0A 2OFVA 3TUBA 1OITA 5HE0A 2P3GX 3DKGA 2V0DA 3R8UA 3VW6A 3HV4A 5ANKA 4UMQA 1OPKA 4BDHA 3TTJA 4C0TA 1CM8A 4WIHA 3S0OA 5CAUA 3GC9A 2R3JA 4XOZA 3UIXA 5HCYA 5GIOE 3EQIA 1JVPP 4ASXA 2X7GA 2YIXA 4XG7A 1W84A 4DH8A 4F0GA 1WFCA 4LRMA 5E8TA 5GHVA 2FSMX 4QNYA 2J4ZA 5DRDA 1FGKA 4FBXA 5IEYA 1GIIA 3JVRA 4F4PA 1PRYA 5F9EA 4J96A 3RPSA 5B7VA 3HMOA 3H3CA 4QD6A 5M4UA 2C3KA 3CTHA 2IN6A 1OUKA 3OY1A 2QOOA 3LM5A 3VBWA 5HNIX 3FSKA 4MQ1A 1LR4A 4QMPA 3SVVA 3ZLXA 4EJNA 3AXWA 3G0EA 3BHVA 3LXNA 3PPZA 5AX3A 2UVXA 1WBPA 3C0IA 2P33A 4X2NA 4XV9A 5CENA 5JZJA 2F49A 3FSFA 4LFIA 4QYEA 4C8BA 2IG7A 3KMUA 3OW3A 4K33A 2R3GA 4PMTA 4GK2A 5AMNA 5TF9A 4QP3A 5AA9A 4UX9A 3DAJA 4ZS4A 2WIHA 5GIPE 1KOBA 4AN3A 2PMIA 2PE1A 1HCLA 4X2GA 4YGAA 3CS9A 3RP9A 2CLXA 2GQSA 4PDYA 3TDVA 2XJ1A 2PU8A 3QUDA 3UP2A 5F1ZA 1H1SA 1WVWA 4M14A 2PMOX 4FSRA 2YM7A 5AM6A 5K5NA 3CD3A 4L52A 4TWOA 5AV3A 2XM8A 2YCRA 1W82A 3AMBA 4HCTA 4CD0A 4EHZA 5EYKA 3TJCA 3QGYA 1CMKE 2HWOA 3DAEA 5M07A 3QCSA 1PMEA 4ERWA 3AC2A 1MRVA 3S3IA 3ZEWA 4QPAA 3F3UA 4UZHA 2J51A 5EG3A 4EOQA 4P7EA 4CYJA 1Q5KA 3HECA 1W7HA 3GCVA 4D4VA 2GTMA 3Q9XA 4M68A 3VS2A 4AW2A 3MESA 3TKUA 1GZ8A 2YM5A 1PXNA 3NYVA 3PY0A 5ETFA 4FVQA 2O2UA 5IQDA 4XBRA 4F1TA 4LV5A 3VUIA 2CDZA 4CMUA 4DTBA 2OW3A 3R7VA 4KKGA 5AAFA 4J8NA 5M06A 4YZBA 2XCKA 3MVLA 3CKXA 3COMA 5EOBA 3SQQA 4F9BA 4HNFA 1Q62A 3LQ5A 3MBLA 3QQGA 5FG8A 5FP5A 3KCFA 4JL9A 4JAIA 3ZO4A 5EM8A 2YDJA 2VO0A 4V05A 4C4IA 3UZPA 5IMXA 3UTOA 5HBJA 3F3ZA 3EMGA 4LGDA 3QTWA 5B0XA 2VGOA 4GFMA 4BCFA 4CV9A 4Y46A 4XG2A 5IDNA 3KREA 4BIEA 2OZOA 2WD1A 3GU6A 3ATSA 5IISA 4YJSA 4A9SA 4DT8A 2W7XA 4MTAA 4C02A 3EFKA 3OTVA 3FZ1A 1M52A 3RKBA 3ZUUA 4PDSA 4RWJA 4PMPA 2YCFA 4YBKA 3GBZA 2VD5A 3IG7A 4GVAA 3RBWA 4BCIA 4F9AA 5BMSA 4AZVA 2QR8A 3PSBA 1WZYA 2XJ2A 3K54A 3N4UA 3GCSA 3L8VA 1H27A 4JDIA 3QFVA 3CCNA 3S00A 5M4IA 2YABA 5HLPA 3UNZA 4TN6A 2W9ZB 4IADA 3VUKA 3LCSA 4AZWA 4CRLA 2GQGA 2B4SB 4AOJA 3WF7A 4M8TA 2P4IA 3GQIA 3OS3A 1H1QA 3VULA 4RFZA 1SVHA 5EYDA 5HVKA 1BI7A 2YM4A 2W0JA 4FSQA 4FTUA 3KVWA 3BV3A 4AZTA 2PVRA 2NRYA 2PHKA 3ULIA 4H1JA 3GI3A 3O51A 4J95A 4BL1A 2WKMA 3AD4A 1JWHA 2PK9A 3RK9A 2F7EE 2BROA 4GFGA 4R3PA 5DG5A 5KKRC 2V55A 3D5XA 4IX3A 2GPHA 4RJ3A 4FV2A 3NW6A 3I5NA 4FZDB 2QD9A 4U3ZA 4ANSA 1FPUA 3OVVA 4CCUA 3TNHA 3AC1A 4BFMA 2C6KA 4CQEA 3I0OA 3OCGA 5E1SA 4I20A 4RVMA 4ZTQA 5EKNA 3BCEA 5LCJA 3VS3A 3BIZA 4G6OA 4EONA 1O6LA 2XIXA 3QF9A 4XG9A 4USEA 4ZSJA 4KUJA 5EFQA 4YURA 5KBRA 3D5WA 3SV0A 2WTWA 3GT8A 5HO7A 3LQ3A 4FV1A 4JT3A 2OIBA 3U87A 4D4SA 4PNKA 2J90A 3FKLA 1IASA 4APPA 2ZDTA 4PL5A 4ZAUA 3RZBA 3A7HA 4RX5A 3I79A 4DA5A 3DQXA 3EZVA 4M15A 3U51A 1MRUA 4DAWA 4I0TA 4UXLA 4QMVA 3C4EA 5AV2A 3ZFMA 4CFWA 2REIA 1RW8A 4OTGA 3BQCA 3E3PA 3SC1A 5IF1A 2R3QA 2XP2A 1YXVA 3RAWA 3O0GA 4K1BA 3MVMA 3POOA 5A14A 1OPJA 4FGBA 2HWPA 2B55A 1TKIA 5AV1A 1JBPE 4FL2A 5GJGA 4J53A 2V5QA 3AQVA 3PXFA 3LIJA 2C6EA 4Q5EA 3VUTA 4J8MA 4EQCA 2JIUA 2LAVA 3DKCA 3V5WA 3C0GA 4XRLA 4FYNA 3SOAA 2I40A 1A48A 3ZS5A 4Y72A 5EI2A 2R64A 3NNUA 3I0QA 3UMWA 4BIBA 3CPCA 2ZMCA 1XHAA 1KE8A 1Z57A 1YWNA 5TE0A 3A7FA 3F3TA 2H6DA 2YLFA 3HV3A 2J0JA 3P4KA 4GSBA 4TYJA 2PUNA 5EI6A 4GH2A 5A46A 5C4LA 3LZBA 3MA3A 3WILA 5KCVA 3PA3A 2ZV7A 1PY5A 2BDFA 3TT0A 2E9PA 2G2IA 2GFCA 3G0FA 3NW7A 3V5PA 1YXUA 3P0MA 4IZAA 2B9JA 3LXLA 4TW9A 4A9TA 4I4EA 4X21A 4JG7A 3EFWA 4ZZMA 4WHZA 5CNNA 3FQHA 1JKTA 4I5MA 4BBMA 5EQEA 3ZRKA 3UIMA 5E8UA 3FC2A 2PVJA 3R9RA 5KMIA 2VUWA 4IWPA 2PZ5A 3C51A 5AR8A 2X2KA 5DWRA 4FV3A 2BKKA 3QTQA 2JITA 3RCDA 3I1AA 3FZPA 4FNWA 3C9WA 5TKDA 2NRUA 5KE0A 3FLQA 5JRQA 2C3IB 1Q8WA 3Q32A 5HCZA 4BBFA 5C26A 2WXVA 4PWNA 4GIIA 5JFSA 5CEOA 3WZEA 3F69A 4B7TA 4FIGA 1YKRA 3HRFA 4BTJA 4RJ4A 2EVAA 4DBXA 4L67A 3EQRA 2C6IA 2CGVA 4RVLA 4AA4A 1F5QA 5K5XA 3SA0A 4NM7A 1PKDA 3NUNA 3R1NA 1ZAOA 3NCGA 4I24A 2ITNA 3ROCA 2JBPA 2OH4A 4MNFA 5A4TA 3QX4A 4YJOA 2ZJWA 4G3CA 4G16A 1W0XC 3RI1A 1KV2A 3RPOA 4AW0A 5CANA 3II5A 5HHWA 4EOIA 4QQTA 4ZTMA 4OBOA 3R7YA 1Y6BA 3P78A 4JOAA 4O82A 1Q97A 3FPMA 1JNKA 5C27A 2PMNX 1O9UA 3AT4A 3PLSA 3IONA 4E73A 5A9UA 3VIDA 4CZUA 3HEGA 5FBOA 1K3AA 3DB6A 2JKQA 2WTKC 3C4ZA 4BHZA 4ZTRA 5DT0A 5EK7A 3HAMA 3BRBA 2WU6A 2XEZA 4NUSA 5CALA 5M55A 4EK3A 2YLEA 1IAHA 2OK1A 4K9YA 4P5QA 4XV2A 3KXNA 4RZVA 2OJJA 4YP8A 2UW8A 3CTJA 2C5NA 3BYSA 3KRJA 3QYZA 4L68A 4A4LA 4ZJIA 2LGCA 4LMNA 4G3FA 2QKRA 2OZAB 3VVHA 3NS9A 4GT4A 2G1TA
chains in the Genus database with same CATH superfamily
2EB2A 5CAVA 4FZ6A 3T9TA 3MI9A 2UW5A 2YN8A 1W83A 2QURA 2YM3A 5IH5A 2IEWA 3ZC6A 2G2HA 2UW9A 1E9HA 3QWKA 3KXZA 1BI8A 3QRJA 4J71A 5CEMA 2WOUA 1V0PA 4JS8A 3R7IA 3CJFA 4O0SA 3ZM4A 3BHYA 5LQFA 4PNIA 4N0SA 2R3OA 2WMQA 3OOMA 5HLNA 1H01A 4IQ6A 1IA8A 3LMIA 3Q5ZA 4FEQA 1Q61A 4DINA 4L3LA 3GB2A 2VTIA 4FRFA 4AA0A 2ITWA 4R3CA 4QP2A 3CQUA 2J5FA 4IZYA 3V6RA 3U55A 3FLYA 1H0WA 1ZZ2A 2HXLA 2UUEA 2XK4A 3BGPA 3NPCA 4FT3A 4X6QC 4MXCA 5J8IA 4C36A 4M97A 4YLKA 5AJQA 2W4OA 4IVDA 5DIAA 2P0CA 3DKFA 4KSQA 3VHKA 2FO0A 2JFLA 1XH8A 3R83A 2FSTX 5CSPA 4JDKA 4YNEA 3E93A 4EZ3A 5AA8A 5AADA 4YJPA 2CPKE 4ZS4A 5ITAA 3TJDA 4ENXA 4E4MA 3DCVA 4LV7A 1NA7A 4FV8A 1K9AA 1EH4A 3TL8A 2UW0A 5IQAA 3DQWA 4IB0A 3ZZEA 4DHFA 2QLUA 4DHZA 1ZOEA 4BZNA 2C0OA 3KF4A 4M3QA 1CDKA 3CTQA 4PTCA 4R78A 4DF3A 2X81A 4YSJA 3BYOA 5I5ZA 5JQ5A 4MVFA 4ACMA 1U54B 4IM0A 3ZXZA 5HIEA 1L3RE 4JG6A 4CQGA 3R73A 3FMLA 3CE3A 3L9LA 4EKLA 4PPAA 5HG7A 4L7FA 4AG8A 4L00A 3HDMA 3UOLA 1LEZA 2YISA 4M69B 4CRSA 3HP2A 4X0MA 3ZONA 2IZRA 5JMSA 4JXFA 4BCQA 1RE8A 3LFNA 3FJQE 2BHEA 5CX9A 3GCQA 4G31A 4GV1A 4F7LA 4QYHA 4S34A 2GTNA 2YEXA 3GEQA 3HZTA 1STCE 3O17A 4QQCA 4UY9A 4R8QA 5DA3A 4IAKA 2JD5A 4EZ5A 4F6SA 3ZH8A 4V0GB 3FY2A 2PVYA 3VS5A 5LVPA 4AGDA 3DFAA 3NNVA 5DYJA 1UWHA 5LJJA 1KE7A 5HKMA 5BYZA 3W0SA 5BVWA 4YJVA 3FL4A 2PL0A 2PUPA 4F7JA 2ZB1A 4USFA 3SXFA 3TEIA 4FVPA 4EOLA 3T3UA 5TR6A 3BV2A 2WTDA 3G51A 4J1RA 2DYLA 5FXSA 2UZNA 3LOKA 4LOOA 3VO3A 4QMOA 3VF8A 3EKNA 3PXKA 4CT2A 3DJ5A 3ALNA 1BMKA 3AC4A 3MN3A 1ND4A 2O64A 3ORIA 4QMMA 4EC8A 5AAGA 3CGFA 2OSCA 4P90A 2A98A 4ANOA 5H3QA 3VJOA 4F0FA 4WNOA 3NUXA 5LXMA 1UV5A 3BPRA 4D2VA 2OU7A 3O71A 4NCTA 4F99A 3BYVA 4GJ3A 3FXWA 2QG5A 3T3VA 5IQIA 4MAOA 4O6LA 3BU5A 3UDTA 3REPA 4ERKA 4NTSA 4CKIA 3ZSIA 3BYUA 4C37A 5CT0A 3PSDA 4BRXA 1NW1A 5J5TA 4ORKA 2IVSA 1G8KA 3V5LA 4IMYA 2ITTA 3CKWA 3COKA 3L9MA 4UV0A 2OI4X 4MBIA 3MS9A 4FTMA 4O38A 3HX4A 3TWJA 1PW2A 4ZJVA 5CEKA 2CNQA 3DTCA 4IFCA 5AEPA 2PMLX 3E8NA 4ZTSA 3SW4A 3ELJA 5HBEA 3HRBA 5DR6A 2ZYBA 2F57A 1XH4A 3AG9A 4CTCA 4O0XA 4IJPA 1U46A 2PE0A 3G2FA 3P9JA 1WBOA 4IVBA 3TNWA 4H3PA 1UU8A 4C62A 1A9UA 5IU2A 2C4GA 1FVRA 2JC6A 3QTRA 4XCUA 5HG5A 3U9CA 3BLHA 2IVUA 3QALE 5AP3A 3UC3A 2GS7A 4BDBA 3WF9A 2ETMA 1JKLA 4BDCA 3P7BA 5HIDA 3E63A 4P4CA 4FEWA 2WHBA 1Y57A 5AP6A 3FUPA 2WAJA 1XJDA 4AT3A 2EUFB 2VTQA 3D2KA 4R7HA 4BDKA 1SVGA 1H8FA 2BRBA 4ZTHA 3HMMA 4A07A 4EWHA 4QMUA 1IG1A 4J52A 5ANOA 4ASEA 4EORA 4D5KA 4RRVA 4E6CA 2H96A 1B39A 3MPTA 1REKA 2A1AB 2QU5A 1REJA 1T45A 3C13A 3RZFA 5C4KA 3BU3A 3MFRA 3MW1A 3NZ0A 3Q9YA 3WIKA 5K4IA 5D10A 4YR8A 3EKKA 4ITJA 4XLIA 4BTKA 3PY1A 1B38A 4NU1A 1SMHA 2ONLA 3QKKA 4FTTA 2ZV8A 5BVKA 2B52A 4FTKA 1M2PA 4GCJA 5ANDA 1KE5A 5CXHA 4I23A 5DOSA 2C5YA 5AR7A 4GW8A 3ZU7A 3PYYA 5J95A 1Q41A 5DFPA 1YDRE 3GGFA 3Q60A 3QWJA 5KHWA 3DBFA 3I4BA 2Y0AA 4MHAA 4TY1A 2Z7QA 3V3VA 1OL5A 4Y8DA 5IPJA 5L2WA 4QEBA 5BUIA 2CSNA 4IVCA 4RC3A 4NM5A 4PL4A 4AZEA 4HVDA 4O7YA 4PDOA 3LFBA 4AZFA 4GU9A 1IA9A 4LMUA 2YACA 5GZ8A 2VTAA 1WVXA 4W4WA 4A4XA 5JT2A 3QYWA 4YHFA 4HVHA 1ST0A 4Q2AA 4R1YA 4QMQA 2BFYA 3LLAA 3IW5A 5AR2A 2Y6MA 4RPVA 2E9NA 4MWHA 3D9VA 3U8WA 1RQQA 1ZYCA 2HOGA 5AP2A 4DEHA 5ANGA 4Z7GA 4A7CA 3WZUA 1Q4LA 3NDMA 4H3QA 1R39A 3ZLSA 4R1VA 4UWBA 5CQWA 3V6SA 5C8KA 5J79A 3F5UA 1SM2A 4BJJB 2WIPA 2I0EA 2PVFA 4ZSLA 4DG0E 4I22A 4QYGA 5HI2A 4XH6A 4RBLA 2J0IA 3OD6X 5L2TA 1OIQA 4YO4A 3AD5A 2CN8A 3V5TA 1R0EA 3IGOA 2XVDA 4IZ7A 1ZXEA 5E9EA 3D4QA 3NR9A 2VO6A 2FB8A 1SYKA 4NH1A 2C0TA 3FMJA 1WBWA 4G1WA 5HO8A 4BC6A 4OTDA 1GIHA 1ERKA 3I81A 4JLCA 4OR5A 3LW0A 2VU3A 3BKBA 3EN7A 3R8MA 4HGLA 3D5UA 5CAPA 4M67A 3W16A 4FUXA 4CG9A 2UZLA 2WU7A 2VX3A 4QP9A 4A06A 2HAKA 4E26A 1KUTA 4M13A 4FC0A 2B53A 3LM0A 5LMKA 4FKJA 2RL5A 3KMWA 3NSZA 3C5UA 5KMMA 3O2MA 3DOGA 3AD6A 1FOTA 1I09A 2IZTA 5HOAA 4C4GA 2P55A 3RHXA 5EM5A 2W5AA 4C3PA 4Q5HA 3KCKA 3F5PA 4EHEA 1H00A 4W8DA 1H08A 2XNGA 4PF4A 2QC6A 2JKMA 2NP8A 1ATPE 2BZIB 3LFAA 3UGCA 2DS1A 3LFCA 3R7GA 5L3AA 4IX5A 1JKKA 4IX6A 4ALVA 4JDJA 3KQ7A 3O7LB 1W98A 3IECA 2I7QA 4FT5A 3O8UA 4BN1A 3V8WA 4IW0A 1ZWSA 1JPAA 4AGWA 3UG1A 4AOTA 1BLXA 4F78A 3R9HA 3L8PA 4QMZA 2BVAA 3KIOC 3GP0A 4RZWA 3QLFA 5K9IA 3UQGA 4H05A 5CU3A 2XF0A 3ZUVA 2R7IA 2XBAA 3RM6A 1DI8A 3QZFA 2AYPA 3P23A 4D4RA 3KULA 5GJFA 2FSOX 3Q52A 1OBGA 4FEVA 3FQEA 1GZOA 2Y4PA 3PP1A 1FVTA 1YI3A 2E9OA 5GINE 2W1CA 4OTIA 2PSQA 3OWJA 1GAGA 4FL1A 4FV0A 3FHRA 3U6HA 2XS0A 4E8AA 3IOPA 1XH5A 2OF2A 2AC3A 3MPMA 3O23A 3KL8A 3QC9A 3VUDA 4CZYB 5AUTA 5JKGA 2ZFYA 4CEGA 3EQCA 5I9YA 4CT1A 1VZOA 1BYGA 4TWCA 4UMUA 4W4YA 4EOSA 2C3JA 1YHWA 4N70A 4CSVA 5HE2A 3NYOA 4RSSA 2PZPA 3FAAA 4UWYA 5HNGA 3ZFYA 3MTFA 4YJRA 2QOQA 3UZRA 4DDGA 2GS6A 5AR3A 3Q04A 1ZRZA 3DLSA 1XBCA 3MJ2A 2WTVA 3AC8A 3EIDA 3CQEA 3TZ9A 4BDEA 2GHLA 3DNEA 4KBAA 4X3FC 4XP3A 4ANMA 4FA2A 2RIOA 2YWPA 5I9WA 3UOJA 4RG0A 1G8SA 2R0IA 4C38A 1BL7A 5HG9A 1RDQE 1YQJA 4LL0A 1CKJA 4DH7A 3GCPA 3GQLA 5IEVA 2PPQA 3RAIA 1P4FA 4QQ5A 5F20A 2HW7A 1BL6A 4ZY5A 3AC3A 4FZFB 3HV5A 3MB6A 3HL7A 3ORPA 3CP9A 1L8TA 3ID6C 1WBNA 2UV2A 3RWPA 4CCBA 4GYGA 2XB7A 2EXMA 5E8XA 4ASDA 3VNTA 1OL2A 1JLUE 2FH9A 4L9IA 4U43A 5AP7A 4F1OA 2G01A 5E8SA 4EL9A 3IKAA 2ITPA 3R1YA 4QMWA 4TYHB 4BI0A 3WBLA 1UVRA 4ID7A 1J1CA 2F2UA 2WPAA 3JUHA 3TG1A 3UG2A 4CFVA 2XK9A 4QOXA 4EK4A 4OGRA 2C6LA 3IS5A 4EOOA 2WTJA 2R3PA 4QP8A 2VWYA 2VO7A 2IVTA 2XYNA 4GVJA 3NNXA 5CSWA 3RNIA 5I3RA 1U5QA 3CLYA 4FEUA 4QDVA 4S2ZA 4IDTA 4MXZA 2HENA 2Z7SA 3IO7A 4QYFA 4ZTNA 1M14A 4FG8A 4QTEA 5B2MA 3CSVA 3DT1A 2FUMA 5CVHA 4C2WA 4FUYA 3UMXA 4M0YA 5JN2A 3QTZA 5CF8A 2XH5A 4DC2A 4E6QA 5AR4A 2UW4A 4E3CA 4QO9A 4BKJA 4BR3A 3TXOA 5CZHA 3I5ZA 3U6JA 3VRZA 3UDZA 4LGGA 4DYMA 4TYEA 3IGGA 2QOCA 2YIRA 1YWVA 4U79A 2XKDA 4I41A 2I1MA 4U97A 4WT6A 3ZBXA 4EZ7A 3NFGB 1FMKA 4EOPA 3W10A 2J50A 4MKCA 4BDIA 4BHNA 5FRIA 1OMWA 2OKRA 1YDTE 3FKOA 5KMLA 3A4OX 3NRMA 3NAXA 1UNLA 1JOWB 1ZOHA 2NPQA 4OTRA 2C47A 4YHTA 3UYTA 5EW3A 5CNOA 4DFLA 1V1KA 4BYJA 4BB4A 4O84A 4U6RA 2IW9A 3W2OA 2VO3A 2X8EA 3RM7A 3OCBA 4FKSA 4N6YA 3F3WA 4OUCA 3OZ6A 4FTOA 2Q0NA 2O3PA 2WMSA 3G9NA 1GOLA 2X1NA 4FNZA 2CCHA 3FC1X 3NIZA 3EOCA 3EN6A 5A4EA 2BZKB 4YC6A 5AM7A 4ACCA 3VS7A 4V01A 3PJ2A 1F3MC 5DMZA 1U4DA 3Q9WA 3THBA 4AXAA 5BUEA 3FMEA 4NSTA 4CNHA 3UO4A 4KIOA 5J9ZA 2VRXA 1GIJA 3EN9A 4WNKA 2QODA 5IQGA 1XH7A 3QBNA 2OXDA 4CGAA 4O0VA 3D7TB 3KVXA 4ZTLA 5K0XA 3ORTA 3OWPA 5D7VA 4QP7A 4DTKA 3ZM9A 3ANQA 3SHEA 4BICA 5EI8A 4GMYA 3R6XA 2HY0A 4C4HA 4FIIA 5KO1A 4RX8A 2ZDUA 1Z9XA 3QD3A 4AUAA 3GOKA 4FSYA 1NY3A 5A4LA 4S30A 4J98A 5FTQA 5HO6A 1E1VA 3GOPA 4L7SA 2R3MA 3KXHA 4DGOA 4K11A 2R3FA 2HK5A 3BI6A 1IAJA 2G9XA 4F9CA 5M4CA 4BVUA 2UZOA 2DWBA 4HGSA 2JDSA 4M84A 5HLWA 4C3RA 5FM2A 1Q3DA 2VWZA 4YJNA 4XMOA 3R00A 3TKHA 3A61A 4L01A 5L8JA 3DZOA 4J97A 3MH2A 3LMHA 2ONLC 4ZLOA 1XBAA 5T68A 4ALUA 1S9IA 2VTPA 3A62A 5EW8A 5IKWA 3UP7A 5E8YA 4IAYA 2ITOA 3QKLA 4YNOA 3PVBA 4WA9A 2B9IA 3VUMA 2Y7JA 4E6AA 5L2SA 4IH8A 3MTLA 3FDNA 4RIYB 4GS6A 3KK8A 4QP6A 2O8YA 3NUPA 1DS5A 3NUAA 3I7BA 4GT5A 5CTPA 3VC4A 3PXRA 5FEDA 3VQHA 4G9RA 3FYJX 5LVNA 1APME 3NUYA 1URCA 5AAEA 3VF9A 4ZZNA 2XK8A 4MXXA 5J1VA 3A8WA 3PY3A 4PPCA 3V5QA 4DEGA 2WELA 4IAFA 4M66A 4ZIMA 5HU3A 3QC4A 3LFSA 4G6LA 3ZBFA 3OT3A 3OCTA 3UVRA 2DUVA 1PXMA 4EHGA 3HMIA 3HAVA 4FSNA 2FSLX 2YJRA 2ZB0A 4CKJA 3KRRA 3FKNA 1IR3A 3PJCA 4HPUE 3ZRMA 4KWPA 4DEAA 4EUTA 4OBQA 2WQMA 3SD0A 4ACGA 4BY9E 2RFSA 4MUQA 1XH9A 5IA2A 1MQBA 3EQFA 4IM2A 4PUZA 3O50A 3PVGA 4RIYA 4WBOA 5FDPA 3IDCA 3A60A 3E7OA 3DBDA 3QCYA 4RIWA 3R7OA 4S33A 4TYHA 5HD4A 5IDPA 4YJTA 1UU3A 1PXPA 1M7NA 4FKIA 5I0BA 4PL3A 1YWRA 2HZIA 2ITVA 2BHHA 2PWLA 5L4QA 2IWIA 3BX5A 1ZMWA 3VS0A 3DK7A 5CU0A 3VAPA 5A4CA 1IRKA 4ONAA 2X2MA 5C9CA 4QMLA 3QTUA 4YZMA 4O7RA 4D5HA 1OECA 4GL9A 5CEQA 3LVPA 4Y5QA 3MWUA 5EOLA 4N4SA 5IQCA 4KIQA 4RFMA 2XA4A 4U9AA 1YI4A 5C01A 3ZSGA 3JR1A 2P2HA 3H9OA 2VV9A 4GU6A 2W1EA 4B4LA 4GG5A 3DXQA 4C57A 4IB5A 5FTOA 1PXOA 2FYSA 5IA3A 4S32A 4DT9A 3FL5A 5FTGA 2GFSA 1ZY4A 3D83A 4J99A 3P1AA 5JGDA 2I6LA 3AC5A 3BQRA 3VQUA 5HE3A 3EHAA 1BX6A 4ZSGA 3DV3A 3R30A 2VNYA 4V0GA 3QZIA 3HNGA 4U41A 3UNJA 4FNXA 3LKMA 3UJGA 4G6NA 2BDJA 3FLNC 3R63A 3CY2A 4PDPA 4KS7A 3RWQA 5BYLA 4KINA 3EQBA 4O0UA 2Y8OA 2JEDA 3MY1A 2X4ZA 4QMSA 4EH7A 5KKRB 2W4KA 3FHIA 3Q4UA 5EKOA 2Y9QA 3W32A 4AWIA 5T3QA 2ZM3A 4K8AA 4X2FA 4I6BA 3V8SA 3W8QA 3S95A 3PA4A 3ZEPA 3R71A 4GUBA 2W9FB 3HDNA 1OKYA 3W55A 3P86A 2VWIA 4NEUA 5JRSA 4JIAA 1Y8GA 2UW6A 4F64A 3EWHA 3PJ3A 2R3NA 4WG5A 4YPDA 4A9UA 3GXLA 2GHMA 5GZ9A 3L8XA 5ETAA 2WZJA 2W05A 1YXTA 3PXYA 4FR4A 1PXIA 4FIJA 3AT2A 3G9LX 5CQUA 3S1HA 3QA8A 4OAVB 1Z5MA 5KUPA 4PMMA 2VTRA 4D0WA 3GFEA 4NK9A 2OJFE 4MBJA 2XIYA 1FGIA 4ZXTA 4ANBA 3I7CA 2QOFA 3KMMA 3OHTA 4I94A 4N6ZA 1J1BA 4WUNA 4ZOGA 5HZNA 4XV1A 1Q99A 4IANA 3HRCA 5CI6A 3F2RA 2ZOQA 3KY2A 3AT3A 4JRNA 3BEGA 4N57A 3EFJA 2X4FA 3PFQA 3OC1A 3VBVA 2B1PA 3B8QA 4BCOA 4YC3A 3MY0A 3ORNA 4FGRA 5DN3A 2JDOA 5HG8A 1YDSE 4QTBA 2XEYA 2C6MA 2UZVA 3GUBA 5JQ8A 4RA5A 4CZTA 1J7UA 3ROYA 3W0NA 4BGQA 2JDRA 3AGLA 3VBTA 4BKZA 1YRPA 1W2CA 5M53A 1JSVA 4G3GA 4CFXA 4I92A 3FLSA 4AQCA 3BELA 5BVNA 1UU7A 1URWA 2QU6A 4JBQA 4F7NA 4KABA 2WOTA 2HZ0A 4AA5A 1H28A 3PSCA 5TO8A 3PUFC 5E90A 2O63A 5CVFA 4JBPA 1XMLA 2QVSE 2C3LA 3UIBA 3ZHPC 2F7ZE 2SRCA 4CVAA 2X39A 2UZBA 4L6QA 3OWKA 5J7HA 1VJYA 2QONA 4FZ7A 4DHJA 3M2WA 5AUUA 1ZZLA 3OUNB 4W9WA 3ZO1A 2R3LA 2GMXA 3WE8A 5A3XA 3NMUF 2ESMA 2RKUA 4OTFA 2WO6A 2IW8A 2QG7A 3MIYA 4G3DA 4M69A 5HX6A 2GNFA 1WBVA 2FA2A 2AC5A 1YXXA 2JBOA 2E9VA 3VUGA 2NO3A 4DFZE 1U5RA 4TKSA 2V62A 3COHA 3PUPA 4HVIA 4QDEA 2YIYA 3F7WA 4PP7A 4EUUA 1QL6A 3RK5A 4E4NA 4BCKA 3RHKA 4L3JA 3CXWA 4I0RA 4UYNA 1UU9A 3D7TA 5E8ZA 3GU8A 4YZ9A 3SKCA 3FQSA 3WZJA 4FKGA 1H1RA 2CNUA 3NCZA 4RC2A 5HVJA 1SNXA 2QLQA 2UVYA 3T8OA 4D1XA 2W1ZA 2QOLA 4GG7A 3RJCA 3QXOA 4W9XA 3W33A 3FZTA 4PPBA 4HGEA 4Y73A 3ORXA 4BZDA 4E4LA 3QHWA 4WUAA 5CAOA 3A8XA 3FLWA 2YHVA 3ATTA 1E1XA 3OXIA 3QQJA 4CFUA 1FQ1B 3MDYA 2VTHA 3KF7A 3CJGA 3HV6A 4RWIA 3R7UA 2W17A 4FTIA 5AUVA 4RQKA 2PVHA 4W4XA 2Q0BA 3F82A 4XX9A 3AKJA 2YZAA 3E8EA 4IFGA 5FWKK 2OLCA 3WI6A 4E93A 1FINA 4NT4A 3TV6A 4U80A 3UO6A 4Y83A 4JAJA 4NJDA 3WARA 4FKWA 2IPXA 3LJ1A 4I4FA 4AFJA 4EBVA 4NFMA 3Q53A 4QTCA 4L42A 4WG4A 3QD2B 4XLVA 5ETIA 3SGCA 4F65A 2C1AA 2GHGA 5EW9A 2CKQA 3P7CA 5CU6A 2WQNA 5EQYA 1RJBA 3DA6A 1H26A 4IE9A 4TYIA 2H9VA 4MD7E 1VLRA 3N51A 2I0YA 3TM0A 4H58A 2PYWA 2OBJA 5IQFA 2JGZA 4TWNA 3R0TA 4CYIA 3DK3A 2CJMA 1OI9A 4E5WA 2Y4IC 3BGZA 2IZSA 2XNNA 1J7IA 3FZSA 4ZZOA 2F2CB 4JBVA 4W4VA 1BKXA 3CEKA 3F88A 1OKWA 3BWJA 2Z2WA 4PRJA 2OJ9A 4X2KA 4RC4A 1FBNA 4HZSA 2HXQA 2X9FA 3E92A 3GC8A 3NEWA 4KA3A 5H8GA 4GUEA 4USDA 4PTGA 3ZDUA 3Q4TA 4YO6A 3A4PA 2CLQA 3OMVA 3DNDA 5J9LA 4GT3A 5M08A 3PWDA 3EZRA 3DKOA 1H0VA 3FLZA 3FZOA 2C5OA 3NW5A 3QUEA 4KAOA 5D7AA 4DLIA 3L9PA 4EOKA 3FEGA 3R22A 2W5BA 1GZKA 2H8HA 3FV8A 3TZ8A 3W8LA 4FIEA 4C61A 4GKHA 4AAAA 3U4UA 4IB3A 1P14A 2VWWA 1M2RA 2XRWA 3HGKA 3R8VA 3SXSA 3V5JA 1HCKA 3HLLA 4FKVA 3V01A 4DH5A 4ARKA 3TKIA 5LWMA 4ZMEA 5DR2A 3OEZA 3UOHA 2YZLA 5LMAA 4P5ZA 4P2KA 2VX0A 4FMQA 3UIUA 4R6VA 5KMNA 4HNIA 3K3IA 3N4TA 1OIRA 4GFOA 4YTIA 4RX7A 3Q4ZA 1PMUA 2YFXA 2X9EA 4YLJA 3ZRLA 1KWPA 5C8NA 5FEQA 4ASZA 1CTPE 2VTOA 1WMKA 4RWKA 4DFUA 3EL8A 1VEBA 2XM9A 4OLIA 5HD7A 4FOCA 3SRVB 4ZLZA 4WNPA 3ODYX 3EH9A 1ST4A 2PZRA 4F08A 4NYEA 4DTAA 4UWCA 3LCDA 4AXCA 1OM1A 4K6ZA 4Y85A 4BCPA 3BEAA 3RPYA 4MXAA 2YIWA 3NWWA 3BE9A 3FXXA 1PJKA 5H2UA 4ZEGA 4A9YA 4E5AX 3ZO3A 2WMVA 4BIDA 4EH2A 2NYAA 4CTBA 3KB7A 3QKMA 2WTKB 1XR1A 3OW4A 4RWLA 4FTRA 2XK6A 3BL7A 3ZC5A 4YBJA 5I9XA 3HV7A 1S9JA 3P7AA 4D55A 1NVSA 4F70A 3AOXA 3PPKA 5IQEA 2BIYA 3QGWA 2YA9A 4F0IA 2CCIA 3UNKA 4MNEB 3IW7A 3MGYA 3QRUA 3ZZWA 4EK6A 5M51A 4HOKA 3FI8A 5JGBA 4EYMA 3LXKA 3AKLA 3EQGA 2BR1A 1OL7A 2HZNA 4EBWA 4LDTA 2WMXA 5M09A 3MFTA 4JR7A 5LWNA 3R21A 3KRWA 3IK3A 2DQ7X 2QHMA 3ZDIA 1QPJA 5D12A 3ODZX 1GJOA 3FE3A 5FP6A 2JAMA 1V0OA 1Q8YA 1UA2A 5HEZA 4AS0A 5KX8A 4FZAB 3OEFX 5HESA 3OFMA 5HICA 4ZY6A 1W2FA 3P5KA 4U45A 3VN9A 2QI8A 5IZFA 2Z02A 3LJ2A 4EH9A 3UQFA 1PKGA 3OOGA 4IHPA 4TTHB 5AX9A 5HE1A 3UBDA 1MRYA 3K3JA 2R4BA 3VS4A 5DI1A 3ZUTA 2HY81 4FEXA 3OG7A 3LAUA 1PXJA 3OROA 1IEPA 4FNYA 5D11A 5A4QA 2VWUA 3PFYA 2BALA 5IQHA 2R7BA 4AXFA 3QZGA 2W1FA 3BHTA 2BDWA 3LCOA 5AV4A 3G6HA 3R1QA 4XG4A 1CSNA 4AP7A 2QO2A 3LFQA 4QRCA 5KMKA 2VWXA 2YJSA 5JK3A 3E8CA 1QMZA 4O1PA 4O0YA 3E62A 4NM0A 3W0PA 5DGZA 2VNWA 4IDVA 5FEEA 4DEDA 1R3CA 2GNJA 4IAIA 2IO6A 3BLAA 5H8EA 3D5VA 4FSWA 4LRJA 2BCJA 4D9UA 4CLJA 2R5TA 3RTPA 4AU8A 3C4WA 3QCQA 4FIHA 3VWAA 3ZOSA 3QXPA 5JFVA 5D41A 2W4JA 3FXZA 4AACA 2PZIA 1SVEA 2OIQA 2V22A 4I3ZA 4ITIA 3W0MA 2OWBA 3Q3BA 2QO9A 3RVGA 1Q3WA 4FG7A 3ORZA 3E64A 1JSUA 5BQ0A 2J7TA 4RJ6A 3S4QA 4AZSA 3NVKI 3DLZA 4WSQA 4Z55A 1OBDA 3PWYA 2QKWB 2ZAZA 2F9GA 3WYXA 4R7BA 3VJNA 4F9WA 5CT7A 4O4EA 3ULZA 3OP5A 1GNGA 5L8KA 4H36A 5CU4A 3DS6A 2W5HA 1P2AA 1ZARA 3ENHA 4FOBA 2A2AA 3POZA 1PYXA 4FKRA 2W96B 2B54A 4TRLA 3O96A 2ZV9A 4JR3A 3ZTXA 2VTLA 4G9CA 4MF0A 1TVOA 4BWXA 4C34A 4AOIA 2XRUA 5FM3A 5TOZA 2YIQA 2X8IA 3UPZA 3EL7A 4U44A 3IQ7A 1YHVA 4TXCA 4U40A 2ACXA 3GC0A 4HCVA 5DHJA 3UE4A 5E8WA 4DFXE 3VBYA 4EYJA 1XMMA 4GIHA 5L2IA 2R2PA 3CQWA 3DGKA 3TZMA 2B9HA 2JIIA 3G6GA 2YITA 3BHUA 4OAUC 5F94A 4EOJA 2XARA 3PE2A 3CPBA 4JQ8A 2Y6OA 3TNPC 2GQRA 3DJ7A 4DLJA 4E5BA 3FPQA 2UZTA 2YM6A 2IJMA 3C5IA 4NIFA 4U3YA 4IM3A 3FYKX 3H10A 4ZJJA 4IVAA 2XAOA 4ZS0A 2BAJA 5GZAA 3BU6A 3A7JA 5FGKA 4QP4A 4AW1A 4CXAA 2VTMA 5CYIA 4BWKA 2JKOA 4JBOA 5EYMA 2X7FA 2PUUA 2BIKB 5CY3A 2CKEA 4XP2A 3DY7A 4YZNA 4XYFA 4BI1A 3DJ6A 3H9RA 3ORLA 4XV3A 5L2QA 2W1DA 4NM3A 5JZNA 3UPXA 3W2RA 2XCHA 3I6WA 3SW7A 1SNUA 1OGYA 2BTRA 4FK3A 3H30A 5ANEA 3W2PA 5KHXA 3M1SA 5JFWA 3Q9ZA 2OXYA 2BRMA 2J9MA 3R2YA 5BNJA 2XKCA 5IG1A 5EHOA 3MA6A 2GSFA 3U54A 3IDBA 4JRVA 5FBNC 3E8DA 5DRBA 3UZTA 3PRFA 4ANLA 4TPTA 4O4BB 2XNPA 3FMMA 3ITZA 3PJ1A 4I5PA