2NRWA

Crystal structure of the c terminal half of uvrc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
217
structure length
204
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHTVASLVVFEDGFPKKGDYRRYKIEQDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 63
structure length 204
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrwA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrwA01
5J2EA 2ZTEA 2J6SA 2KZZA 3UPQA 4PGXA 3HX0A 4DFJA 4QZBA 1MC8A 2BCRA 8ICOA 3OJUA 2C28A 4GXKA 2AGPA 3HT3A 3GIKA 4DL3A 3PW4A 1U9LA 4M9GA 1BPZA 5DLGA 4FS2A 3SV3A 1A76A 3IHQB 4TUPA 2JZBB 3V7JA 1U49A 4RQ4A 4ED2A 1T8EA 4DSIA 7ICRA 3GIJA 3H8WA 3PX0A 5J0PA 1S97A 5KG5A 4NXZA 4QZCA 5F9LA 4RQ0A 3JPNA 3JPQA 3EPIA 4I2JA 1KLNA 2ZJ5A 1XWLA 1XC9A 1NJYA 5BOLA 4ED0A 3TQ1A 2V4QA 2FMQA 4R63A 1U48A 2JEJA 4FO6A 4DL7A 4YCXA 4JK1A 2J6UA 5D4BA 3PO5A 4G3IA 4MFAA 2J6TA 5J0TA 1NKBA 4R8UA 3EYZA 4XRHA 2ASLA 4KLQA 1D9DA 5HP4A 2HVIA 2W8KA 4KITB 3RH4A 3RAQA 1KDHA 5KFPA 4RQ5A 3EZ5A 4ECUA 9ICBA 3LWMA 5DB7A 3RRHA 1ZQRA 5KFZA 4JWNA 2KZ3A 9ICUA 1COOA 1ZQOA 5DQIA 2Y1JA 1WCNA 8ICGA 2AQ0A 3JPRA 4RUCA 5DQHA 5DKWA 3MDCA 4ECSA 3Q8PB 3V6KA 2BGWA 1KRPA 9ICNA 1ZQUA 4RU9A 4Z6CA 4YD2A 3RB0A 4EZ9A 4UB2A 2BPFA 4DSEA 2HHVA 4GXJA 3RB3A 1SL0A 5IILA 2XY7A 4KLIA 5CA7A 2M9NA 4F5OA 7ICJA 3PNCA 8ICTA 1MSWD 9ICHA 3BQ2A 2BDPA 3PR4A 1UA0A 1Z3EB 3AUOA 1NK7A 4B9VA 3RJKA 2PI4A 4KLLA 5D46A 7ICGA 1CUKA 4Q8FA 3C2KA 3TFSA 2F1IA 3FDSA 4RPXA 4PHAA 2BKEA 1U45A 4DSJA 4KLDA 4B9UA 3RJHA 3C23A 3MR5A 2XGPA 2BPGA 2FLNA 5KFTA 3Q8QB 1ZYQA 1S76D 5J0YA 5J29A 4TUSA 1X9WA 1LV5A 1QTMA 2F1HA 5KG2A 4I2DA 5HMLA 4ECZA 3H8SA 7ICQA 1XSLA 4DEZA 3H7IA 4C8NA 5J2AA 2BQUA 2FLLA 3OGUA 2ZUDA 5KT7A 4YXMA 1CEZA 3M9MB 7ICLA 5HHIA 5KT5A 3G6YA 4F4ZA 4R8UB 4BWJA 2ZJ8A 3Q8SB 4KLGA 1ZQGA 3PW5A 4RQ1A 4MF8A 3PX6A 2AJQA 2A1JA 3RH5A 3Q8LA 4CCHA 1JIHA 3T3FA 1TVAA 4YR0A 1SKSA 4IRCA 2ATLA 2NRZA 4UB4A 2P6RA 4IRDA 4DSLA 3MGHA 3MGIA 4C8OA 1ZQBA 3JPSA 2FMPA 1NK8A 4I2FA 5IIOA 2XY6A 3GQCA 4DQPA 2NRWA 4LZGA 3HWTA 4RPZA 1UA1A 1TK5A 4I2IA 4DF8A 1ZQAA 4YP3A 4LVSA 1UT5A 3H4BA 2JEFA 4QW8A 2R8GA 5KG4A 4RQ3A 4MFFA 3SZ2A 1SL1A 3MR3A 4DOAA 5EWGA 2C2DA 4ELUA 9ICVA 1IM4A 3RRGA 2KZMA 4P4MA 4GLXA 4YQWA 9ICLA 5J2JA 4YN4A 1T7PA 3OSNA 5BPCA 3KHGA 4J9NA 3V7LA 4ZH4A 5KFYA 4GC6A 4YD1A 5KFIA 3TFRA 1LB2B 4Z6EA 3PO4A 2HHQA 3OSPA 3EW9A 4O5EA 4O3RA 3UQ2A 4R64A 4EBDA 2HHWA 3T5JA 4EEYA 3NGDA 2FPMA 3BQTA 2ZUBA 3V7KA 2BQ3A 4FBUA 9ICIA 4PGYA 9ICJA 3GV8B 4JV0A 4RUAA 2B21A 4UB5A 1S10A 4F8RA 5IIJA 2HHSA 4DOBA 9ICOA 4Q43A 2MAXA 3RB6A 4PHPA 3H8JA 5KG6A 4RNOA 3MFIA 3KHLA 5KFGA 4B9SA 1ZQMA 2W9BA 5JUMA 5KT3A 1ZQDA 4F2RA 4MF2A 2DPJA 4TURA 3RJJA 4LZDA 1C7YA 4KLHA 4J9QA 5IIKA 1S9FA 5J0OA 3AU6A 4DSKA 4ECVA 1RZTA 5J0WA 5KFEA 4TUQA 5KG7A 5KFCA 2XGQA 9ICGA 4KN7A 4KLSA 3AU2A 1K1QA 4O3QA 4R66A 2IA6A 4RNMA 3K4GA 2UVUA 4I2CA 2BHNA 1Y88A 1NJZA 7ICVA 2I9GA 5L1JA 3PW7A 1D9FA 3UXNA 1XS9D 3PY8A 4JWMA 5KFOA 4P4OA 5KFKA 1ZQEA 2AU0A 4QWEA 3V6JA 2BPCA 3T5LA 3EWAA 1NK0A 3C2LA 3V6HA 1ZQSA 4ED3A 3Q8KA 5J0QA 4ED7A 2P66A 5KFQA 3LDAA 3KHRA 1ZQKA 5KG3A 4DO9A 2FPKA 1D8LA 3HW8A 4DL5A 5DBAA 4F4XA 3QE9Y 9ICMA 5HMMA 1TKDA 1ZQCA 3TI0A 2F1JA 8ICQA 1X2IA 4B9MA 2Y1IA 3ZDEA 5KFLA 3GV7B 4I29A 3RAXA 5DB6A 4RQ6A 2Q0ZX 4O0IA 3SV4A 4FBTA 4YVZA 1BPYA 1QSYA 2BQRA 8ICBA 4DQRA 1NK6A 4IQWA 4K4GA 2HHXA 2W9MA 4NLGA 1KFTA 1ZQWA 3RJFA 2UVVA 3TARA 4F93B 3ZDCA 1S0VA 2W9BB 3V72A 4ECQA 1U47A 4F5QA 2AQ4A 3NTUA 2ALZA 5J2GA 2ZUCA 3BJYA 4KMUA 4F92B 9ICEA 4ECYA 4FS1A 1JXEA 3B0YA 2BCUA 3OHBA 3SI8A 5KT2A 4O5CA 4ED6A 1S0NA 4NM1A 1JX4A 1XSNA 2HW3A 2PXIA 4QZDA 1ZQTA 4B9NA 3UXOA 3RH6A 4NLZA 5DDMA 4KTQA 4M47A 3N97B 4DFMA 1TAUA 1PZNA 4DLEA 4PHDA 4R65A 3PVXA 5J0UA 5KFDA 5IINA 5EOZA 2RDIA 8ICNA 3ZD8A 3GFKB 3RR7A 3IM1A 5J2BA 3GIIA 3C5FA 3MR6A 3M8RA 3THVA 4JUZA 4DS5A 2BCQA 1RXWA 5DLFA 7ICSA 4UAYA 3ZDBA 4UQGA 3ISBA 4DL2A 1RXVA 2ISPA 9ICRA 1L3SA 3KHHA 2PFOA 2JEIA 5KFXA 2WTFA 8ICIA 4NLKA 1NOMA 5J2IA 3JPTA 2XC9A 1TV9A 5DDYA 4I28A 4HYKA 1NKEA 5BOMA 1KEJA 4IQTA 5KFBA 3MR2A 1BPXA 4DS4A 4J9MA 1MQ3A 8ICFA 1X9SA 4TQRA 4O3SA 3QEBZ 2DFLA 5J2DA 1SL2A 2I1QA 4QWAA 1TK8A 2C2RA 2ZTDA 5DB8A 2HHUA 2AGOA 4DFPA 4J9OA 5TZVA 3GV5B 2NRTA 2BCVA 4B9LA 3G6VA 1ZQIA 1ZQFA 4JV2A 4QZFA 2V4RA 3TAPA 4RZRA 4BWMA 5IIIA 4C8MA 4EYHB 4ECWA 1H38A 1XO1A 3SYZA 1D8YA 1ZQLA 4GXIA 4E0DA 7ICHA 4F4KA 4DL4A 4IR1A 4P4PA 3RB4A 1BGXT 4KLOA 5KFWA 8ICLA 9ICFA 4M2YA 4O9MA 1RYRA 1JN3A 4JV1A 4KLJA 1ZQYA 4YMOA 2IHMA 4BDPA 4DWIA 4M04A 4PH5A 1AROP 4J9SA 1DOQA 2JZBA 4ED8A 1NKCA 1RPLA 4IQVA 1HUZA 1KFSA 9ICKA 4RT2A 4O3NA 4F5PA 4RQ7A 1EXNA 4ECXA 5L1LA 4TQSA 1KFDA 5KFVA 4J9PA 4DOCA 4KLEA 4YXJA 4PGQA 1U4BA 3HPOA 2R8JA 4YR3A 5L1IA 2VA2A 1RYSA 2A1JB 3C1ZA 4QZAA 3C2MA 1ZQHA 7ICKA 3QEAZ 3ZD9A 3C5GA 4F5RA 4F3OA 4F2SA 1IXRA 1MQ2A 1XSPA 4UB1A 3BDPA 5KTQA 4IR9A 4I27A 1L3UA 2UVRA 1B43A 1ZJMA 4BGDA 3PMLA 2BR0A 3RJGA 1T4GA 3C21A 2C2EA 2XCPA 4ELTA 2FPLA 4J9KA 2PFQA 4KN4A 5HHHA 5CJ7A 3TANA 1S0OA 3RR8A 5CHGA 4Q8EA 2RDJA 3C1YA 4BXOA 4P2HA 4RT3A 3PW2A 4UBCA 1ZQVA 3UQ0A 4F4YA 4F50A 3UXPA 2KFNA 4NM2A 4ECTA 4QWDA 2XO7A 7ICNA 4QZIA 2UVWA 2XCAA 1JMSA 3RBEA 4KLUA 1TK0A 5CP2A 4YFKA 4UBBA 2NRVA 4DQIA 5KFNA 3OHAA 4QW9A 3ISCA 2ZJAA 3T5HA 2HVHA 2KFZA 4RQ2A 2ASDA 8ICMA 3QZ8A 5KFUA 8ICUA 4M6WA 2W9AA 4M9NA 2NRRA 5KFJA 5J2CA 1NK9A 2OWOA 3ORYA 3BQ1A 4XUSA 4O3PA 4DLGA 4F91B 4PPXA 4I2EA 4QZ8A 8ICJA 3RJIA 4QWCA 4RPYA 4UAWA 7ICEA 5DQGA 4UAZA 5J0SA 2NRXA 3M9NB 1N48A 5F9NA 2V9WA 2VA3A 3ZDDA 3H40A 1ZQPA 1KSPA 1L3VA 4NLNA 4I2AA 4XQ8A 3PX4A 3JPOA 5DBBA 3MABA 1KTQA 1S77D 1BVSA 5KT4A 5EWFA 1ZETA 4EZ6A 2R8IA 4C8LA 4MEYA 5C5JA 1NJXA 3LWLA 8ICAA 9ICAA 3MDAA 4RNNA 3PV8A 1A77A 4I2GA 5J0XA 9ICWA 4Z6FA 5DBCA 4QZHA 5L1KA 4XA5A 2H5XA 1T3NA 4BXOB 4RQ8A 5L9XA 4YG2A 4PHEA 2ASJA 2W9CA 5DG9A 7ICPA 4B9TA 8ICYA 2PFPA 1SKRA 1HJPA 5J2KA 1L5UA 4KLFA 4Z6DA 1TAQA 3ETLA 7ICFA 3BQ0A 3RJEA 8ICCA 1ZQNA 2IHNA 1ZQXA 8ICRA 4M6WB 2DPIA 5KFRA 3H4DA 5KT6A 5HNKA 3LK9A 2FLPA 4YMMA 2MUTA 4C8KA 4QZ9A 5DGAA 4M9JA 7ICTA 3T5KA 1SZPA 4ELVA 3RBDA 5DB9A 3GDXA 2HHTA 9ICSA 4KLMA 7ICIA 3MBYA 1DGSA 4Q45A 9ICXA 2R8HA 5DGBA 8ICVA 3RTVA 2VANA 8ICEA 2BCSA 4I2BA 3G6XA 4DL6A 3KTQA 7ICOA 1S0MA 4YMNA 5J2HA 2JEGA 4QZGA 3B0XA 1SKWA 2PFNA 5CB1A 4M0AA 4ECRA 1TFRA 8ICSA 9ICTA 4DF4A 4QWBA 3PMNA 1QSLA 1K1SA 1Z00A 1ZJNA 1NK4A 4UB3A 4QZEA 5IIMA 1HUOA 1BPBA 3E2EA 5J2FA 2IBKA 7ICMA 1UT8A 2AGQA 5KG1A 1L3TA 1ZQQA 9ICPA 4M9LA 3HP6A 8ICXA 2ZTCA 4EBEA 8ICKA 3ISDA 3GILA 1JXLA 5D49A 4DFKA 3M8SA 3OJSA 4EBCA 4MEXA 2FMSA 1ZQJA 4Q44A 5KFSA 4EYIB 1N56A 4F4WA 4KLTA 1XU4A 3EPGA 7ICUA 3MFHA 2W9CB 1BPEA 4DQQA 3ZDAA 1V9PA 2XY5A 4ED1A 9ICCA 3PR5B 4NY8A 4O5KA 3Q8RB 5KFHA 4J9LA 5KG0A 2C22A 1NK5A 5CWRA 2P6UA 3TAQA 1NJWA 5J0RA 1X9MA 4M9HA 8ICWA 4K4HA 1QLNA 4MFCA 9ICQA 5KFFA 5EWEA 2PI5A 5KFAA 3PW0A 4F5NA 2MUTB 3N4MB 5CR0A 2KTQA 5KFMA 2VA8A 2R8KA 3JPPA 4GC7A 4I2HA 4DQSA 1QSSA 5DG7A 4IRKA 8ICHA 4K4IA 5DG8A 8ICPA 2KN7A 1ZQZA 4DSFA 4X5VA 3GIMA 2LYHA 3K75D 1WCLA 4J9RA 2ISOA 4O3OA 4YR2A 2IMWP 3M9OB 4IQUA 8ICZA 3C65A 1BPDA 3FYHA 3QZ7A 3Q8MA 2W8LA 1B22A 2GWSA 1Z00B
chains in the Genus database with same CATH superfamily
4CHZA 3HKZF 1LKYA 3MXMA 3HX0A 4JN4A 4NYFA 1L7NA 3UIQA 2C28A 4GXKA 1JXBA 4AF1A 3PW4A 1A5WA 5LY3A 1KN5A 2HI0A 4WFAL 3WXMB 1BPZA 2HBJA 1NZBA 4FS2A 3SV3A 4X66K 2VWKA 4LF5K 1WG8A 1U49A 2JZBB 4E1MA 3LZIA 4QJFB 3R9KA 3ID6A 1T8EA 1VSEA 3PLAA 1LOTB 4OJLA 3PX0A 2P1JA 1S97A 3H45C 5HOOA 4MFBA 1TGOA 3HSCA 5ALQA 2KG5A 4I2JA 1KLNA 4MHVA 4AHCA 3HKZC 3DLEA 1XC9A 2JEJA 5BOLA 4WFBL 2FMQA 1BNPA 1TVRA 4FO6A 2QKBA 4JK1A 2J6UA 5D4BA 3KLIA 4MFAA 5EVZA 1HLUA 1HYVA 1NKBA 4DU1A 3ZSYA 1COKA 2P9NA 2OANA 2QWMA 2HVIA 2JV3A 2BDUA 4EENA 2IVPA 3RH4A 2XVTA 3BS7A 4FJMA 2YB4A 5KFPA 3DDHA 4ECUA 2FLOA 4K42A 3RMAA 2BGGA 3ITHA 3C7NA 4CZMA 4K8ZA 3EZWA 3TWHA 2Y1JA 5JLHA 1KKXA 2GO7A 3JPRA 2BGWA 5EXWA 1ESVA 1RT6A 2A6AA 2DUYA 1RBRA 4KO0A 3CCQN 3IG8A 2E1YA 2HHVA 3DWLA 3HK2A 4FZMA 2NRHA 5AZJA 1IJJA 3L3UA 2ZIWB 5JICA 7ICJA 1F21A 3QMLA 4Y2JA 3BQ2A 3PR4A 3SAGA 4B9VA 4KLLA 5GAEP 4E7KA 7ICGA 2WAQF 3D2EB 3CJ7A 4XH5A 2AA4A 5ALTA 2EZYA 3QU9A 2BKEA 4BR5A 4DR3K 1VQ7N 2O8CA 3MK6A 3RJHA 5FPNA 2LM4A 2XGPA 1NGAA 3OS1A 3Q8QB 1S76D 1RTHA 5J29A 1OKJA 3FZHA 4OJ5A 3LM9A 5HMLA 4OKJA 4PL8A 3H8SA 2G08A 2D0BA 4BUGA 3AVMA 3NH2A 2ZUDA 4Y2QA 7ICLA 5LJWA 3VEWA 3VCBA 1B92A 3VQCA 4BWJA 2ZJ8A 3HP9A 2E4LA 3I28A 2KK0A 3HOSA 2WAQC 3KZXA 3WXJA 3Q8LA 4CCHA 4M3XA 4CZKA 1T6DA 4E19A 4E7LA 4UB4A 1ZBLA 1WB9A 2M0NA 2GH1A 1EWQA 3NHGA 3SUNA 3V81A 1T03A 1L6NA 3UKUA 1BOTO 3F53A 1NK8A 4U6PA 5M1FA 3I55N 1QCKA 2HOEA 1PVQA 1UT5A 5ALRA 2ZG6A 2R8GA 2QWQA 3ATVA 1VQLN 5HR6A 2IS3A 4JI4K 1CZ9A 5I9EB 4YQWA 4YN4A 1E3MA 3ULDA 4BR2A 3DRSA 1WLJA 3KHGA 3K5LA 4JK7A 4GC6A 1LB2B 1NGGA 4RTFD 2HBKA 1VSKA 4M41A 4CVNE 4O5EA 4GIBA 3E58A 4EBDA 2HHWA 4ID1A 3T5JA 4EEYA 4KH6A 4AQYK 4BC4A 2FPMA 3BQTA 2ZUBA 3V7KA 3BY5A 3CPEA 1J97A 2E1EA 3N7RC 4UASA 2QWLA 1XI1A 3P5JA 2MAXA 3RB6A 4H5RA 4LF9K 2W6KA 2WF9A 1KQQA 2IOHA 1ZQMA 2W9BA 5JUMA 1JLAA 2QWPA 5F3XB 4OD0A 4KLHA 1NWKA 3QO9A 4QS9A 1HKBA 1S9FA 5J0OA 3AU6A 4NB4A 4H0OA 1RZTA 2ASOA 5J0WA 4BE2A 2D0OA 2XGQA 1DK3A 9ICGA 4KLSA 1B9DA 3AQFA 1J53A 3N28A 2IA6A 2UVUA 4RG8A 4GNIA 3GU3A 4EP5A 5L1JA 3PW7A 4JRPA 4JWMA 5EE3A 1XS9D 4P0PA 1ZQEA 3H1QA 4ZHRA 4CEEA 4QWEA 5AZIA 3DMJA 3HBTA 2BPCA 3T5LA 3EWAA 1NK0A 1ZQSA 2P9UA 3TSUA 2PYLA 3ZX3A 1B0XA 4MLEA 2KIVA 3F2DA 4XH1A 5KFQA 3KHRA 2KVCA 5AQNA 3WNEA 4JS4A 4DV4K 5KG3A 4NCAA 1RBVA 3J8AA 5HMMA 1TKDA 2YX6A 5JLFA 3M8QA 4JYAK 8ICQA 4Q0BA 1X2IA 1XC3A 3OYMA 2HSTA 3O9TA 5KFLA 3GV7B 4LFAK 5JMVA 5ALJA 4BJQA 1N60A 3WNGA 1AQ6A 3MGVA 1VSLA 2OZMA 2WF7A 1QSYA 4M3TA 2HHXA 5EE0A 4K4GA 5AQOA 4DTPA 2RLTA 1FO4A 1CLQA 2IOFK 3ZDCA 1S1TA 1U47A 3VGLA 4GFJA 4F5QA 5J2GA 1Z6RA 3BJYA 4CJTA 3G25A 3OYNA 4CBWA 5ALPA 4ECYA 3MDQA 1LW0A 2KQ2A 1V38A 3DLHA 3HYFA 3MXJA 1W0HA 4LJXA 2EHGA 1OH8A 1SZHA 4NM1A 1BWFO 2OCEA 3HRDD 1XSNA 2HW3A 3F9KA 3AA3A 3H3OB 3OA9A 5DDMA 4KTQA 2KNJA 4RQNA 4DFMA 2PZSA 4W5QA 3CCLN 3MN6A 3JXUA 3SBGA 2QM1A 1Z05A 1DXSA 4GKKK 4CGIA 4DR6K 3AARA 3DLRA 4DQ8A 2RDIA 8ICNA 1OH6A 4JAXA 2ZGZA 4B1XB 3GFKB 5FROA 2JGAA 4CFBA 2E6MA 2K8CB 1K8KA 5J2BA 2AP1A 3MR6A 3THVA 1S9GA 4JUZA 2F4VK 3RMDA 1RXWA 1XHZA 3ZDBA 2JXJA 1NGEA 4AHVA 4DL2A 1NGFA 5G5GA 9ICRA 1L3SA 4O0JA 5AM3A 4YOVA 3S6JA 1Q3UA 4CHNA 2FBVA 3L0QA 1YJWN 4NLKA 5J2IA 4FZYA 1ZBSA 1TV9A 4CI6A 2Y0SF 3P38A 4HYKA 4J2EA 4JHDA 5E79U 1NU0A 4FJ5A 3MR2A 4DS4A 4P0QB 4I9QA 4Z94A 4TQRA 3DRPA 4OJRA 5J2DA 4CNQA 2I1QA 4QWAA 1TK8A 1SL2A 2ZE2A 2KVSA 2WOMA 2ZTDA 5DB8A 4XIUA 3VC8A 2AGOA 4CEOA 4Y2SA 1HJRA 3O8MA 3ZI4A 3FR0A 2HB5A 4BRFA 3J81O 2BCVA 3G6VA 4WJ3B 2PMZF 4JV2A 2FI1A 4BQLA 3PUFA 4ECWA 2HNDA 1TE2A 1KLMA 4BG8A 3JYTA 4GXIA 3MX2A 4QS8A 3AM9A 2Y0SC 1VQMN 5KFWA 3OPXA 8ICLA 3HRGA 3AAQA 3O5BA 3SPZA 4YOTA 3SJJA 1XMOK 1JN3A 1Y64A 3KVGA 1ZQYA 1XNQK 1NZPA 1ASWA 4H03B 2VIXA 4A61A 3CPWM 4OLAA 3F5AA 4ED8A 1WSHA 4NJ8A 3OTOK 3V9UA 2DWQA 3M6GA 4FPBA 2AXTU 5T14A 2RQ5A 2YV0X 4C4TA 5AQYA 3OYGA 2PYJA 5JS1A 3CCEN 2YKMA 3THYA 4J9PA 4BR0A 4JEPA 2DKZA 4PGQA 2JMGA 1U4BA 1K5OA 2QW9A 4A57A 4YR3A 5L1IA 3AVLA 3QUBA 1RYSA 1ZQHA 4CIFA 4GMJB 4EIAA 3DXKB 3QBXA 4F5RA 3QB0A 1IXRA 2HDOA 4QNLA 1MQ2A 3WXIA 5HLFA 1RCHA 5CRXA 1QVGM 3IRXA 4UB1A 3S41A 2ATQA 5KTQA 4B3RK 3OW2M 1L3UA 2UVRA 4BGDA 3UKRA 2ZJRL 3SJHA 1N36K 4J9KA 3AA5X 3LAMA 4OGCA 1SGGA 2V7YA 3NF7A 4BC2A 4WF9L 1C6VA 4P2HA 3L2UA 4FOEA 4FJ9A 2QXFA 1HYSA 3BQ7A 2FBYA 3UXPA 4NO7A 1O03A 2KFNA 3IAYA 4CEDA 1YTUA 3T69A 5A0LA 1NBWA 4B3MK 4QZIA 4CZGA 3S3NA 1JMSA 1FFVA 5TISU 1BU6O 3KLHA 4C4RA 4UBBA 2E8NA 3OYDA 4QW9A 1QHTA 2HVHA 1I39A 5AM5A 3IG1A 4DR4K 4RQ2A 1KD1O 8ICUA 1CZAN 4FCYA 2QB0B 1NGHA 3SQ4A 4BR9A 1IH7A 2WF6A 1HJOA 4QZ8A 2OHFA 3V6DA 1GOBA 1VQ8N 5DQGA 1N48A 3VENA 4UY8O 1QQ5A 4M7YA 2VJ5A 3H40A 1KSPA 1HQEA 3DXMA 4LC9B 3U9DA 4NLNA 4I2AA 1BDGA 5BPLA 1U6ZA 5ADXA 5DBBA 1J9AA 3ZEUB 2QLTA 1ZETA 2EAPA 5AK5A 4PHTX 3QESA 1XMQK 1C0TA 1Z19A 1P8ZA 4MEYA 2FF3B 3RF9A 3LWLA 1N62A 4YFUA 5BRFA 9ICWA 5DBCA 4U67L 2H5XA 1ZQ1C 4CK3A 3L6QA 1JLFA 4BXOB 3K58A 1R59O 4JI8K 4CK2A 5ALVA 2R18A 1HYZA 1UHUA 1SS6A 4KH4A 5AQJA 5SZTA 5EE1A 5DG9A 4Y0WA 8ICYA 2ZIVA 1HJPA 2NZTA 1HUXA 2EZZA 4M3UA 1IBKK 2EDUA 3ENBA 3EKSA 3MWPA 3RJEA 4Z4HA 3G6EN 4DR1K 1N34K 8ICCA 4PWDA 1RTIA 5KPZA 5TKYA 1ZQXA 1X1PA 4M6WB 4C7YA 2DPIA 1YZ7A 3C6TA 3H4DA 1NI3A 3LK9A 3FC4A 4YMMA 2MUTA 3BF1A 3LPUA 3VMFB 4W5RA 1SZPA 4ELVA 2GWJA 3IS9A 3ZSOA 3LDNA 2P9IB 4Q45A 2R8HA 8ICVA 8ICEA 5HBMA 1N63A 5KL8B 4I2BA 2QTDA 3L4IA 3KTQA 1S0MA 3VA0A 4KTZA 4LH5A 4FJIA 3B0XA 2PFNA 3SPYA 5CB1A 4JKDA 2CH5A 1WYGA 2P9SA 4K43A 1HKGA 3SBTA 5ALWA 1PK1A 4QWBA 4A2AA 1QSLA 4LF6K 1QZ6A 4UB3A 3KKSA 2R7YA 4EEKA 5IIMA 3T79A 3E2EA 3AVBA 4BVPA 2P5OA 4Z4FA 1C1BA 2AGQA 1L3TA 5KG1A 3N4PA 3DJCA 1IKYA 4CHPA 4X62K 5JU5A 8ICKA 4CF8A 4DFKA 4MEXA 3OJSA 2FMSA 1QQOA 4CBXA 3TACB 3AGRA 3CXCM 4F4WA 7ICUA 4H0XB 3MFHA 3OYHA 3ENOA 4HUGA 4O5KA 3I0RA 1T3VA 5AQHA 4UATA 4CK1A 1BG3A 4H5VA 5AKIA 4JB3A 3O3FA 1JJ2M 5E26A 1WWVA 1QLNA 1BNOA 5KFFA 4ILGB 1BA1A 4I9LA 1T05A 3PW0A 1ZBUA 3VPZA 3VQ9A 2O8FA 4A62A 3P83D 4HCCA 2MU2A 2KHVA 3WU2U 4DQSA 5ALSA 1QSSA 4IRKA 3U6FA 1K8AO 1V97A 3HVTA 8ICPA 3DI6A 4DSFA 1ASVA 3C29A 2E1ZA 3ZT0A 4CZJA 2E2NA 2P9PB 4FWLA 3J7ZO 2L5YA 2IMWP 3M9OB 1KC8O 3C65A 3AQEA 1BPDA 3FYHA 3Q8MA 3CG7A 4HWIA 5HRRA 2O8BB 2D0CA 1X3NA 3CI5A 5AQWA 4BRDA 3B9JA 3RWUA 2RHFA 1JALA 1BISA 2F7TA 3OJUA 2AGPA 3HT3A 1A5XA 1U9LA 2ASMA 3JSMA 5KL1B 2DTUA 3ZT4A 2ZJPL 4DUYK 2QKKA 4DV5K 2YHAA 1J6ZA 3V7JA 4CJVA 1DGJA 4ED2A 7ICRA 4OVLA 4DKWA 2KLAA 3PIOL 3OHRA 1DTQA 2KP7A 4NXZA 4B8AB 3VN5A 4RQ0A 3JPNA 3JPQA 1ILYA 2HOQA 4JKHA 1WAFA 1G99A 2VG6A 3E01A 2ZJ5A 4JD2A 3E0FA 1ZBHA 2LKYA 4IG3A 1IBMK 4M3ZA 1Z26A 3KKAC 4ED0A 3TQ1A 1WOQA 4FJNA 4R63A 1L7MA 1U48A 4DL7A 5AIBA 1Q9YA 4G3IA 3TSPA 3QFUA 4IC9A 2J6TA 1T3QA 2FXUA 4KLQA 2UYTA 3FZFA 4Z4GA 5ALEA 2ITGA 5AQSA 1N5YA 1FFUA 1KDHA 3E9OA 3OS0A 2W43A 1HNWK 2ODGA 2I7NA 1BQMA 2ZQBA 5M1PA 1S6PA 3O0FA 1U2VB 2AQ0A 5C2FA 1NLVA 3ULEB 5DQHA 4YOUA 4US8A 3V6KA 3NE6A 3IG5A 2O6KA 4RU9A 3RB0A 4MQ3A 4KPYA 3OYCA 3THWB 5IILA 3IN5A 5ALUA 2G07A 1RT2A 2M9NA 5CR4A 1K6YA 3PNCA 5AHXA 1UA0A 1TUUA 1ZD5A 3AUOA 1NK7A 2JWKA 4JKAA 1RBUA 4CEAA 1CUKA 1N61A 2OTJN 3WKBA 3HPGA 3TFSA 2F1IA 4E7IA 4G1QA 4PHAA 4YDUC 4FYDA 4B9UA 1N5XA 3C23A 1WSFA 2ES6A 2PBDA 1LWEA 4BC3A 3D7EO 2BH1A 4TUSA 1X9WA 1LV5A 4IWVA 5KG2A 4I2DA 5ALYA 1RNHA 1MWKA 3C6UA 3C95A 5I42A 1FKPA 4O44A 2K4PA 4DEZA 1Q7YO 3H7IA 4C8NA 5J2AA 3R8EA 4JI7K 2FLLA 1WAJA 1CEZA 2NV3A 5HHIA 4KI6A 3KJVA 3L3FX 2JWLA 3CNHA 2E8OA 3PW5A 4USAA 2P9NB 3L2RA 2AJQA 5EU7A 4QOZB 2A1JA 4DCHA 3AVCA 1JIHA 3FM9A 4IFVA 1TVAA 1D5AA 2ATLA 2D4WA 2IAJA 4A59A 2NRZA 3C7NB 3WK5A 4K25A 3IRUA 1J5OA 1X3MA 1ZC6A 4JV5K 2A3VA 2E2OA 1ZQBA 4PL7A 4OPJA 2FMPA 3A5MC 3SK3A 4DQPA 4CEZA 2NRWA 4LZGA 3HWTA 1WUAA 1TK5A 2P9LA 4I2IA 1ZQAA 5GINA 1S72N 4LF4K 3H4BA 4CGDA 3O3HA 5KG4A 4B1VA 2ZIXA 5EWGA 2FSKA 9ICVA 1SWWA 1S5LU 4P4MA 9ICLA 4O8UA 1HQUA 4PZOA 1T7PA 1YZ6A 4GW6A 5GTIU 1RDWX 2O8DA 2JHDA 4ZH4A 2F8KA 5KFIA 2ZIUA 3U9ZA 2WB1F 4LY7A 2O8CB 2Q36A 3WK6A 4Y2YA 2YMPA 3NGDA 4LF7K 2BQ3A 5AQFA 1QQCA 9ICJA 3GV8B 4RUAA 2HHSA 3O4NA 1S10A 5IIJA 5KQ8A 4DOBA 1NMNA 3M6ZA 3EE8A 5KG6A 3K1ZA 4CF0A 1ECWA 2Q0RA 4MF2A 2DKXA 1KVAA 4JLHA 4LZDA 1TL1A 4IDKA 4WFNL 2UUCK 5AQXA 2BUPA 5IIKA 4DSKA 2WB1C 2K4IA 3QDKA 4N47A 1O1WA 5JVHL 1QVFM 5KG7A 2NUBA 1HIWA 1ZXOA 4CW7B 1NOZA 4O3QA 2WTUA 4RNMA 5GAGP 1NJZA 3UB5A 1JCGA 5A2QO 7ICVA 3PY8A 4PKGA 3AN1A 4P4OA 5KFKA 4WCEL 2GV9A 3CCVN 2CRXA 4FLVA 3C2LA 1ZXIA 2G06A 5CEHA 4ED3A 3Q8KA 4CFDA 2AHOB 3A0BU 3WK7A 1IKVA 2OPPA 2A1SA 2I5JA 3UMCA 1IKWA 4KV8A 3SCXA 4DO9A 1YF5L 4R5PA 4DL5A 5DBAA 2Q4TA 4Y2VA 1ZQCA 3OYEA 1WSIA 5FDLA 2F1JA 3M5RA 5FPEA 4B9MA 3LDSA 1GO3F 2OTLN 3MAQA 3IKMA 4HUEA 2I5HA 4I29A 3RAXA 1ATNA 4RQ6A 4O0IA 3SV4A 4FBTA 1UOCA 3ASMA 4FLUA 2GLEA 3CJCA 1YITN 1BPYA 3KWIA 1NK6A 3CERA 4F3TA 4M3WA 3NS1A 3HZ6A 1ZQWA 3RJFA 4YOYA 2LM1A 4DCCA 4F93B 3FFKB 2W9BB 3CCMN 3VF4A 4E7JA 4QCLA 5KRSA 2ALZA 2PFUA 4OCZA 4BRCA 3VERA 2W55A 3D6RA 4CF5A 4M42A 1XNSA 2PAVA 4IOCL 1JROA 3K0SA 3UMBA 1RT5A 4ILJA 4KH5A 4PA1A 4E89A 3CQXA 3NVVA 3WKEA 3SI8A 4O5CA 4GVMA 1S0NA 5AK4A 2PXIA 3WXKA 3FZLA 3UXOA 3AGKA 4NLZA 1BUPA 2RRDA 1TYQA 3VEVA 2A41A 4P0PB 3Q7BA 5AM4A 1TAUA 5C42A 2XRIA 4Z4EA 4IG0A 2JH1A 2IGIA 2KICA 4CBUA 4R65A 4DTJA 2W7PA 3L4PA 5IINA 4W5TA 2I7PA 3LDQA 3ZD8A 5CHIA 5AM2A 5J2QA 4G9BA 3GIIA 1YXQA 5DMRA 2BCQA 2UXBK 2OYYA 4UAYA 4JI2K 4C1NK 1YVUA 2ISPA 2A42A 5KFXA 4Q5VA 5ALGA 5FRNA 4F72A 4JRQA 1W2BM 1NOMA 2QB1A 4RW8A 3TAMA 4B08A 4IO9L 4I28A 1TKXA 5H2FU 1NKEA 1KEJA 3WKCA 5KFBA 2B5JA 5G5HA 1X9XA 4J9MA 2IVNA 3TAEA 2YY6A 1MQ3A 3BEXA 2V51B 4CECA 2DFLA 3LP0A 2A3ZA 1EETA 4KKOA 1S6QA 1XHXA 3F5TA 2YKNA 2C2RA 3QEPA 1C1CA 4E7HA 3CW2C 3VTHA 4DR7K 3ZSXA 4J9OA 1Q46A 3A8YA 3GV5B 4YORA 5IWAK 3AVKA 4BRKA 1ZQFA 1S1VA 1NG9A 3NRWA 2KJ5A 4C8MA 4BR7A 4E0DA 4FW2A 1RTJA 4ZOHC 2UXDK 4NXNK 2XIDA 4BRNA 4IBNA 4A5BA 4DTXA 1ZD2P 2NO4A 3WQUA 4UW9A 4M04A 4JK8A 4FM2A 4PH5A 4UAUA 1JCEA 4M45A 2JZBA 5HRPA 1RPLA 2YQEA 4IQVA 1JI7A 1HUZA 1JLQA 4RT2A 3KLGA 4W5NA 4RQ7A 3DM2A 5AKXA 4TQSA 1UAXA 2A40A 4KHQA 1KFDA 4NL9C 3D2SA 3VEZA 4B8CA 3K57A 3T1HK 2B6GA 3F2BA 2RP5A 3C1ZA 3C2MA 4HCBA 1QQ7A 3QEAZ 3MWTA 3O4QA 3ZD9A 4F3OA 4HTLA 5AI9A 2X78A 3LP1A 4Z4CA 1J2MA 3M1FA 3BDPA 4I27A 4IR9A 1SUQA 1B43A 1ZJMA 3RJGA 4FSVA 4H5TA 1T4GA 2C2EA 4ELTA 2JGUA 1KXPA 4KN4A 5KAFU 5HHHA 3S9HA 3RR8A 1HNZK 3AVGA 5D3GA 2WONA 4DTNA 3PW2A 1Z4OA 1SAZA 4F4YA 1VJ5A 5AQPA 3CIPA 3NGZA 7ICNA 4KLUA 4B6JA 1T44A 2IDOA 5LJVA 5BN9A 4FFDA 1TK0A 2NLXA 2NRVA 5KFNA 3OHAA 3ISCA 1HX1A 4IZ9A 2ZJAA 2KFZA 3QEVA 2NRRA 2UU9K 2OWOA 3ORYA 2EWSA 3BQ1A 3DOLA 3CC4N 2CGKA 1OVYA 4DLGA 3FFIA 3CMAN 3DLKA 4F91B 3P39A 5ALZA 4I2EA 3QU7A 8ICJA 3LP3A 3THYB 1HPZA 2H3VA 2HF4A 4UAWA 7ICEA 2V9WA 3ZDDA 1GOCA 4EAHD 1ZQPA 1L3VA 3N7PD 3DRRA 3V1QA 3PX4A 4OPHA 2E2PA 1S77D 4FM0A 3KKAA 4I6MA 5KT4A 4FZXC 2R8IA 1RFQA 4NXMK 4CD1A 4C8LA 2BANA 5C5JA 4W5OA 9ICAA 3MDAA 4EHTA 1A77A 3VESA 3VOVA 2YNHA 5IT9O 5L1KA 4K41A 3VQDA 4I2PA 1VQPN 1IG6A 1GLDG 4RQ8A 3U8XA 4B1WB 2OXOA 5L9XA 2F76X 4DHYA 2G8VA 1QHAA 3VQ6A 3F2CA 1I94K 4B9TA 3ATUA 3WEEB 5J2KA 1L5UA 1BHLA 4CJLA 4IS7A 4CEQA 1GLFO 3BS5A 3BQ0A 2QKQA 4CF4A 1ZQNA 2IHNA 4ZTFA 4DV1K 3BGRA 2UUBK 3A5OC 1SB3C 2G5IB 4PL1A 5AI5A 5KFRA 4N5SA 5HNKA 1HNIA 2YHWA 4FK4A 1V85A 4QZ9A 3QUCA 3QUTA 2G09A 1LAVA 3GDXA 9ICSA 4KLMA 7ICIA 1W9HA 3NVYA 9ICXA 3H08A 2XI9A 3KFUF 3KHYA 3NF9A 4YDUA 4H4OA 1CXQA 2D1KA 1YI2N 3AO3A 2VANA 3L8BA 2W3RA 7ICOA 4DL6A 3DXMB 1UPHA 2W04A 4UARA 4YMNA 2Q2RA 4C0ZA 3MN9A 2RN2A 5KGXA 4Y1CA 3I1YA 1S3XA 4BACA 4M0AA 1IO2A 5ADXH 1S8OA 8ICSA 4CDGA 5ELZA 1DRGA 1W97L 4JI6K 3AVJA 4QZEA 3QLHA 4NCGA 1HUOA 1IKXA 1BPBA 4CGZA 1UT8A 3CC2N 5KGWA 4CF3A 4M9LA 2DFEA 3VQPA 2ZTCA 3K2PA 3ISDA 1JXLA 2UXCK 3M8SA 1SV4A 3SQ1A 1M6YA 4Q44A 3GBTA 3JS6A 1RDDA 1N56A 4DQQA 2XY8A 2ZIVB 2PMZC 2XY5A 3H0MB 2ESEA 3PR5B 4NY8A 1A6SA 2G8WA 3Q8RB 2E8PA 2Z7JA 1NK5A 4DTUA 2D3DA 4CJKA 3NF6A 4KRFA 4I2QA 4M9HA 4GV6A 9ICQA 4KAZA 5FRMA 4OO1J 4AHSA 4FWOA 4US9A 5KFAA 2MUTB 3K9JA 5KFMA 2JH7A 3TKAA 4GC7A 1T6CA 3WKDA 2EAOA 2DFHA 4O4GA 1LVHA 4FWPA 1CRXA 5ALXA 8ICHA 2W41A 4A2BA 4OKKA 2KN7A 3NVWA 1ZQZA 3ZX2A 3I76A 3GIMA 2QXLA 1E4FT 1WSJA 2K89A 1RGIA 5BN8A 3EN9A 4IQUA 3O08A 3QZ7A 4DU4A 3IFRA 1PK1B 4FWNA 2W8LA 3RSEA 5J2EA 2ZTEA 2J6SA 1EXQA 3UPQA 4PGXA 5CE3A 4DFJA 1MC8A 5F1XA 5GTHU 2CXYA 1JL2A 1PVPA 4CF1A 2H3FA 1GLAG 4IEIA 4C1NI 1BCMA 5ALLA 3CJAA 2FJ6A 3I56N 1Q82O 3M6KA 2LPEA 1RDBA 3L4QA 4HAIA 3IHQB 4CGGA 4RQ4A 4FL9A 4JI5K 1UQVA 4DSIA 2V52B 3GIJA 5AQIA 4AHRA 3H8WA 5J0PA 2KMDA 5KG5A 4QZCA 5F9LA 2I6XA 2W40A 2ZM6K 3H0LB 3ZYYX 2EX3A 1NJYA 3V9WA 3VGKA 2V4QA 4CJWA 4YCXA 3B6PA 3P4IA 4FJ8A 3THXA 1L8LA 4KHSA 2HF3A 5J0TA 3M8PA 4R8UA 3EYZA 5CYMA 4XRHA 3CM5A 2O8FB 4PZNA 5AQTA 4CRXA 2E5LK 3K1RB 1NGBA 4KITB 3RAQA 1RILA 3AO2A 2GTDA 5TKWA 3LWMA 5DB7A 2E20A 1ZQRA 5KFZA 4IEEA 9ICUA 1VRTA 2JLEA 3CHWA 1COOA 2ITMA 4JS5A 1ZQOA 3QNNA 1WCNA 8ICGA 1HNVA 3QFPA 4ECSA 4Y2XA 4Z6CA 4UB2A 1HEKA 3F9MA 1SL0A 3TSQA 4UB8U 1M90O 3AY9A 1KAYA 8ICTA 5H1SQ 4PJ0U 9ICHA 3PSFA 5JS2A 4KLIA 4OPAA 3RJKA 4CHQA 2D5RA 3GL1A 3OYIA 5D46A 4LFBK 4Q8FA 1A0PA 2K8BB 5AM1A 3HJEA 3FDSA 3AVHA 2IOFA 1L7PA 3VEYA 4BG9A 4CE9A 2VWJA 4J2BA 4PL2A 1JLBA 3MR5A 4RCHA 3H0RB 2OH2A 3M3ZA 1ZYQA 3LALA 1HKCA 2F1HA 4JD2B 4ECZA 4GVEA 1XSLA 3ED5A 3V4IA 4NV0A 3OGUA 5KT7A 2YHBA 4QS7A 4B1UB 3OYJA 3G6YA 4F4ZA 3AMZA 2DGZA 3Q8SB 4JK9A 4KLGA 5BRHA 2FSJA 4WQ5C 5C15A 3IMXA 1L8OA 3RH5A 4DR2K 4RW9A 3VF6A 4B3SK 3LM2A 1PUZA 3MMVA 1SKSA 4IRCA 4ILHA 1NOYA 4GY2B 2P6RA 4LD0A 3RFAA 3C28A 3CFOA 4BDZA 1FKOA 4DSLA 4CJQA 4C8OA 3ZSZA 3JPSA 4FK0A 4JI0K 4I2FA 2GBZA 3KKRA 4CIGA 5EE9A 5IIOA 2XY6A 3GQCA 4FWRA 1A5VA 1UA1A 4RPZA 5AQUA 1P7DA 4DF8A 4LVSA 4YP3A 3UM9A 4RQ3A 5SWMA 3JAMO 1SL1A 3MR3A 3MN7A 1F5SA 3CRXA 1KVCA 2VGNA 4BRAA 2C2DA 4ELUA 1IM4A 2KZMA 2CGJA 4GLXA 4FOIA 3OY9A 5J2JA 1RYUA 1UWBA 4YD1A 5C0YA 3TFRA 4Z6EA 4H0TB 3TU5A 3PO4A 2HHQA 3H3NO 4FJJA 4O3RA 3UQ2A 1EP4A 5ALKA 2FSNA 5FLXO 4KBOA 2QB0A 9ICIA 3HI0A 4PGYA 2ASPA 3ZSWA 4FJHA 5B66U 4UB5A 2B21A 1G15A 4F8RA 1DGKN 5LMUK 4FJXA 4FLTA 4PHPA 3I33A 3VQ5A 4RNOA 3KHLA 5KFGA 4B9SA 4YOXA 1FJGK 5KT3A 1ZQDA 4F2RA 3ALYA 3MCAB 1FW6A 3AV9A 3W3DA 2YMLA 4NL9A 2HBMA 1C7YA 1RBTA 4I7FA 3S3MA 4J9QA 2OM6A 4KHYA 3OYLA 3ZEUA 4LF8K 2O8EA 3HL8A 4ECVA 2QWRA 3D2FB 3ONNA 5KFCA 2GEMA 3CJ9A 3ZSRA 2K8AA 3AU2A 1K1QA 3A5LC 4CZFA 5L1MA 4BROA 1XO0A 3NCIA 2BHNA 1Y88A 5ALNA 4ICLA 2I9GA 2Z1GA 2P9LB 3UXNA 3DV9A 5GAHP 5KFOA 1IV0A 2AU0A 1EO1A 1URJA 3QIOA 2H3QA 1GLJO 2ZIXB 5AK6A 3SQ2A 2P51A 4H0VB 1FEZA 2GX9A 2MSNA 2P66A 4PKIA 3R1XA 4DB3A 1ZQKA 5KQDA 3VETA 1D8LA 3HW8A 3QE9Y 1WN7A 3ZETA 2O8DB 3DEEA 3TI0A 3PSIA 1TUYA 4NCBA 1Q3VA 2RKIA 3A0IX 2Y1IA 3J81j 2ETJA 2GOLA 1LWFA 1MA7A 5DB6A 3C94A 2G8IA 2Q0ZX 1RQLA 2YCHA 4KB1A 4YVZA 3AA2A 5AQQA 4DQRA 4IQWA 2W9MA 4NLGA 2QARA 3QEWA 3MEGA 4FE3A 1BI4B 4ID5A 1S0VA 3O1WA 3V72A 4ECQA 1GLEG 4RW7A 4CJFA 4C4SA 4CJUA 3A2FA 4CHYA 2ZUCA 5LMNK 2HHHK 4KMUA 4F92B 1LKYB 2DF4B 5BR9A 3NGIA 4L8RB 4B9QA 4CFCA 3WK9A 1WBBA 4ED6A 3AL0B 4B1ZA 4OKEA 4QZDA 1ZQTA 5GIPA 3RH6A 1OH5A 1RQNA 1J2NA 5ALHA 4M47A 1PZNA 4NLBA 4DLEA 3UE5A 3PVXA 5J0UA 2DY4A 5KFDA 1YVNA 5EOZA 3G10A 5AM0A 4BRQA 3P31A 4JKGA 1N33K 4AYBF 3M8RA 1MDUB 2EAMA 3BF3A 3H46O 7ICSA 3E66A 1RXVA 3QU2A 3KHHA 1J5EK 2WTFA 4J03A 8ICIA 1ITGA 3AEVA 3GOIA 1VSHA 2KKPA 3JPTA 2XC9A 1NM1A 3MC1A 1VQON 1S22A 4IO8A 2KKZA 5F2RA 5BOMA 3QU4A 4AM6A 4BVOA 1BPXA 4IQTA 1CXUA 3WXLA 1TL3A 2VQFK 3MX5A 8ICFA 1W7AA 3QEBZ 2DFFA 4K0KK 4FWQA 4QIWF 2W7OA 5AZJB 1BCOA 3TAPA 4BC5A 4BWMA 1H38A 1XO1A 3ZCMA 1YHQN 1ZQLA 7ICHA 2GWKA 3AO1A 4DL4A 4P4PA 3RB4A 4KLOA 2NO5A 4BRIA 2KSOA 4CJ3A 3HOTA 1DKGD 4M2YA 4IL6U 1TYQB 3SEIA 4DR5K 2YI1A 3L2VA 1NJIO 1RYRA 4GV9A 4JV1A 1LWCA 3V1OA 3UMGA 3I8DA 5EX5A 2VGMA 4QIWC 1DOQA 3EL2A 1NKCA 3VEXA 1YIJN 4R79A 3QNOA 3QETA 4PKHA 1KAZA 3N4QA 2H3GX 3Q7CA 1QH9A 4MO5A 1GOAA 5L1LA 3KD1E 3C6HA 4KLEA 3AVFA 4YXJA 3E9PA 1SWVA 3NH0A 3HPOA 2R8JA 2P9KA 1VSDA 2W3SA 3U4LA 1Q18A 3SD7A 7ICKA 1HRHA 4JI3K 3C5GA 3D45A 4F2SA 2F8LA 3WQTA 5KPRA 1Z4NA 3NUQA 2F3NA 4OX9K 1VQ4N 3WK4A 2RE2A 3LYSA 3UKUB 3EKUA 5AICA 1VSJA 2XCPA 4WE1A 2FPLA 3AAPA 3HJFA 4LSLA 3TANA 1S0OA 4CFAA 2CH6A 2RDJA 1DEJA 3R9PA 4ACOA 4KI4A 4KHWA 4RT3A 2Y9UA 2ZXHA 1VK0A 1EWRA 4CZIA 4UBCA 1V4TA 1H1VA 1ZQVA 5AI4A 3UQ0A 5J2NA 4F50A 1RT4A 3THWA 2GUIA 4Z4IA 3OYFA 3QXGA 4QWDA 2XO7A 2LYBA 4KFBA 3RBEA 2GUPA 5FPMA 5F0XA 4IFYA 4RW4A 4CZEA 3I0SA 2G8FA 2HMIA 4FJKA 1U04A 2ASDA 8ICMA 2IC3A 3QZ8A 5KFUA 2VWBA 4M9NA 1NGJA 3LVVA 2MA1A 5KFJA 2E8MA 5J2CA 1NGIA 1ZRNA 1RDFA 2VG7A 4O3PA 2A5XA 4DU3A 4KX5A 2O4GA 3IUCA 1RTDA 2OPSA 4FZNA 4QWCA 2QEXN 2YNFA 4FO0A 3M9NB 4UAZA 5J0SA 2NRXA 3HSTB 3CF5L 5F9NA 5AQZA 1NGCA 2F8TA 4ISEA 4XQ8A 2VKQA 3MABA 2YHXA 1KTQA 4PUOA 5EWFA 4EZ6A 5C24A 3TAGA 1N32K 4OLBA 3KD5E 4RWTA 4FJGA 2E3TA 3MEEA 3VGMA 2B6AA 8ICAA 4FLYA 2O4IA 3L5KA 1OH7A 4RW6A 1C0FA 2E6LA 5KNIA 5J0XA 3B8AX 4GV3A 2H3ZA 4XA5A 4EP4A 3F5EA 5AZIB 3O3GA 2KIWA 3K5NA 2P9UB 1C0GA 2HBLA 1QS4A 4HHTA 2F9TA 2X74A 3O4WA 4EFHA 3A5NC 2W9CA 2PKEA 7ICPA 2HNYA 1HR0K 3O9UA 4CJRA 4Y2UA 3V9SA 3G0ZA 1C20A 4Z6DA 3ETLA 4MLHA 5EY4A 7ICFA 4H8KA 3QICA 2Z1IA 8ICRA 4YOWA 2F44A 3AO5A 4CJPA 4WQ4C 3CQ8A 7ICTA 3ETRA 3KIOA 3SUPA 3SLCA 3IP4B 3RBDA 5DB9A 3QERA 4U7BA 3QU5A 3AO4A 1DGSA 2ZWHA 5DGBA 3RTVA 4LFCK 1SXEA 3U3GA 1VSIA 1PVRA 4HUFA 3ZT1A 1X9JA 5J2HA 2JEGA 2ZD1A 3GG4A 4CJSA 3ENHA 4A5AA 4I6MB 4BR4A 2WFBA 1X66A 1JLGA 4ECRA 5AQMA 4IOAL 4DF4A 4J2DA 3A0HU 1K1SA 3PSPA 1NMDA 1Z00A 2HSZA 1ZJNA 1NK4A 4FWMA 1T94A 3SQIA 3CCRN 4WQ5A 1EX4A 5J2FA 5KPTA 3NVMA 9ICPA 1ZQQA 2E5SA 3CFPA 3LVWA 1VLBA 4H5WA 2CPRA 4EBCA 4NLCA 3DLLL 1UCVA 3CMEN 3HO1A 3K5MA 5KFSA 4EYIB 1SV0C 2VQEK 3SMSA 4KLTA 1XU4A 4Y2RA 1CZBA 1BPEA 3ZDAA 1JL1A 3SAHA 2Z1HA 3L2QA 1IG8A 1V9PA 1K8KB 5ALIA 1SIJA 3ZT2A 2Q31A 2WFAA 3BS5B 4OJOA 4J9LA 3M1YA 4C80A 3NRZA 1TV6A 5CWRA 2P6UA 3TAQA 4CIEA 4E1JA 2K60A 1S9EA 8ICWA 4K4HA 3KK3A 4MFCA 1BO5O 5AKLA 4XEIA 1Q9XA 4JHDB 3LDPA 4F5NA 3N4MB 2ZGYA 5CR0A 1LCUA 3ZT3A 2KTQA 5B8HA 2VA8A 2R8KA 3JPPA 4I2HA 5M1KA 3B6OA 1QQMA 2YN4A 1Z1BA 5DG8A 4K4IA 3FZMA 5BR8K 2LMRA 3SMPA 3LL3A 3TADC 4DV3K 5J2PA 4X5VA 4BE1A 3QEIA 1WCLA 4J9RA 3ALRA 2YX8A 2ISOA 4FK2A 4K8XA 4DFDA 2WF8A 1RDCA 3CJBA 3EE9A 4CF2A 4EX7A 5DM6L 4CE6A 1B22A 4AHTA 4F71A 2GWSA 4IRDA 1SZ2A 4JKFA 3QNMA 2KEYA 1B4FA 2KZZA 4Y2PA 2ZIWA 4QZBA 2BCRA 8ICOA 3TTDA 3G4SN 5J8YC 2BTFA 4KX3A 3GIKA 5ALDA 4DL3A 4M9GA 4M3YA 4HVJA 5BREA 5DLGA 3OS2A 1A76A 4TUPA 3OVNA 4BREA 3D2EA 3D0PA 4CGHA 1Z25A 5MLCQ 5AJ3K 5GADP 4DV0K 2YJFA 3E9LA 4O5FA 3VQAA 2D0AA 1C0MA 2QWOA 3EO3A 1WBDA 3EPIA 3WK8A 1XWLA 3DLGA 4O55A 2D0PA 1K73O 2YNGA 1WSEA 3S3OA 3PO5A 1OW5A 4M63C 3E1YA 3CCSN 3EUB2 2JRZA 4DV7K 2ASLA 3C6AA 1D9DA 5HP4A 4CJ4A 1N6QA 2W8KA 3C0BA 3HPHA 1I3AA 4MDAA 4RQ5A 3EZ5A 1S5JA 3UKRB 4E1NA 9ICBA 3RRHA 4JWNA 3H6EA 1FXXA 1SV5A 2KZ3A 3CCUN 2YHYA 3J80O 5DQIA 4U7CA 4L3QA 2A1RA 1KRPA 4RUCA 5DKWA 3MDCA 2IIRA 5I3UA 1WUDA 3Q8PB 9ICNA 1VAZA 1ZQUA 2EANA 4EZ9A 4YD2A 1WWUA 3RSEB 3QUQA 2BPFA 4M3RA 1REVA 1Q8KA 4DSEA 2J4RA 2GELA 3OBYA 4IJAA 5M1OA 4GXJA 3RB3A 4DG1A 4KHPK 2XY7A 1FK9A 5CA7A 1NGDA 4F5OA 3SUQA 4DUZK 2HMPA 1WNSA 1MSWD 2BDPA 1Z3EB 2PI4A 4FZZA 3NVKA 1RT1A 3V9ZA 3C2KA 4RPXA 1U45A 1LAWA 4DSJA 4KLDA 3SI6A 4YNQA 2QWNA 3T7ZA 5J1EA 2BPGA 2FLNA 3O9SA 5KFTA 5J0YA 1QTMA 4C23A 1M1KO 5KI6A 5ALMA 7ICQA 4CHOA 1N8RO 1O13A 1VRUA 5AKJA 2BQUA 4A8EA 3THXB 4YXMA 3M9MB 3D2QA 5KT5A 1MN8A 4R8UB 5M1QA 3CD6N 1ZQGA 3PX6A 4RQ1A 4MF8A 1BA0A 3LDOA 2BZFA 3T3FA 4YR0A 5K4LA 4C7ZA 3HILA 2HCFA 1ASUA 3HM9A 3BZKA 3NVZA 4H4MA 4G9ZA 3MGHA 2FF6A 1YUWA 2A1AA 3MGIA 2P35A 2F77X 5AI8A 4BRLA 1YJNN 4N76A 2EZXA 1OXJA 4AHUA 3RMBA 3O80A 2JEFA 4QW8A 4MFFA 3F2KA 4OJPA 3SZ2A 3FZKA 3G71N 4FLXA 5AKYA 5HP1A 3WUHA 4DOAA 1KVBA 1VHXA 3KLFA 3HVRA 3RRGA 3CQYA 3KWGA 4DTRA 4F9OA 2HMXA 4H0YB 2OA8A 5HRSA 3NMUA 3OSNA 4CJEA 5BPCA 4E3SA 4J9NA 3V7LA 3TABA 4FXDA 5KFYA 2YNIA 5AQGA 5B5EU 1KL9A 2E2QA 3KD3A 3SENA 3GZFA 3EW9A 3OSPA 1MU2A 2X6SA 3FE1A 2EH9A 4R64A 3O1BA 3VQ7A 3KBBA 4FBUA 4JMUA 3H8MA 5AKKA 3BP8A 4JV0A 1N5WA 4YHHK 2YMMA 4TSXA 4FJ7A 9ICOA 4Q43A 3R3LA 3H8JA 3MFIA 1P90A 3ICXA 3LZJA 2P9SB 4IDHA 3VA3A 2DPJA 2FC0A 4JKBA 3KK2A 4UAVA 1JLCA 3J7YP 3NDKA 4TURA 3RJJA 2W54A 3MEDA 3O9QA 3L3VA 2W03A 3MN5A 5KFEA 1VQ9N 4B3TK 4TUQA 5AK3A 4KN7A 5JTIA 4FVMA 1WSGA 3CM6A 5HL7L 4R66A 4JNEA 2Q3SA 3K4GA 4I2CA 1MA9B 2G5HB 1D9FA 3H1VX 2LI6A 5J2MA 3V6JA 2W42A 3V6HA 4CEFA 4BRHA 1X42A 2F2AB 5J0QA 4ED7A 2HNZA 4BY9C 2H3IA 3LDAA 4XH4A 3KLEA 2FPKA 3WT0A 1SXDA 1ZD4A 4F4XA 9ICMA 3WEEA 2G8UA 2PY5A 4H5NA 2UUAK 4FJLA 4PQUA 3ZDEA 4KB0A 1JUDA 1X6JA 1YT3A 4CGJA 5HR7A 2YJEA 3AA4A 3ZSVA 5JRTA 4KTWA 3CFRA 4LH4A 8ICBA 1KAXA 2BQRA 1HPMA 4ISGA 4P0QA 1Z1VA 1KFTA 5HRNA 4IOXA 2K4HA 1ATRA 3D2NA 3TARA 2G0AA 2UVVA 1RT3A 4BGAA 4GKJK 1JKHA 3ZX0A 2AQ4A 3NTUA 3VTIA 1E4GT 5AIAA 2HOFA 4EHUA 3MXIA 2XHBA 9ICEA 3LAKA 3T19A 2VJ4A 2O8EB 4CJ7A 2HOIA 4FS1A 1JXEA 3B0YA 2BCUA 4QAGA 3OHBA 3CYMA 3PZPA 3QBWA 1XQSC 5KT2A 1ZBFA 1RBSA 3U3YA 5BPMA 4KREA 1JX4A 3DYAA 3AVIA 5C10A 1IIPA 1RT7A 2X6NA 4B9NA 3TPQA 3EY1A 3OBWA 3N97B 2RF2A 3FGUA 5AFUH 5T7BA 4BE0A 4IXCA 3SNNA 4PHDA 2MRLA 2V7ZA 1DK2A 4X64K 4B3OA 3QX7A 1GLCG 1ZD3A 3GE1A 5ALFA 4O8KA 5LL6Z 2QI2A 4CZLA 3RR7A 4DV6K 2K4EA 3OYAA 3IM1A 1JLEA 2RPIA 3ZETB 3C5FA 1QQNA 2WBNA 2QK9A 4DS5A 5DLFA 4CJ5A 1R0AA 4UQGA 3ISBA 1VSFA 2JEIA 2PFOA 1DT9A 4BGBA 1VQNN 2NYVA 1VQKN 3HTVA 3D6JA 5DDYA 4EX6A 3DXKA 2WC9A 4B1YB 3V9XA 4Y1DA 3N7SC 4IFEA 2ZJQL 2QARB 1JCFA 3AVAA 1X9SA 1VSMA 4WQ4A 3VQEA 4O3SA 2KHOA 4NWIA 4KMOB 1QE1A 1MWMA 1OUQA 2Q1NA 2HHUA 1KBUA 3WNHA 2ZF5O 4DFPA 3SR6A 5TZVA 2NNWA 2NRTA 4B9LA 4CF9A 1ZQIA 3R6MA 4QZFA 2V4RA 5E41A 4RZRA 1D8YA 5IIIA 4EYHB 1IG9A 4AM7A 3NFAA 3SYZA 3M7DA 3LP2A 1TKZA 4F4KA 3BUZB 4IR1A 2D6FC 1BGXT 9ICFA 3DOKA 1D4XA 4O9MA 1BQNA 3HXMA 3CP8A 2W6LA 4KLJA 4YMOA 2IHMA 4BDPA 4DWIA 1ZBIA 4AP9A 1AROP 1V4SA 1S1UA 4J9SA 5KAIU 1NNLA 5C2DA 2WUSA 4FZLA 1KFSA 9ICKA 2P5GA 4O3NA 4F5PA 2VG5A 1EXNA 1F44A 1C1AA 4JKGB 4ECXA 1SQKA 2FBTA 1GLLO 1SV0A 2KOBA 1EQYA 3I8BA 2KE7A 5FP0A 3RVCA 5KFVA 4DOCA 5DM7L 3IDHA 4Z0UA 3LDLA 2B4JA 4KHUA 2A19A 2VA2A 5ALOA 2A1JB 4QZAA 3TAFA 5AQKA 5AQVA 4CESA 3F73A 4CZHA 2E8AA 2OZSA 4AILC 1VQ5N 1XSPA 3TTCA 5AFUA 4FPAA 2BR0A 3PMLA 2VCPA 3C21A 4V19S 3KK7A 1ZRMA 2PFQA 1B9FA 5HROA 2W11A 5CJ7A 1HNXK 1IBLK 2FBXA 3OTQA 5CHGA 4Q8EA 3NAEA 3CJ1A 4O3MA 4EELA 5CYQA 1PK3A 3C1YA 4OJ6A 4BXOA 3TADA 1LW2A 5AQLA 4DTSA 3ID8A 2KD1A 2WF5A 1K9MO 3OYBA 4CEBA 3K9KA 4BDYA 3T1YK 4NM2A 2CGLA 4FWSA 4FLZA 4ECTA 3K5OA 4J2AA 3U26A 3HM8A 2KSOB 2UVWA 1D8BA 2XCAA 4MDBA 3T1AA 2YTUA 2ZIUB 2E1FA 5CP2A 4YFKA 4DQIA 2DQNB 5CZ1A 3QEXA 2LHTA 3QYPA 3T5HA 1ZOLA 1QZ5A 1YJ9N 5CY4A 5J8YA 2F96A 3KK1A 4M6WA 4BX9C 2W9AA 4HTUA 3V1RA 1NK9A 4IKFA 3VQBA 4XUSA 5K14A 1F0MA 1L7OA 2D8CA 3PSTA 2IVOA 4PPXA 1XUPO 2E88A 2KJ9A 3RJIA 2P9IA 3CC7N 4RPYA 4IJNA 2VA3A 4BRGA 5C25A 5AKEA 3PIPL 3GDQA 3DLBA 1RDUA 2P9KB 1DLOA 3JPOA 2KV2A 4Y2TA 2OPQA 5C12A 1ATSA 1BVSA 1RDAA 2RHKA 4X65K 4DV2K 4H0PA 2N1RA 1BIUA 4YY3K 2OYQA 1NJXA 4DMNA 4FVUA 1JRPA 3W0LA 3SAFA 3CETA 5FPDA 4RNNA 2FDRA 5AKGA 3PV8A 4I2GA 3CCJN 1Q86O 4JKEA 4Z6FA 4CERA 3LANA 4QZHA 3NGYA 2Y9TA 2KHQA 2F9WA 4LSNA 3P1GA 1T3NA 3EEQA 1BIZA 3LPTA 1X40A 2ZXIA 2QA4N 2KKVA 1FIQA 4YG2A 1S1XA 3ZLJA 4PHEA 2ASJA 3QIPA 4ICAA 2KW4A 3SUOA 5AI0A 1EKEA 3NASA 2PFPA 1SKRA 1DTTA 2BE2A 4O5BA 2DBYA 4DTOA 4KLFA 1TAQA 3OYKA 4FW1A 3BZCA 5AKHA 3K59A 2WHEA 3IDWA 4CGFA 4OPKA 2AH5A 3TTFA 3SMVA 4DTMA 1YTAA 1YAGA 5KT6A 2IOCA 3J7AP 2FLPA 4C8KA 4M9JA 5DGAA 3DAWA 3T5KA 4AH9A 3NH1A 3ISNC 1NNEA 2HHTA 4BQZA 1J54A 3MBYA 2XICA 2EQYA 2OEHA 1GLBG 4UB6U 2B0CA 1S1WA 2JR5A 1OVQA 3QINA 3VQ8A 1CI4A 4N56A 2G8HA 1KQSM 3TR8A 2BCSA 3G6XA 4N41A 4ISFA 4AYBC 3O6WA 4CD3A 4J8FA 3VQQA 4PY5A 4QZGA 2P9PA 1IV8A 4M7XA 1RM6C 1SKWA 5AR0A 2Q97A 3ZSQA 1TFRA 9ICTA 2LYAA 3WKAA 1C0UA 3KOOA 3PMNA 4OGEA 1Y97A 3KZIU 5BRDA 2O8BA 3WNFA 2LBOA 2LSNA 1TKTA 3VQ4A 1VQ6N 5JVGL 2YMQA 2IBKA 1RG6A 7ICMA 5AQRA 1X6IA 1Q81O 3L2WA 2Z1JA 3D2FA 8ICXA 3HP6A 4EBEA 4KHNA 3GILA 4MO4A 3RMCA 5D49A 1ED1A 5EOYA 1KCFA 1ZQJA 2KJ8A 5M1NA 3EPGA 3MECA 2W9CB 4BRMA 3SQ0A 3O9RA 4ED1A 9ICCA 2OPRA 1HMVA 4BRPA 5CZ2A 5DK5A 2VYPA 2G8KA 5KFHA 2C22A 3IV6A 5KG0A 1Q8IA 1NJWA 5J0RA 1X9MA 4NYNA 1BL3A 2Q0UA 5EWEA 3NBPA 2PI5A 3AVNA 2DPNA 2YB1A 3VF2A 1QQ6A 2FE9A 3FLCO 3FAHA 5AI6A 1TAMA 3NF8A 5DG7A 3MCPA 5E84A 1VDVA 1KW4A 4FLWA 4JKCA 5GIOA 2LYHA 3K75D 2DL0A 3KZBA 4FWKA 1N2XA 4O3OA 4YR2A 1O08A 1BI4A 1U2VA 4JI1K 3ULEA 2F8SA 4RQMA 8ICZA 3VEOA 5BPNA 4FM1A 1XNRK 2CN1A 4WYBA 4ZTJA 5AKZA 5KRTA 1Z00B
chains in the Genus database with same CATH topology
3HX0A 4JN4A 2C28A 4GXKA 5LY3A 4AF1A 3PW4A 4WFAL 3WXMB 1BPZA 2HBJA 4FS2A 3SV3A 1U49A 2JZBB 3ID6A 1T8EA 3PLAA 1LOTB 3PX0A 1S97A 3H45C 5HOOA 3HSCA 4I2JA 1KLNA 1XC9A 2JEJA 5BOLA 4WFBL 2FMQA 4FO6A 4JK1A 2J6UA 5D4BA 4MFAA 5EVZA 1HLUA 1NKBA 2P9NA 2OANA 2QWMA 2HVIA 2IVPA 3RH4A 5KFPA 4ECUA 2FLOA 4K42A 3C7NA 4CZMA 3EZWA 2Y1JA 5JLHA 3JPRA 2BGWA 5EXWA 1ESVA 2A6AA 3CCQN 2E1YA 2HHVA 3DWLA 2NRHA 5AZJA 1IJJA 5JICA 7ICJA 3QMLA 3BQ2A 3PR4A 4B9VA 3SAGA 4KLLA 5GAEP 7ICGA 3D2EB 3CJ7A 4XH5A 2AA4A 2BKEA 4BR5A 1VQ7N 3MK6A 3RJHA 5FPNA 1NGAA 2XGPA 3Q8QB 1S76D 5J29A 1OKJA 3FZHA 3LM9A 5HMLA 4PL8A 3H8SA 2ZUDA 7ICLA 5LJWA 3VEWA 4BWJA 2ZJ8A 3HOSA 3WXJA 3Q8LA 4CCHA 4CZKA 1T6DA 4UB4A 3UKUA 1BOTO 1NK8A 5M1FA 3I55N 2HOEA 1UT5A 2R8GA 2QWQA 3ATVA 1VQLN 5I9EB 4YQWA 4YN4A 4BR2A 3KHGA 4JK7A 4GC6A 1LB2B 1NGGA 4RTFD 2HBKA 4O5EA 4EBDA 2HHWA 4KH6A 3T5JA 4EEYA 4BC4A 2FPMA 3BQTA 2ZUBA 3V7KA 3CPEA 2QWLA 2MAXA 3RB6A 4H5RA 1ZQMA 2W9BA 5JUMA 2QWPA 4KLHA 1NWKA 4QS9A 1HKBA 1S9FA 5J0OA 3AU6A 4NB4A 4H0OA 1RZTA 2ASOA 5J0WA 2D0OA 2XGQA 9ICGA 4KLSA 2IA6A 2UVUA 4GNIA 5L1JA 3PW7A 4JWMA 1XS9D 1ZQEA 3H1QA 4QWEA 5AZIA 3HBTA 2BPCA 3T5LA 3EWAA 1NK0A 1ZQSA 2P9UA 3TSUA 3ZX3A 4MLEA 4XH1A 5KFQA 3KHRA 5AQNA 5KG3A 3J8AA 5HMMA 1TKDA 2YX6A 5JLFA 8ICQA 1X2IA 1XC3A 2HSTA 3O9TA 5KFLA 3GV7B 5JMVA 1QSYA 2HHXA 4K4GA 5AQOA 3ZDCA 1U47A 3VGLA 4F5QA 5J2GA 1Z6RA 3BJYA 3G25A 4CBWA 4ECYA 3MDQA 4NM1A 1BWFO 1XSNA 2HW3A 3H3OB 3OA9A 5DDMA 4KTQA 4DFMA 3CCLN 3MN6A 3JXUA 3SBGA 2QM1A 1Z05A 3AARA 4DQ8A 2RDIA 8ICNA 4JAXA 2ZGZA 4B1XB 3GFKB 1K8KA 5J2BA 2AP1A 3MR6A 3THVA 4JUZA 1RXWA 3ZDBA 1NGEA 4DL2A 1NGFA 4YOVA 9ICRA 1L3SA 1YJWN 3L0QA 4NLKA 5J2IA 1ZBSA 1TV9A 4CI6A 3P38A 4HYKA 4JHDA 3MR2A 4DS4A 4Z94A 4TQRA 5J2DA 1SL2A 2I1QA 4QWAA 1TK8A 2ZTDA 5DB8A 2AGOA 3O8MA 3FR0A 4BRFA 2BCVA 3G6VA 4JV2A 4BQLA 4ECWA 4BG8A 4GXIA 3MX2A 4QS8A 1VQMN 5KFWA 8ICLA 3HRGA 3AAQA 3O5BA 4YOTA 1JN3A 1Y64A 3KVGA 1ZQYA 4H03B 4A61A 3CPWM 4ED8A 3M6GA 4FPBA 5AQYA 3CCEN 4J9PA 4BR0A 4JEPA 4PGQA 1U4BA 2QW9A 4A57A 4YR3A 5L1IA 1RYSA 1ZQHA 4EIAA 3DXKB 3QBXA 4F5RA 3QB0A 1IXRA 1MQ2A 3WXIA 1QVGM 4UB1A 3S41A 5KTQA 3OW2M 1L3UA 2UVRA 4BGDA 3UKRA 2ZJRL 3SJHA 4J9KA 2V7YA 4BC2A 4WF9L 4P2HA 4FOEA 3UXPA 4NO7A 2KFNA 3T69A 1NBWA 4QZIA 4CZGA 1JMSA 1BU6O 4UBBA 4QW9A 2HVHA 4RQ2A 1KD1O 8ICUA 1CZAN 1NGHA 4BR9A 1HJOA 4QZ8A 1VQ8N 5DQGA 1N48A 3VENA 4UY8O 4M7YA 3H40A 1KSPA 3DXMA 4LC9B 3U9DA 4NLNA 4I2AA 1BDGA 5BPLA 1U6ZA 5ADXA 5DBBA 3ZEUB 1ZETA 4PHTX 1P8ZA 4MEYA 2FF3B 3LWLA 5BRFA 9ICWA 5DBCA 4U67L 2H5XA 3L6QA 4BXOB 1R59O 4KH4A 1SS6A 5AQJA 5DG9A 4Y0WA 8ICYA 1HJPA 2NZTA 1HUXA 3ENBA 3EKSA 3MWPA 3RJEA 3G6EN 8ICCA 5KPZA 5TKYA 1ZQXA 4M6WB 2DPIA 3H4DA 3LK9A 4YMMA 2MUTA 3BF1A 3VMFB 1SZPA 4ELVA 2GWJA 3LDNA 2P9IB 4Q45A 2R8HA 8ICVA 8ICEA 4I2BA 3L4IA 2QTDA 3KTQA 1S0MA 3B0XA 2PFNA 5CB1A 4JKDA 2CH5A 2P9SA 4K43A 1HKGA 3SBTA 4QWBA 4A2AA 1QSLA 1QZ6A 4UB3A 5IIMA 3E2EA 4BVPA 2AGQA 1L3TA 5KG1A 3N4PA 3DJCA 8ICKA 4DFKA 4MEXA 3OJSA 2FMSA 1QQOA 4CBXA 3AGRA 3CXCM 4F4WA 7ICUA 4H0XB 3MFHA 3ENOA 4O5KA 5AQHA 1T3VA 1BG3A 4H5VA 1JJ2M 5E26A 1QLNA 5KFFA 4ILGB 1BA1A 3PW0A 3VPZA 4A62A 4DQSA 1QSSA 4IRKA 1K8AO 8ICPA 4DSFA 2E1ZA 4CZJA 2E2NA 2P9PB 4FWLA 3J7ZO 2IMWP 3M9OB 1KC8O 3C65A 1BPDA 3FYHA 3Q8MA 4HWIA 1X3NA 3CI5A 5AQWA 4BRDA 2F7TA 3OJUA 2AGPA 3HT3A 1U9LA 2ASMA 2ZJPL 1J6ZA 3V7JA 4ED2A 7ICRA 4DKWA 2KLAA 3PIOL 3OHRA 4NXZA 4RQ0A 3JPNA 3JPQA 1ILYA 4JKHA 1G99A 2ZJ5A 4JD2A 4ED0A 3TQ1A 1WOQA 4R63A 1U48A 4DL7A 4G3IA 3TSPA 3QFUA 2J6TA 2FXUA 4KLQA 2UYTA 3FZFA 5AQSA 1KDHA 3E9OA 2I7NA 5M1PA 1U2VB 2AQ0A 5C2FA 1NLVA 3ULEB 5DQHA 4YOUA 3V6KA 4RU9A 3RB0A 5IILA 2M9NA 5CR4A 3PNCA 1UA0A 1TUUA 3AUOA 1NK7A 2JWKA 4JKAA 1CUKA 2OTJN 3TFSA 2F1IA 4PHAA 4YDUC 4B9UA 3C23A 2PBDA 4BC3A 3D7EO 2BH1A 4TUSA 1X9WA 1LV5A 4IWVA 5KG2A 4I2DA 1MWKA 4DEZA 1Q7YO 3H7IA 4C8NA 5J2AA 3R8EA 2FLLA 1CEZA 5HHIA 2JWLA 3PW5A 2P9NB 2AJQA 2A1JA 4DCHA 1JIHA 1TVAA 2ATLA 2D4WA 4A59A 2NRZA 3C7NB 4K25A 1X3MA 1ZC6A 2E2OA 1ZQBA 4PL7A 2FMPA 3A5MC 3SK3A 4DQPA 1WUAA 2NRWA 4LZGA 3HWTA 1TK5A 2P9LA 4I2IA 1ZQAA 5GINA 1S72N 3H4BA 5KG4A 4B1VA 5EWGA 2FSKA 9ICVA 4P4MA 9ICLA 4O8UA 1T7PA 1RDWX 4ZH4A 5KFIA 3U9ZA 2Q36A 3NGDA 2BQ3A 5AQFA 9ICJA 3GV8B 4RUAA 2HHSA 1S10A 5IIJA 5KQ8A 4DOBA 3EE8A 5KG6A 2Q0RA 4MF2A 4LZDA 4WFNL 5AQXA 2BUPA 5IIKA 4DSKA 3QDKA 5JVHL 1QVFM 5KG7A 1ZXOA 4O3QA 4RNMA 5GAGP 1NJZA 3UB5A 1JCGA 7ICVA 3PY8A 4PKGA 5KFKA 4P4OA 4WCEL 3CCVN 3C2LA 4ED3A 3Q8KA 4DO9A 1YF5L 4DL5A 5DBAA 1ZQCA 2F1JA 3M5RA 5FPEA 4B9MA 2OTLN 3IKMA 4I29A 3RAXA 1ATNA 4RQ6A 4O0IA 3SV4A 4FBTA 3CJCA 1YITN 1BPYA 3KWIA 1NK6A 3CERA 3HZ6A 1ZQWA 3RJFA 4YOYA 4F93B 3FFKB 2W9BB 3CCMN 3VF4A 2ALZA 2PFUA 4BRCA 3VERA 3D6RA 2PAVA 4IOCL 4ILJA 4KH5A 3CQXA 3SI8A 4O5CA 1S0NA 2PXIA 3WXKA 3FZLA 3UXOA 3AGKA 4NLZA 1BUPA 1TYQA 3VEVA 2A41A 3Q7BA 1TAUA 4CBUA 4R65A 5IINA 2I7PA 3LDQA 3ZD8A 5CHIA 1YXQA 3GIIA 2BCQA 4UAYA 4C1NK 2ISPA 2A42A 5KFXA 1W2BM 1NOMA 4IO9L 4I28A 1NKEA 1KEJA 5KFBA 4J9MA 2IVNA 1MQ3A 3BEXA 2V51B 2DFLA 2A3ZA 3F5TA 2C2RA 3VTHA 4J9OA 3A8YA 3GV5B 4YORA 4BRKA 1ZQFA 4C8MA 4BR7A 4E0DA 4BRNA 4A5BA 3WQUA 4M04A 4JK8A 4PH5A 1JCEA 2JZBA 1RPLA 4IQVA 1HUZA 4RT2A 4RQ7A 4TQSA 2A40A 1KFDA 3VEZA 3C1ZA 3C2MA 3QEAZ 3MWTA 3ZD9A 4F3OA 4HTLA 3M1FA 3BDPA 4I27A 4IR9A 1B43A 1ZJMA 3RJGA 4FSVA 4H5TA 1T4GA 2C2EA 4ELTA 1KXPA 4KN4A 5HHHA 3RR8A 3PW2A 1SAZA 4F4YA 5AQPA 3CIPA 7ICNA 4KLUA 1T44A 5LJVA 5BN9A 1TK0A 2NLXA 2NRVA 5KFNA 3OHAA 3ISCA 1HX1A 4IZ9A 2ZJAA 2KFZA 2NRRA 2OWOA 3ORYA 2EWSA 3BQ1A 3CC4N 2CGKA 1OVYA 4DLGA 3CMAN 3P39A 4F91B 4I2EA 8ICJA 2HF4A 4UAWA 7ICEA 2V9WA 3ZDDA 4EAHD 1ZQPA 1L3VA 3PX4A 4OPHA 2E2PA 1S77D 4I6MA 5KT4A 2R8IA 1RFQA 4CD1A 4C8LA 5C5JA 9ICAA 3MDAA 4EHTA 1A77A 3VESA 3VOVA 5L1KA 4K41A 1VQPN 1GLDG 4RQ8A 3U8XA 4B1WB 5L9XA 4DHYA 1QHAA 4B9TA 3ATUA 3WEEB 5J2KA 1L5UA 1GLFO 3BQ0A 1ZQNA 2IHNA 3A5OC 5KFRA 5HNKA 2YHWA 4QZ9A 3GDXA 9ICSA 4KLMA 7ICIA 9ICXA 4YDUA 3KHYA 2D1KA 1YI2N 2VANA 7ICOA 4DL6A 3DXMB 4YMNA 2Q2RA 3MN9A 1S3XA 4M0AA 5ADXH 8ICSA 5ELZA 1W97L 4QZEA 1HUOA 1BPBA 1UT8A 3CC2N 4M9LA 2ZTCA 3ISDA 1JXLA 3M8SA 4Q44A 3GBTA 3JS6A 1N56A 4DQQA 2XY5A 3PR5B 4NY8A 3Q8RB 1NK5A 4M9HA 4GV6A 9ICQA 4OO1J 4FWOA 5KFAA 2MUTB 3K9JA 5KFMA 4GC7A 1T6CA 4FWPA 8ICHA 2W41A 4A2BA 2KN7A 1ZQZA 3ZX2A 3GIMA 2QXLA 1E4FT 1RGIA 5BN8A 3EN9A 4IQUA 3O08A 3QZ7A 3IFRA 4FWNA 3RSEA 2W8LA 5J2EA 2ZTEA 2J6SA 3UPQA 4PGXA 5CE3A 4DFJA 1MC8A 5F1XA 1GLAG 4IEIA 4C1NI 3CJAA 3I56N 1Q82O 3L4QA 3IHQB 4RQ4A 4FL9A 2V52B 4DSIA 5AQIA 3GIJA 3H8WA 5J0PA 5KG5A 4QZCA 5F9LA 2W40A 3ZYYX 1NJYA 3VGKA 2V4QA 4YCXA 3P4IA 2HF3A 5J0TA 4R8UA 3EYZA 4XRHA 5AQTA 1NGBA 4KITB 3RAQA 2GTDA 5TKWA 3LWMA 5DB7A 2E20A 1ZQRA 5KFZA 4IEEA 9ICUA 3CHWA 1COOA 2ITMA 1ZQOA 1WCNA 8ICGA 3QFPA 4ECSA 4Z6CA 4UB2A 3F9MA 1SL0A 3TSQA 1M90O 3AY9A 1KAYA 8ICTA 5H1SQ 9ICHA 4KLIA 4OPAA 3RJKA 3GL1A 5D46A 4Q8FA 3FDSA 3VEYA 4BG9A 3MR5A 4RCHA 3M3ZA 1ZYQA 1HKCA 2F1HA 4JD2B 4ECZA 4GVEA 1XSLA 3OGUA 5KT7A 4QS7A 4B1UB 3G6YA 4F4ZA 5BRHA 3Q8SB 4JK9A 4KLGA 2FSJA 4WQ5C 5C15A 3IMXA 3RH5A 3VF6A 3LM2A 3MMVA 1SKSA 4IRCA 4ILHA 4GY2B 2P6RA 4DSLA 4C8OA 3JPSA 4I2FA 5IIOA 2XY6A 3GQCA 4FWRA 5AQUA 1UA1A 4RPZA 4LVSA 4DF8A 4YP3A 4RQ3A 1SL1A 3MR3A 3MN7A 2VGNA 4BRAA 2C2DA 4ELUA 1IM4A 2KZMA 2CGJA 4GLXA 4FOIA 5J2JA 4YD1A 5C0YA 3TFRA 4Z6EA 4H0TB 3TU5A 3PO4A 2HHQA 3H3NO 4O3RA 3UQ2A 2FSNA 4KBOA 9ICIA 3HI0A 4PGYA 2ASPA 4UB5A 2B21A 4F8RA 1DGKN 4PHPA 3I33A 4RNOA 3KHLA 5KFGA 4B9SA 4YOXA 5KT3A 1ZQDA 4F2RA 3MCAB 3W3DA 1C7YA 2HBMA 4J9QA 3ZEUA 4ECVA 2QWRA 3D2FB 5KFCA 2GEMA 3CJ9A 3A5LC 3AU2A 1K1QA 4CZFA 4BROA 2BHNA 1Y88A 2I9GA 2P9LB 3UXNA 5GAHP 5KFOA 2AU0A 1EO1A 1GLJO 4H0VB 2GX9A 2P66A 4PKIA 3R1XA 4DB3A 1ZQKA 5KQDA 3VETA 1D8LA 3HW8A 3QE9Y 3ZETA 3TI0A 1TUYA 3A0IX 2Y1IA 5DB6A 2Q0ZX 2YCHA 4YVZA 5AQQA 4DQRA 4IQWA 2W9MA 4NLGA 1S0VA 3O1WA 3V72A 4ECQA 1GLEG 2ZUCA 4KMUA 4F92B 5BR9A 4B9QA 4ED6A 4B1ZA 4QZDA 1ZQTA 5GIPA 3RH6A 4M47A 1PZNA 4NLBA 4DLEA 3UE5A 3PVXA 5J0UA 5KFDA 1YVNA 5EOZA 4BRQA 3P31A 4JKGA 3M8RA 1MDUB 3BF3A 3H46O 7ICSA 3E66A 1RXVA 3KHHA 2WTFA 8ICIA 3GOIA 1NM1A 3JPTA 2XC9A 1VQON 1S22A 4IO8A 2KKZA 5F2RA 5BOMA 4AM6A 4BVOA 1BPXA 4IQTA 3WXLA 3MX5A 8ICFA 3QEBZ 4FWQA 5AZJB 4BC5A 3TAPA 4BWMA 1H38A 1XO1A 1YHQN 1ZQLA 7ICHA 2GWKA 4DL4A 4P4PA 3RB4A 4KLOA 4BRIA 3HOTA 1DKGD 4M2YA 1TYQB 2YI1A 1NJIO 1RYRA 4GV9A 4JV1A 5EX5A 2VGMA 3EL2A 1DOQA 1NKCA 3VEXA 1YIJN 4R79A 4PKHA 1KAZA 3N4QA 2H3GX 3Q7CA 4MO5A 5L1LA 3C6HA 4KLEA 4YXJA 3E9PA 3HPOA 2R8JA 2P9KA 3U4LA 1Q18A 7ICKA 3C5GA 4F2SA 3WQTA 5KPRA 1VQ4N 2RE2A 3UKUB 3EKUA 2XCPA 2FPLA 3AAPA 3TANA 1S0OA 2CH6A 2RDJA 1DEJA 3R9PA 4RT3A 4CZIA 4UBCA 1V4TA 1H1VA 1ZQVA 3UQ0A 4F50A 4QWDA 2XO7A 3RBEA 2GUPA 5FPMA 5F0XA 4CZEA 2ASDA 8ICMA 2VWBA 3QZ8A 5KFUA 4M9NA 1NGJA 5KFJA 5J2CA 1NGIA 4O3PA 2A5XA 3IUCA 2QEXN 4QWCA 4FO0A 3M9NB 4UAZA 5J0SA 2NRXA 3CF5L 5F9NA 5AQZA 1NGCA 4ISEA 4XQ8A 3MABA 2YHXA 1KTQA 5EWFA 4EZ6A 4RWTA 3VGMA 8ICAA 1C0FA 5J0XA 3B8AX 4GV3A 4XA5A 5AZIB 2P9UB 1C0GA 2HBLA 2F9TA 3O4WA 4EFHA 3A5NC 2W9CA 7ICPA 3O9UA 4Z6DA 3ETLA 4MLHA 5EY4A 7ICFA 3QICA 8ICRA 4YOWA 4WQ4C 7ICTA 3SLCA 3RBDA 5DB9A 4U7BA 1DGSA 2ZWHA 5DGBA 3RTVA 1X9JA 5J2HA 2JEGA 3GG4A 3ENHA 4A5AA 4I6MB 4BR4A 2WFBA 4IOAL 4ECRA 5AQMA 4DF4A 1K1SA 1NMDA 1Z00A 1ZJNA 1NK4A 4FWMA 3CCRN 4WQ5A 5J2FA 5KPTA 3NVMA 9ICPA 1ZQQA 4H5WA 4EBCA 4NLCA 3DLLL 3CMEN 5KFSA 4EYIB 3SMSA 4KLTA 1XU4A 1BPEA 3ZDAA 3SAHA 1IG8A 1V9PA 1K8KB 2Q31A 4J9LA 5CWRA 2P6UA