2NRWA

Crystal structure of the c terminal half of uvrc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
217
structure length
204
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHTVASLVVFEDGFPKKGDYRRYKIEQDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 63
structure length 204
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrwA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrwA01
4DQQA 5C5JA 4O5KA 3GFKB 5KFZA 1ZQKA 3H8WA 4B9TA 5KG1A 3SYZA 1XSPA 1QSSA 4JV2A 1T4GA 2W9BB 5HHIA 8ICMA 7ICLA 4XUSA 3T5JA 1T7PA 1U9LA 1TK0A 3JPPA 1N56A 1ZQXA 1QSYA 4RT2A 4YN4A 4NY8A 4PPXA 8ICQA 3G6YA 1S0VA 5KG2A 4DSFA 5J0RA 8ICIA 5DLFA 1ZJMA 5L9XA 4QWEA 5KFJA 2HHWA 1D8LA 3JPOA 4JWNA 1Y88A 4QZIA 5KFTA 1BVSA 4RQ1A 4J9PA 2A1JB 3T5KA 4KTQA 4PHPA 4B9VA 1C7YA 4O3PA 4EZ6A 4O3NA 5IIKA 4I2JA 4R63A 4RNNA 2XCAA 3TAPA 3Q8RB 5D49A 4E0DA 1ZQJA 3ZDBA 4FBUA 3OJSA 3ORYA 5DLGA 2I1QA 2BPGA 9ICRA 4F4XA 4J9MA 4TUSA 2PFQA 2FLLA 2C22A 1TK5A 4QW8A 4KMUA 5EWEA 3PMLA 3Q8QB 1S0MA 4I2AA 4O3QA 7ICGA 3LWLA 2MUTA 3GV5B 4M47A 3ZDCA 4M6WA 5KFBA 4QZ9A 3GV7B 3ZDDA 1KLNA 1ZQDA 2KZ3A 8ICTA 2C2DA 2PI5A 2V4QA 9ICFA 4MFFA 5DBBA 3AU2A 3PX4A 4QWCA 1U47A 2HVIA 4EBEA 1ZQVA 4O3OA 1ZQMA 3BDPA 1KEJA 4IR9A 4B9UA 4YQWA 5CWRA 5CP2A 4Q45A 4UB5A 4KLFA 5J2IA 4F92B 3HW8A 2HVHA 2HHUA 1NJXA 3Q8KA 1ZQRA 3MFIA 3RJEA 2BPFA 4QZFA 5KFYA 5J0WA 1ZQQA 1RZTA 1S97A 9ICAA 4DL5A 4DSLA 4NLKA 4R8UB 5KFPA 4Q8FA 1K1QA 1XSLA 5J2DA 3C2MA 4QZAA 1KRPA 2AQ4A 1RXWA 4Q8EA 9ICEA 1ZETA 2NRRA 5DQHA 2W9AA 2PFOA 3V6HA 2KZMA 1S9FA 1KTQA 3BQ0A 1MQ3A 1HUOA 5KFEA 2KFNA 2GWSA 4PH5A 4JUZA 4DSKA 4ECQA 4DF4A 3RH4A 1UT8A 5KFOA 3RTVA 4RUAA 1X9WA 2DFLA 5J0QA 4HYKA 1D9DA 9ICMA 5DBCA 3H4BA 1ZQCA 1B43A 1Z00A 5KFLA 4CCHA 5KT4A 4DL7A 1N48A 4YMMA 1NKBA 1D9FA 4JV0A 2P6UA 5L1KA 3V6KA 3RH6A 1NK0A 4Z6EA 2IHMA 4O3RA 4I2DA 5CHGA 3EW9A 4UB1A 3JPQA 4IR1A 5KFWA 1U4BA 4DSJA 8ICUA 2FMPA 2BHNA 4UB4A 1HJPA 4EYHB 5CB1A 3M8SA 3GIMA 3V72A 4DFKA 7ICNA 4RQ2A 4ECVA 4QWDA 2P66A 4ELUA 3JPNA 1WCNA 2XCPA 2LYHA 5DB7A 3N97B 7ICIA 4TUPA 5KG6A 4ED7A 1ZQSA 4NLGA 3PX6A 3PR5B 1UA1A 3UQ2A 3OGUA 4F2SA 8ICNA 1NJYA 1TK8A 4J9QA 3TANA 3C1ZA 3BQ1A 4YR3A 2NRWA 3MR5A 4NM2A 4R65A 5J0UA 1A77A 2M9NA 5KFDA 3EYZA 4DO9A 4MFCA 4RQ4A 2ALZA 4K4IA 3E2EA 5IINA 1NK6A 4ECYA 2NRTA 1TFRA 3PR4A 4DSEA 1XC9A 3PO5A 4IRKA 4M9GA 4KLHA 7ICSA 4EEYA 4DQPA 4B9NA 1S0NA 2JEIA 9ICVA 7ICEA 4DLGA 2BCSA 2VA3A 1ZQTA 5IIMA 4EBDA 5IIOA 1BPDA 8ICRA 1TAUA 1SKWA 4JK1A 4GC6A 5KT5A 9ICPA 1EXNA 5J29A 4MF8A 1ZQZA 4DWIA 2XY7A 2R8GA 4J9OA 4DOBA 1DGSA 2AJQA 1UT5A 2BPCA 3K75D 3GILA 3QEAZ 1ZYQA 5D4BA 9ICJA 4EYIB 1B22A 3RJIA 5DQGA 1T8EA 3RJFA 2BCQA 4KITB 2ASJA 3BQ2A 1T3NA 4KLGA 4F4YA 4DL2A 8ICYA 3C1YA 1NK5A 4GXJA 3RJGA 1AROP 1IXRA 4FBTA 4KN4A 2IHNA 2ISOA 4P4MA 4QWBA 1XO1A 3B0YA 4RUCA 5BOLA 4M2YA 4QZBA 4MEYA 3MGHA 3SV4A 9ICCA 4ECRA 3MR6A 4I2HA 2FPKA 5KG3A 4F91B 3AU6A 1XSNA 1QLNA 3H4DA 3RAQA 1Z3EB 3MR2A 4F5OA 2NRXA 2UVVA 4O0IA 3V7KA 4K4HA 4IQUA 4KLSA 9ICHA 4DL3A 5IILA 2XGQA 3RJHA 4TQRA 4LZDA 5IIJA 9ICNA 4J9KA 1L3SA 1A76A 4RPXA 1RYRA 2JEFA 5KG7A 3H8SA 5DQIA 4M6WB 3TQ1A 3RJKA 3LWMA 2BDPA 4DQIA 7ICKA 9ICQA 4GXIA 2Y1IA 1KFTA 5KFGA 4DS4A 5J0SA 4Q43A 4I2CA 4P4PA 5DDYA 2DPJA 4FS1A 2HHSA 1S10A 4RNMA 4QW9A 5KFVA 7ICRA 1K1SA 2FPLA 4ECTA 5KFSA 4F5RA 4JWMA 2F1HA 9ICIA 4YD1A 2B21A 3HWTA 1U48A 4ZH4A 1U49A 2ATLA 5J0YA 7ICUA 9ICBA 4YFKA 2FPMA 1CEZA 4YR2A 3RB6A 4RPYA 1DOQA 1XWLA 7ICMA 1RPLA 3FDSA 5HMMA 3EPGA 3RR8A 4J9NA 3M8RA 5KT3A 7ICFA 4F5PA 4QZEA 2HHVA 4GC7A 2ZUCA 5L1JA 5J0XA 2W9BA 2BKEA 2NRVA 4PGQA 4KLMA 5KFMA 4I27A 4J9SA 2R8KA 3PO4A 3V6JA 4NLZA 3C23A 9ICUA 4IRCA 4QZGA 7ICJA 1BPXA 1TAQA 4KLEA 3TAQA 3TFRA 2BR0A 1L5UA 1ZQNA 3PY8A 4BXOA 2AGPA 7ICQA 3PVXA 9ICLA 2ISPA 7ICOA 5KFNA 3KHHA 5DG7A 4ED0A 2BCVA 7ICVA 1Z00B 2J6SA 1NKEA 5HP4A 4TUQA 1UA0A 4BWJA 5KT2A 1JXLA 2KFZA 2KN7A 3SI8A 4RQ0A 2V4RA 4O5EA 2FMSA 3UXPA 1NK8A 4YMOA 4MEXA 1MC8A 3RH5A 3PW4A 3OSPA 2AU0A 2ZJ5A 3G6VA 4KLQA 4I2EA 1KFSA 3ZD9A 2KTQA 3TI0A 4F93B 1LV5A 4IQVA 2W9CB 3M9NB 1WCLA 2ZJ8A 4DOAA 8ICGA 3T3FA 1S0OA 4I2FA 5HNKA 1JXEA 3ZD8A 2XY6A 2FMQA 8ICXA 4ED6A 8ICJA 5BPCA 5DG8A 1NOMA 2W8LA 4ED2A 3EZ5A 4FS2A 4KLIA 4O5CA 2ASLA 4I28A 3M9OB 4LZGA 3C5FA 4RT3A 2J6TA 5L1IA 5J2AA 3TARA 4R66A 4F4ZA 8ICWA 3ISCA 7ICTA 2ZTDA 2AQ0A 2ZTCA 5BOMA 3HT3A 1S76D 4F5NA 1ZQIA 2XY5A 1L3VA 3GIKA 2W9CA 4MFAA 3ISDA 4M04A 2BCRA 5KTQA 2R8HA 5TZVA 4ECZA 2FLNA 8ICLA 4C8KA 4IRDA 2UVUA 4M9HA 1JMSA 1U45A 1BPEA 5KFUA 1ZQAA 4RQ6A 2W9MA 3ZDEA 2A1JA 5J2GA 3PW2A 1HUZA 1SL1A 3MFHA 1KFDA 4R8UA 5D46A 5KFQA 5KFHA 1ZQWA 3RB0A 1RYSA 1KSPA 2OWOA 3LDAA 1XS9D 2R8JA 1JX4A 2JZBB 4F4KA 1CUKA 1QTMA 4UQGA 4DEZA 2FLPA 4DOCA 4ED8A 4DFMA 3GDXA 3PW5A 3HX0A 1PZNA 3N4MB 4PHDA 1ZQYA 3OJUA 4ED3A 2HHTA 4ECUA 2W8KA 1SL2A 4RQ8A 4YMNA 3BQTA 3MDAA 3GIJA 2P6RA 4UAWA 5J2BA 5DB6A 5KFCA 4YR0A 3PNCA 4GXKA 2AGQA 4UBBA 3SZ2A 1D8YA 4RNOA 4M9JA 1ZQFA 4I29A 2JZBA 1V9PA 3ETLA 1BPYA 5KFXA 5KFFA 5J2FA 4XA5A 2UVRA 4YCXA 4R64A 5J2JA 4YVZA 4BWMA 5DGBA 3C2LA 2IBKA 4B9SA 1ZQEA 4DSIA 4O9MA 3C5GA 7ICPA 2AGOA 3RRGA 4BDPA 1BPBA 3MGIA 4LVSA 8ICVA 9ICGA 4Q44A 5J0TA 4M9NA 2ZJAA 2C2RA 3HPOA 4ECSA 3QE9Y 2ASDA 8ICKA 5J0OA 2ZUBA 4Z6DA 5KG0A 4BGDA 4UB3A 1MQ2A 4M0AA 3OSNA 5DG9A 1ZQUA 9ICTA 3EWAA 1TV9A 2PFPA 4UAZA 4NLNA 2BQUA 5HHHA 3H8JA 4DLEA 2BCUA 4EZ9A 2BQ3A 1NK9A 3M9MB 4YD2A 2HHXA 2IA6A 1NK7A 3KHRA 3GIIA 4Z6CA 3MABA 4PHAA 2F1IA 1TKDA 3Q8LA 2V9WA 4KLDA 1TVAA 2H5XA 4KLOA 5EWGA 5KT6A 4YXJA 4P4OA 4J9RA 3RR7A 4I2IA 5KFRA 2BGWA 4I2BA 3KHGA 1SKRA 3LK9A 3JPTA 4NM1A 3PX0A 4C8MA 4UB2A 3IM1A 9ICSA 5DDMA 4C8LA 3MBYA 4KLTA 1SL0A 5J2KA 4PHEA 3BJYA 4IQWA 3K4GA 4B9LA 4ELVA 4K4GA 4YXMA 3NGDA 4ECXA 4M9LA 1MSWD 5F9LA 4TQSA 2VA2A 1KDHA 1ZQHA 5KG4A 3KTQA 4O3SA 4F4WA 1JIHA 4KLUA 1NK4A 3PMNA 3TFSA 4DL4A 1ZQBA 3MDCA 2C2EA 3EPIA 2XO7A 1X9SA 2DPIA 2RDIA 1H38A 3KHLA 4F50A 3RBEA 5DB8A 4X5VA 1RXVA 4F3OA 3OHAA 3RBDA 4KLJA 4TURA 3RB3A 2IMWP 4DQRA 4F2RA 3SV3A 4RU9A 5HMLA 3QZ8A 3IHQB 3T5HA 4KN7A 8ICAA 3PV8A 3RJJA 2ZUDA 3UXOA 4F8RA 3T5LA 1BPZA 2XC9A 4YG2A 2KZZA 1ZQPA 4GLXA 4DF8A 2JEJA 4DFPA 4G3IA 5DKWA 1QSLA 4QZ8A 3B0XA 3Q8MA 5J2EA 4C8OA 3NTUA 4QWAA 4C8NA 5J2HA 1IM4A 2C28A 2HW3A 3RB4A 4QZDA 1NJWA 5KT7A 5JUMA 1BGXT 8ICFA 1NJZA 4DS5A 1JN3A 4QZCA 3C65A 3GQCA 2JEGA 4RQ5A 5DGAA 5L1LA 4XRHA 2VANA 2NRZA 3ISBA 8ICEA 2HHQA 5KFKA 5F9NA 3Q8PB 1SZPA 4Z6FA 5EOZA 4ELTA 1X9MA 5CJ7A 4KLLA 2R8IA 8ICZA 8ICCA 3V7LA 4F5QA 8ICOA 3RRHA 2MUTB 2J6UA 1ZQLA 1COOA 4I2GA 9ICKA 3UXNA 4RPZA 3QEBZ 1X2IA 3UPQA 4PGXA 2PFNA 4EBCA 8ICPA 4P2HA 4XQ8A 4ED1A 9ICWA 4RQ3A 9ICOA 3H7IA 5J0PA 4UAYA 4YP3A 3FYHA 4DL6A 3Q8SB 8ICHA 4QZHA 3C21A 4PGYA 1NKCA 3JPSA 1SKSA 4FO6A 4JV1A 4RQ7A 2Q0ZX 5KFIA 2I9GA 2UVWA 4B9MA 4UBCA 3QZ7A 3PW7A 1LB2B 5J2CA 2RDJA 4BXOB 2PI4A 3PW0A 2MAXA 4J9LA 1XU4A 5CR0A 3V7JA 2BQRA 1ZQOA 2ZTEA 2VA8A 8ICBA 5KFAA 4IQTA 4NXZA 5IIIA 1ZQGA 5EWFA 3MR3A 4RZRA 3OHBA 3RAXA 1L3TA 9ICXA 2F1JA 3UQ0A 3HP6A 3THVA 3GV8B 3G6XA 5KG5A 3AUOA 7ICHA 4MF2A 5CA7A 3ZDAA 4DQSA 1ZJNA 1S77D 2PXIA 3JPRA 2XGPA 5DBAA 3H40A 2WTFA 3C2KA 8ICSA 5DB9A 4DFJA 2Y1JA 4ECWA 1L3UA
chains in the Genus database with same CATH superfamily
4DQQA 3EKSA 4I6MB 4C4SA 1YF5L 2FDRA 2OZMA 4EFHA 1T05A 3SYZA 2AA4A 4PZOA 2W9BB 3U3YA 8ICMA 4RTFD 5AI4A 2F8KA 2QB0A 4Z94A 3QYPA 3JPPA 3VA0A 1N56A 4B8CA 3QU4A 4FVMA 3A5NC 5AKYA 4RT2A 4NY8A 3LVWA 4NYNA 3AVFA 3KLFA 4O44A 3R9PA 2YKNA 5J0RA 2D5RA 1TYQB 1ZJMA 1RT3A 4JS5A 3DRRA 5KFJA 1D8LA 3VC8A 2HBLA 3WU2U 4KKOA 3JPOA 2QARA 2LHTA 2O4GA 5AKEA 4JAXA 5CZ2A 2QK9A 2PMZF 1IBKK 1BVSA 1I39A 3SD7A 4CESA 1YJWN 3HL8A 4B9VA 4O3PA 3LPUA 1S5JA 1NGBA 1N5YA 4R63A 1E4FT 4FBUA 3ZDBA 3QERA 4DTOA 4YOVA 4FFDA 3Q7CA 4BJQA 9ICRA 2PFQA 2P51A 2ZQBA 1TK5A 3ASMA 4PKHA 4FZLA 5EE3A 4US9A 2E2NA 1L7NA 2FXUA 3HXMA 2K4HA 5EE0A 1GOBA 4M47A 4FPBA 3ZDCA 4AHTA 5KFBA 5C2FA 1ZD3A 2JGAA 2LMRA 4QZ9A 3GV7B 3D2EA 3I33A 1KLNA 4IZ9A 1ZQDA 2KZ3A 2QWPA 3WKBA 1K8KB 3HO1A 3SLCA 2C2DA 3IUCA 1BHLA 5CYMA 1SZ2A 2HF3A 3QBWA 2QWLA 1ZQMA 3BDPA 1G15A 1KCFA 4BRGA 3HM9A 4IR9A 4Q45A 3KJVA 3F2BA 3CF5L 3OYHA 2UUAK 4F92B 1W7AA 2HVHA 4AHVA 3QNNA 3Q8KA 2P35A 5GIPA 2YNHA 4H8KA 3RJEA 5AFUH 1ATSA 5AQXA 5KFYA 3UKRB 3AVAA 1S97A 9ICAA 1DGKN 3TABA 1S1VA 3G10A 5AZJB 4NLKA 4X66K 4Q8FA 2QXFA 4FJNA 4UARA 4Q8EA 1ZETA 3H3NO 5DQHA 1V4TA 1KTQA 3S6JA 3SBGA 2KFNA 4FWLA 5GIOA 4JKEA 5BPNA 4DTPA 1NNLA 4JUZA 2G5HB 3RH4A 2HSTA 2GELA 4M63C 2G8KA 1NWKA 3HBTA 1K8AO 1Z00A 3NF8A 2ZM6K 2A40A 2HMIA 1IO2A 5KT4A 2ZJRL 1NOZA 2K60A 4YMMA 4HTLA 2AH5A 5AQYA 2D0OA 2IHMA 3AO2A 4CK2A 4W5TA 4K8ZA 2BHNA 4F3TA 4IFYA 5ALFA 5A0LA 3M8SA 4CZFA 4BC5A 7ICNA 4KX3A 4CFBA 4DTXA 4QWDA 2P66A 2XRIA 2XCPA 1VSDA 5DB7A 1YTAA 4ED7A 3V1QA 3PX6A 2OYQA 2RN2A 5BN9A 1NJYA 3CHWA 5ALSA 2YMPA 4JNEA 4YR3A 4CJ3A 3MR5A 4R65A 5J0UA 1GLDG 3N7SC 3EYZA 1TL3A 4JD2A 4DO9A 5ELZA 2ALZA 2QWNA 3UKUB 4K4IA 4CZEA 3I55N 1X66A 2NRTA 1W9HA 1XC9A 2A6AA 4CJ7A 3LDNA 2WFAA 2JEIA 9ICVA 4DLGA 2CH6A 2VA3A 3DLRA 2W03A 2YTUA 1M90O 4CF0A 1PK1B 2VJ5A 1TAUA 4GW6A 4LF4K 1IH7A 4JK1A 4O3MA 1VQ5N 3M5RA 4J8FA 1J53A 2NNWA 1K8KA 1EXNA 2ZIXA 4BUGA 2JXJA 1LKYA 4DWIA 2F8TA 5KAFU 2XY7A 4OPHA 5AICA 4H5VA 1S9GA 4MFBA 4LF8K 2HDOA 4E7JA 3QEAZ 1ZYQA 5F2RA 5FRNA 9ICJA 5J2PA 5D4BA 2P9SA 1B22A 3RJIA 3RJFA 2HMXA 2VIXA 2DPNA 4KLGA 8ICYA 4KO0A 2QLTA 4JI5K 3ZETA 3CNHA 3SUQA 4J2AA 4FBTA 4DV4K 2IHNA 5CHIA 1BCOA 1NGAA 4IJNA 2K4PA 3T7ZA 4RUCA 3AA2A 4M2YA 4MEYA 3MGHA 2HCFA 5HBMA 3MR6A 4I2HA 3IRXA 3QO9A 4AH9A 4YNQA 2XI9A 5ALLA 4H5WA 1VQON 5JTIA 2XGQA 3ZEUA 4TQRA 4LZDA 4OKKA 3C7NB 3IG5A 3PZPA 1L3SA 3M6ZA 1RYRA 1ZRMA 3CIPA 4KHSA 3L3UA 9ICQA 7ICKA 3OA9A 3TR8A 3LWMA 1BA1A 3AVGA 4JLHA 4B9QA 4LF5K 3AO4A 4GXIA 3PIPL 1EO1A 1KFTA 3CYMA 1FKPA 4DS4A 5GTHU 3FZKA 3HOSA 5DDYA 5BR8K 2A1SA 5CR4A 1VJ5A 3D2NA 1KXPA 4CZIA 3OYDA 1YUWA 2GV9A 3KZXA 4RNMA 4DB3A 3RMBA 5HRRA 2QWOA 2FPLA 3SMVA 3DI6A 3QINA 2YN4A 1QVFM 4F5RA 3FZMA 3HWTA 2ATLA 5J0YA 1B92A 7ICUA 3VEWA 3BS7A 3MMVA 3OS0A 4FK2A 1BUPA 3RB6A 1DOQA 4RPYA 3V81A 4M42A 3NS1A 4QZEA 4F5PA 2HHVA 4GC7A 1BA0A 2YNGA 3H08A 5AQWA 1JCFA 4KLMA 5KFMA 1BOTO 3M3ZA 5EX5A 4I27A 3NVWA 2R8KA 3PO4A 3OYNA 3C23A 1B4FA 5H1SQ 2CH5A 1RT4A 3DLHA 3O80A 3SPYA 1TKXA 3TAQA 1WWUA 1AQ6A 4CEAA 2BR0A 2WB1C 1L5UA 4PKGA 3CCLN 9ICLA 2BZFA 1RT1A 4EIAA 3J8AA 2J6SA 3AVIA 1NKEA 2BGGA 4BWJA 3VQ9A 1IKXA 2WF5A 1KAXA 3SI8A 3WKAA 4O5EA 2CGLA 3D45A 3LDOA 3QU9A 4FLXA 5ALNA 1NK8A 3F2KA 2E3TA 2AU0A 3OSPA 1KKXA 3FE1A 3QBXA 4I2QA 1FKOA 3ZD9A 4DTUA 3TI0A 4OO1J 2P9SB 2F3NA 5AFUA 2W9CB 2ZJ8A 8ICGA 5ALDA 3T3FA 1TL1A 2EZZA 2OXOA 4I2FA 4ICLA 5HNKA 1RYUA 1RBTA 4KX5A 1NOMA 4ED2A 4FS2A 3C0BA 3DOKA 4I28A 1A5WA 2BDUA 2HF4A 1KLMA 3MDQA 4KB1A 2NV3A 1X42A 8ICWA 3ISCA 7ICTA 3RWUA 5ALWA 2W3RA 3H1VX 4JK9A 3HT3A 3TSQA 4CJPA 3RMCA 1QH9A 2XY5A 3F5AA 2FSNA 4MFAA 3TSPA 4WQ5A 2BCRA 5KTQA 1RBVA 2EQYA 8ICLA 1VAZA 2UVUA 4M9HA 2G8WA 4M3TA 1JMSA 4BRCA 3L5KA 3E9LA 2WF8A 1HUZA 1J9AA 4YHHK 1SL1A 4W5NA 4RWTA 3ZSZA 2O8EA 1U2VB 5DM6L 5KFHA 2LI6A 5KFQA 3RB0A 3AVMA 4H4MA 4CK3A 1OH7A 3ALRA 3VQDA 5HRNA 3AARA 4UQGA 2I7PA 4IDKA 2FLPA 3ICXA 2CGJA 3G4SN 2V52B 3P1GA 2E6LA 4FM2A 4FJLA 3VMFB 3GDXA 4FJGA 3O4NA 3P39A 2H3GX 4BRFA 3QEPA 3U9ZA 4I9QA 1YIJN 4ED3A 2HHTA 3CERA 3MCAB 2W8KA 3NUQA 1SL2A 2WC9A 3NFAA 3F2CA 2DKXA 2JWLA 4YY3K 3PSIA 5G5GA 4NJ8A 1X9JA 3ETRA 3CETA 3GIJA 3TTCA 1IIPA 4C80A 4JI1K 5DB6A 3CMAN 4BVOA 3O8MA 3SZ2A 1DRGA 4RNOA 2ETJA 1RCHA 4PL7A 2YX6A 2I6XA 3V1RA 2GUPA 4CHOA 4BR0A 1UQVA 1S1XA 2E1EA 2YMMA 5AK6A 3NCIA 5AIBA 3PUFA 2YX8A 4L3QA 3M1FA 3FAHA 5J0TA 1C1AA 2ZJAA 1FW6A 4ECSA 3CRXA 3MEGA 2A41A 1ZRNA 3OSNA 3HYFA 1ZQUA 3M6KA 3IG1A 3DRSA 4XH1A 1TV9A 5M1PA 4C7YA 4FJIA 4UAZA 4CECA 2BCUA 4M3WA 4E7LA 2BQ3A 3M9MB 5ALEA 5GAHP 4FCYA 2HHXA 1ZOLA 3LP1A 4WQ4C 5G5HA 2HNZA 2E2PA 2ZIUB 3S3MA 1QE1A 3K5LA 3LZIA 4OLBA 4FLTA 5ALQA 4KLOA 3AO3A 1TVAA 3T1HK 3P38A 5EWGA 3C95A 3L4QA 2G8IA 4I2IA 5KFRA 2BGWA 3T69A 1SKRA 3NGYA 3AN1A 3OYAA 3JPTA 4LJXA 3BGRA 4A62A 3IM1A 9ICSA 5DDMA 1Z1VA 2EH9A 5ALVA 3AGRA 4CGJA 4FWOA 2PYLA 5J2NA 5J2KA 3OYJA 2KJ8A 4FJMA 3K4GA 4ELVA 2YI1A 4K4GA 3C6UA 1ZXOA 4M9LA 3WXLA 2HNDA 3CC2N 3NF7A 1EQYA 1JLBA 4O3SA 3O9TA 4BRMA 4IC9A 3A8YA 3WNFA 4KLUA 3UMGA 3TFSA 3ZCMA 3LYSA 1ZQBA 4EHTA 4CIFA 3EPIA 2DPIA 4X65K 4P0PA 2LKYA 5C2DA 4X5VA 1RT5A 3QEWA 2G8VA 5E84A 4Z4GA 4KLJA 4Q0BA 2PFUA 4TURA 3UKUA 2VG7A 1N63A 1QS4A 3WXMB 3S9HA 4CI6A 2Y9TA 4JB3A 1KW4A 3T5HA 4CEDA 3PV8A 2WAQF 1NM1A 3MXMA 1T03A 3UXOA 3LL3A 3EEQA 1ZQPA 4DF8A 2JEJA 1GLLO 3NTUA 1B9DA 4C8NA 3KLGA 4GFJA 5KT7A 5JUMA 3AVJA 5BRDA 5ALKA 1ESVA 4CJ4A 3MGVA 5F0XA 4B3SK 2VKQA 4CJSA 2JEGA 1WNSA 1V97A 3CFRA 4RQ5A 3EKUA 4CBUA 4DU3A 5L1LA 5AQQA 4A5BA 5F9NA 3Q8PB 3ULDA 5EOZA 4IEEA 1S72N 4JKBA 3CJ7A 2YHYA 2WF6A 8ICCA 1YZ6A 1K9MO 1X6IA 2MUTB 3SMPA 1D8BA 1RTJA 1ZQLA 3J80O 1COOA 5J8YC 4I2GA 4RPZA 4WE1A 4PGXA 2LSNA 4P2HA 3P4IA 4CJRA 4LFBK 3O6WA 2O8EB 2EDUA 5J0PA 4HHTA 3S3NA 2F8LA 8ICHA 3CQYA 5FLXO 3BEXA 1O13A 3KZBA 4PGYA 3VQEA 3MC1A 3VOVA 3O9UA 2Q0ZX 3ZX2A 3ULEA 3QEVA 3SAFA 1HQEA 4Y1DA 4A2AA 4BQZA 1XU4A 2KKPA 4EX6A 1ED1A 4OLAA 4EX7A 8ICBA 3AVKA 5IIIA 4ILGB 3D0PA 4FJKA 2QWMA 4QS8A 3RAXA 5BREA 2F1JA 1QCKA 3HP6A 3HZ6A 1Q9YA 3SCXA 1BNPA 2E5LK 2K4IA 5AK3A 3OTOK 1HLUA 1KAZA 2Q31A 2KOBA 1Q81O 1X40A 4Z0UA 2DF4B 3J7YP 3H40A 1F5SA 2E8PA 5DBAA 8ICSA 4IEIA 2F2AB 2D0BA 1L3UA 1JROA 1L7PA 2FF6A 5C5JA 1T44A 4O5KA 4IL6U 4JKCA 4XH4A 5C24A 3I28A 2DFEA 3GFKB 5KFZA 3KK7A 3SAGA 4B9TA 5KG1A 1VDVA 1XSPA 4JV2A 2P9PB 2O8DA 1T4GA 2H3VA 3LVVA 4XUSA 1T7PA 2G07A 2HI0A 3IDHA 4CHZA 3GL1A 1QSYA 4PPXA 5JICA 1XI1A 8ICQA 3G6YA 1S0VA 4DSFA 3MX2A 3WQUA 3NGIA 4UB8U 4BACA 1FIQA 4CGIA 4QWEA 5M1QA 2W41A 4OD0A 1JRPA 2HHWA 3CJAA 4A57A 4JWNA 4QZIA 3THXB 3TTFA 4J9PA 3VQ5A 4ACOA 1X3MA 1GOCA 3HRDD 2R7YA 4KHPK 2W7OA 1WSGA 2WFBA 4CEFA 4RNNA 3TAPA 4E0DA 4U67L 4B6JA 4CF4A 1DTTA 1Q9XA 2I1QA 2BPGA 3SBTA 2DKZA 2FLLA 1D4XA 4DKWA 1Z1BA 4EHUA 4BRKA 2WTUA 3ZEUB 1CLQA 4I2AA 5AKIA 3LANA 1IV8A 3IDWA 4A8EA 7ICGA 3GZFA 2MUTA 3U9DA 2VJ4A 1UAXA 2D0AA 1XNQK 4Q5VA 4M3UA 3CCRN 2V4QA 4M3YA 3TADA 3OW2M 3AU2A 5KL8B 3AA3A 2YKMA 3DXKA 1OXJA 4FZXC 1ZQVA 1ZBLA 1LWCA 3R8EA 4B9UA 1ZQ1C 5CP2A 3NBPA 4PQUA 4KLFA 3MXIA 4QIWF 3QUQA 3QLHA 3K9JA 2UYTA 4A5AA 1SUQA 5HROA 3MFIA 4H5RA 1QQ6A 5AKXA 1KVCA 5I42A 3RMAA 2X74A 4C7ZA 3EUB2 1RZTA 1L8LA 5CYQA 5ALYA 2Q1NA 2E8MA 4DL5A 4HUFA 4JRQA 3O4QA 4FVUA 5KFPA 3I56N 3AVCA 4YOWA 5J2DA 3C2MA 1KRPA 1ECWA 2AQ4A 2NRRA 3P31A 4OJOA 2PFOA 3DLGA 2KZMA 4A2BA 1Q86O 4J2EA 4FJXA 4CJLA 1HUOA 1GLEG 4DSKA 4DF4A 2K89A 3RTVA 3ITHA 2DFLA 1VRUA 4E7IA 2F76X 3CP8A 3K9KA 3RFAA 5DBCA 5GAGP 4PUOA 1Q46A 3A5MC 2HMPA 4B1XB 5KFLA 4CCHA 3WT0A 4O5BA 1N48A 1SV0A 1D9FA 3CG7A 5L1KA 3RH6A 3V6KA 4JMUA 3TACB 2IOFK 5ALHA 4O3RA 4ICAA 2KHVA 2NO4A 3EW9A 5CHGA 4Y2YA 1P7DA 5KFWA 2B6AA 3LP0A 2QKKA 1N62A 2FMPA 2DTUA 1HJPA 4EYHB 2JGUA 3T1AA 4DV3K 1SB3C 4E7KA 3BP8A 3DJCA 4WFBL 3OBYA 4O55A 2LYHA 3N97B 2N1RA 3WQTA 4M41A 1UA1A 4QCLA 5HR6A 4YDUA 2IIRA 3QDKA 2UXCK 3I76A 3BQ1A 1PK3A 3FZLA 5AKLA 1A5VA 2M9NA 5KFDA 1S6QA 4Y1CA 5AZIB 1UOCA 3CCQN 3E2EA 4F9OA 4CZMA 1I3AA 5IINA 1EWQA 2ATQA 4ECYA 4DSEA 2OPPA 2ZE2A 2QKBA 3N7RC 1WAJA 2GOLA 1HPZA 3QESA 5AI9A 4E1NA 5LY3A 2HOEA 4LFAK 1IJJA 1NBWA 4CGDA 4DR3K 3DWLA 3PIOL 5IIOA 1NLVA 1SKWA 3HOTA 3K57A 1GOAA 4FZMA 5KT5A 2HBMA 4ZHRA 2P9PA 2O8DB 5ALZA 4NCBA 3KD3A 1DT9A 2RRDA 5AQLA 4DV1K 3QFUA 1RDBA 1S1WA 1QHTA 3A0HU 1UWBA 4LH5A 2A19A 4DOBA 1DGSA 1FK9A 1NGGA 4ISGA 4E1JA 4H4OA 5HRPA 4CZKA 4FLUA 3K1ZA 4IOCL 2QI2A 3L0QA 5JVHL 2VWKA 1T3NA 4I7FA 5AM4A 4AHUA 3D7EO 3CCMN 3C6TA 4GXJA 2NRHA 4NLBA 3TAMA 5ALGA 3O9QA 5BRFA 1XNRK 3L2VA 1SQKA 5C12A 1BL3A 3NDKA 1L8OA 2W04A 1A6SA 4KHNA 2ISOA 3TADC 1UHUA 5JRTA 1JUDA 4QZBA 1X9XA 4CGGA 2GX9A 2ES6A 2DUYA 2ZIVA 1HYSA 2FPKA 5KG3A 4F91B 1QLNA 4AHCA 1VQ8N 3RAQA 1Z3EB 3MR2A 3Q7BA 2YCHA 3H6EA 3NVYA 2EZXA 4KLSA 4NL9A 4HCBA 4FJ7A 4GV6A 4AF1A 5M1KA 4J9KA 4P0QA 1A76A 3TAGA 4RPXA 2JEFA 4M45A 3E58A 1JKHA 4HAIA 5DQIA 3RJKA 4JHDB 4DQIA 3L8BA 2EAOA 1SWWA 4FSVA 2PMZC 5GAEP 3FC4A 5J0SA 2Q0UA 4U7CA 4Q43A 4I2CA 1QQMA 3CJ1A 4P4PA 2DPJA 4BRIA 1MDUB 4C1NI 2NYVA 5KAIU 3MECA 4BE0A 4MHVA 4JRPA 4N41A 5KFVA 7ICRA 3CM5A 4PY5A 4AHSA 1M1KO 4ECTA 5KFSA 5HOOA 3HSCA 4KI4A 1MA7A 4BX9C 4YD1A 1SAZA 1U48A 5AQVA 1U49A 2LPEA 2HBKA 9ICBA 3SUNA 3V9UA 4YFKA 2FPMA 4YR2A 3M1YA 4HUGA 5BN8A 3FDSA 5HMMA 3WK9A 4M7YA 5CZ1A 1PVQA 4N56A 1HR0K 4FJJA 7ICFA 1T6DA 5LJWA 2ZUCA 5L1JA 2RF2A 2W9BA 2YHAA 4PGQA 4J9SA 4NLZA 9ICUA 3V6JA 1BU6O 2HB5A 3EL2A 3NVMA 4WFAL 3LDLA 7ICJA 4OJ6A 4PL1A 1NZBA 3ATUA 2W6LA 3K5MA 4JYAK 3D2FB 4H0PA 3AA4A 3TFRA 3EE8A 3PY8A 3UMCA 1Y64A 2ISPA 1RFQA 1Q3UA 5KFNA 4YOXA 5DG7A 1H1VA 1Z4NA 1Z00B 1W0HA 1DKGD 3MCPA 3MWTA 4IS7A 5KT2A 1JXLA 4IKFA 5AQRA 1VQ6N 4RQ0A 1W97L 5AK4A 4WF9L 3NRZA 3VGKA 4MEXA 4FW2A 2ZF5O 3H3OB 4XIUA 3G6VA 4I2EA 5I9EB 2KTQA 1HPMA 1J2NA 1RDCA 2GBZA 1T6CA 4IQVA 5C42A 3E1YA 4DOAA 4CGHA 4FM0A 1S0OA 3ZD8A 2XY6A 1Q8IA 4FXDA 5ALIA 1LW0A 5DG8A 1TUUA 2ZGYA 4BRPA 5ALPA 3EZ5A 4KLIA 3CXCM 3DLBA 2ASLA 1WB9A 4RT3A 2J6TA 2YV0X 5J2AA 2OTJN 4R66A 4F4ZA 1C0FA 3UMBA 5HLFA 1DGJA 5BOMA 2AQ0A 1VQLN 3ONNA 2M0NA 1HJOA 4F5NA 2IDOA 4IJAA 1HRHA 3O08A 2W9CA 3WKDA 2RPIA 3SQ0A 2O8CB 3KBBA 3ISDA 2V7YA 3K0SA 2JR5A 4U6PA 1YTUA 2UXDK 5AM0A 4RW8A 4B1WB 4KHQA 2QARB 3K2PA 2Q3SA 1BPEA 5KFUA 1ZQAA 2NLXA 3ZDEA 4RQ6A 2A1JA 1IG6A 3MFHA 4OPKA 2OPRA 4R8UA 2OWOA 1ZQWA 4DV6K 1RGIA 5M1OA 2YQEA 1JX4A 2VQFK 1CUKA 3PSFA 3E66A 4CBWA 5DMRA 2Q97A 5J1EA 4Z4IA 5DK5A 4AP9A 2GUIA 3LM2A 1PZNA 2X78A 3MX5A 4PHDA 1GO3F 2OEHA 5KGXA 1SXEA 1WLJA 2Q4TA 3HPHA 4YMNA 3S41A 3BQTA 3MDAA 4UAWA 3D6JA 2OPSA 5ADXA 1D8YA 3AO5A 1ZQFA 4I29A 2JZBA 4EP5A 4CJWA 5KRSA 3WK6A 4JI4K 4IFEA 2PZSA 4EENA 2FJ6A 4YCXA 2D0CA 2Y9UA 5KI6A 4C23A 7ICPA 3C2LA 4B9SA 4O9MA 1WBDA 3H0RB 2AGOA 3RRGA 4AILC 2E8NA 3C94A 4O0JA 2E5SA 3MGIA 4LVSA 9ICGA 4IXCA 4M9NA 2L5YA 3DRPA 4XEIA 3ALYA 3HPOA 3A0IX 5J0OA 5ALTA 3WNEA 4CHPA 1O1WA 4DG1A 4M0AA 3EWAA 4USAA 1RT2A 2FF3B 1RDFA 3D2SA 3J81j 4DTMA 5CRXA 4EZ9A 3O9RA 4OPJA 2V7ZA 1RNHA 2IA6A 3VETA 2YY6A 3ULEB 1VSLA 3LM9A 3VESA 4PHAA 4RG8A 2V9WA 4GMJB 4GNIA 2XVTA 2PAVA 1S5LU 3IP4B 4G9BA 4YXJA 2CRXA 3OYFA 4P4OA 4G1QA 4N76A 3QU7A 3RR7A 3WEEB 3V9WA 5JLFA 1N5WA 2CXYA 5HR7A 4CZHA 4C8LA 2VWBA 3A5OC 4KMOB 3MBYA 4KLTA 3VQBA 4IQWA 3OS2A 3UIQA 3NGDA 5F9LA 4TQSA 1CRXA 4BC2A 2VA2A 4MDBA 1KDHA 1ZQHA 3KKSA 5KG4A 4F4WA 2OPQA 5T7BA 2KLAA 1NK4A 3ZETB 3THWB 1NG9A 3MDCA 1R0AA 2XO7A 3IV6A 2RDIA 1RBRA 2IS3A 3KHLA 1BI4B 3TU5A 3OYCA 5TKWA 3IN5A 4F3OA 4FLVA 4CJQA 5C10A 4DQRA 1E4GT 2JWKA 1LCUA 1YJNN 4F2RA 1WG8A 4CHQA 5IT9O 3CFPA 3NAEA 2ZUDA 4J2BA 1BPZA 2V51B 2XC9A 2XIDA 4YOTA 1RQNA 1PK1A 2KVCA 1HUXA 5J2EA 3ZI4A 2QXLA 5JS2A 4QWAA 5J2HA 2C28A 1IM4A 3CJ9A 4JV5K 3AMZA 1NJWA 4QZDA 4H5NA 3FR0A 2W54A 4WQ5C 3OS1A 1BGXT 4JKAA 4BQLA 4DCHA 4DS5A 3L2RA 1JL2A 4HUEA 2ASMA 2G8FA 1PVPA 4L8RB 2KVSA 2GH1A 1DK2A 3ZSRA 3OYLA 1O03A 5KNIA 3KFUF 4XRHA 3M8PA 2NRZA 2WAQC 3ISBA 8ICEA 2Z1JA 4DTJA 4Z4EA 4ELTA 3JS6A 1X9MA 3MWPA 3ZSWA 3TKAA 2P9KA 3ID6A 5FDLA 3RRHA 2J6UA 2GEMA 1BG3A 5H2FU 2HSZA 4K42A 3QEBZ 1V4SA 3AVNA 5AQHA 5AI0A 1VSFA 8ICPA 1J6ZA 2P5GA 2OANA 2D3DA 4RQ3A 1T3VA 9ICOA 3H7IA 3VF2A 3R6MA 2ZIVB 1I94K 4JI3K 3HK2A 4YP3A 1VSEA 4DL6A 3DXKB 1SZHA 4U7BA 1ZBHA 5FPNA 1XMQK 1HMVA 2ZJPL 1NKCA 4HVJA 3HJFA 3JPSA 4YORA 2Y0SF 1X6JA 4GY2B 4FO6A 4JV1A 4RQMA 5AKGA 4ZOHC 2YNIA 4UBCA 4F72A 4E89A 1LB2B 2RDJA 1N60A 3PW0A 2MAXA 4J9LA 1NGIA 3PSTA 5CR0A 2BQRA 4KH6A 4FLZA 2JHDA 2PKEA 5KFAA 2UXBK 1Z25A 3WEEA 5AIAA 3JYTA 3OHBA 2G5IB 3UQ0A 3G6XA 1WSEA 4RW4A 2KNJA 3MN6A 4DQSA 5CY4A 1ZJNA 4BRLA 4AM6A 1HNZK 4OKJA 3JPRA 5AQJA 4IWVA 1LWFA 3LAMA 3O3FA 4DFDA 3NVZA 3A2FA 3HRGA 1X3NA 2W3SA 1BDGA 2YHWA 4WQ4A 1SIJA 2A3VA 3CCEN 4J2DA 1FFUA 7ICLA 3T5JA 5MLCQ 1NGCA 1F44A 1TK0A 4C4RA 3MN5A 1ZQXA 7ICQA 1EP4A 4YN4A 2FC0A 4CEEA 1VQ4N 5KG2A 2B0CA 8ICIA 5DLFA 1L7MA 2WBNA 1NGHA 3ZLJA 2YJEA 3V1OA 4JKGA 2E1YA 4RCHA 1Y88A 5T14A 5KFTA 2BE2A 2A1JB 3T5KA 4PHPA 1YXQA 1VSMA 3P83D 3SPZA 1C7YA 2AHOB 5EY4A 5KQDA 3QMLA 2UU9K 4I2JA 2XCAA 3MN7A 2GWJA 4CDGA 1ZQJA 5KRTA 4BR7A 3KK3A 3LALA 4CBXA 3DLLL 4B3MK 4F4XA 4BROA 2C22A 3QIPA 1VQ7N 4QW8A 3PMLA 1S0MA 1TUYA 4FO0A 2R18A 1M6YA 4CF9A 4Y2TA 3LWLA 3I0SA 4W5OA 4CD3A 2K8AA 3DXMA 3ZX3A 4CERA 3ZDDA 3UKRA 4DU1A 2WF7A 2KICA 3ZX0A 9ICFA 3SI6A 4BC3A 2HHHK 4DV0K 4CFDA 4QWCA 1U47A 4JKDA 4EAHD 4EBEA 5JMVA 1TVRA 1KEJA 2H3ZA 1S1TA 3K5NA 3W3DA 1OH8A 4JI7K 5AKHA 5B5EU 4TSXA 5ALRA 3HW8A 2HHUA 3V4IA 1W2BM 2LM4A 2UUBK 3VENA 1BCMA 1D5AA 2CGKA 2BPFA 1WYGA 1ZQQA 1KAYA 4NO7A 3K5OA 2YNFA 4BRDA 4WJ3B 1GLCG 4FM1A 4DSLA 5KPTA 2QA4N 4UB6U 4R8UB 1SGGA 3CC4N 1XSLA 1VSJA 3NHGA 9ICEA 1RXWA 2HOQA 2W9AA 1E3MA 1S9FA 3BQ0A 2NZTA 3MEEA 4NYFA 3BZCA 5EE9A 5KFEA 3F9KA 4FWPA 1VQNN 3O5BA 1DXSA 1UT8A 5KFOA 3SJJA 4HYKA 9ICMA 2YJFA 4CNQA 1BNOA 2EHGA 5E41A 1B43A 4FWNA 5B8HA 4GVEA 2QEXN 1QZ5A 4GVMA 4DL7A 1CI4A 4R79A 4CD1A 2QKQA 2IVOA 1NK0A 4I2DA 1LAWA 3QNOA 4IR1A 4DSJA 1T94A 1U4BA 3EE9A 3VQPA 5IWAK 3FGUA 5ALUA 3QIOA 3N7PD 3V72A 1B0XA 3ED5A 3RF9A 4CJUA 4ELUA 3JPNA 1WCNA 4ISEA 1SV0C 4NWIA 7ICIA 1XNSA 5KG6A 4NLGA 3E0FA 3PR5B 3JAMO 4FZYA 3OGUA 4F2SA 8ICNA 1TK8A 4J9QA 3EN9A 3TANA 3C1ZA 1Z05A 3VTIA 3IAYA 2NRWA 4JI8K 2Q2RA 4NM2A 1XHZA 1LKYB 5D3GA 4RQ4A 1RM6C 4GIBA 1WBBA 1WN7A 2NO5A 1TFRA 3PR4A 7ICSA 3PO5A 1YVUA 2P9IA 1WOQA 2H3FA 3CW2C 3GU3A 4EEYA 4DQPA 2I7NA 4FOEA 3ZT0A 4CE6A 1S0NA 4CF8A 5GADP 1ZQTA 5IIMA 4I6MA 4DR7K 2WB1F 4PL8A 2YMQA 3MEDA 1ZD5A 8ICRA 4NL9C 1L6NA 2ZXHA 2ZIWA 2LYBA 9ICPA 3V9XA 1ZQZA 4UATA 4PJ0U 3VQ4A 2R8GA 2F9WA 4B1ZA 1FJGK 4DV5K 4KTWA 1DK3A 4YOYA 2EX3A 4FWMA 1UT5A 2BPCA 3K75D 2KEYA 2GO7A 4EYIB 1V85A 1QQNA 5DQGA 3VGMA 4KITB 2ASJA 1RTIA 1C0MA 2RE2A 4F4YA 4DL2A 4H0XB 3C1YA 4AHRA 4JKGB 3QUCA 1IXRA 5AK5A 1DEJA 3SAHA 4JHDA 1KD1O 3J7AP 5CEHA 2IOFA 4P4MA 4CJTA 2ZIXB 1IBMK 5AZJA 4LH4A 1SS6A 4FWRA 4IDHA 9ICCA 1IBLK 3AU6A 1XSNA 1LWEA 4K0KK 3CPWM 4XH5A 3QUTA 4F5OA 2NRXA 2UVVA 4O0IA 3V7KA 4K4HA 9ICHA 3ENOA 4BGBA 5IILA 3I1YA 9ICNA 5IIJA 4Y2UA 1Q8KA 2ZWHA 1QQ5A 3H8SA 4PKIA 4M6WB 3TQ1A 2BDPA 4ZTJA 2Y1IA 3SQ4A 3VTHA 3IMXA 3VQ8A 2KKVA 2H3IA 4CW7B 1S10A 3BF3A 2W42A 2UUCK 3MK6A 2RQ5A 3DM2A 2F1HA 4WFNL 1JLGA 3N4QA 2HOFA 4NB4A 1CEZA 2IAJA 5AQIA 1Z6RA 2KD1A 3TAFA 3EPGA 4J9NA 2Q36A 5KT3A 3R1XA 5CE3A 5AQPA 5ALXA 5J0XA 2BKEA 2NRVA 2BANA 4CGZA 4A61A 2E1FA 1S8OA 2W55A 3VQ7A 4IRCA 3D6RA 2XY8A 1BPXA 2W11A 3T79A 4DTRA 2YMLA 1URJA 1TYQA 3QFPA 1ZQNA 4EP4A 4BXOA 1P8ZA 2AGPA 3PVXA 7ICOA 2B5JA 3WKCA 5BRHA 2KG5A 3KHHA 5C15A 4ED0A 2BCVA 5AHXA 7ICVA 1BQNA 3KHYA 1EKEA 5HP4A 4TUQA 1UA0A 2KFZA 2FBXA 2CN1A 4LF9K 2Y0SC 1VK0A 2DFHA 2K8CB 3VGLA 3GG4A 4M3XA 3OHRA 2WOMA 3RH5A 2O8FB 2ZJ5A 4KLQA 1S9EA 1KFSA 4MLEA 4IOAL 3OPXA 1BISA 1QQOA 4B1VA 1LV5A 1WSHA 3QNMA 1HYZA 1RILA 2X6NA 3CJBA 1WCLA 1SV5A 3IG8A 2IOCA 2JRZA 4JI2K 3OYEA 2FMQA 3HM8A 8ICXA 4ED6A 2WUSA 2E1ZA 5JVGL 4EEKA 1KL9A 2W8LA 2KMDA 4O5CA 2HHQA 4FPAA 1RDAA 5L1MA 3C5FA 4CK1A 2DL0A 4C0ZA 3HTVA 3AAPA 3TARA 3QEIA 2EWSA 5JS1A 2ZTDA 2ZTCA 1S76D 2FBYA 2Q0RA 1TGOA 3DYAA 1ZQIA 4RW6A 4CEZA 1CXQA 3GIKA 1NMNA 2KW4A 3VQAA 4WYBA 3NH1A 4FJ5A 4JI0K 3D2QA 2R8HA 4IRDA 4MO5A 4BRQA 4IBNA 4IFVA 3DEEA 3CD6N 3K1RB 2W9MA 3RSEA 5J2GA 3PW2A 2HBJA 1C6VA 1HNWK 4V19S 2VQEK 5D46A 1KSPA 1BIUA 2QTDA 2KHOA 4DMNA 1XS9D 4KPYA 5AQGA 5LL6Z 4CJFA 4F4KA 1YITN 2DGZA 5BPMA 3WK7A 3BS5A 1J54A 4DEZA 4OGEA 4DOCA 2WONA 4JKFA 2ITMA 4CGFA 3HX0A 1JLEA 4ILJA 5LMNK 2D8CA 3N4MB 5EOYA 4RW9A 2EAMA 1RDWX 1ZQYA 5M1NA 3OYIA 3H46O 1UPHA 2KJ5A 4IO9L 2E2OA 2QB1A 3D2EB 3KIOA 1VQPN 4B1UB 1IKVA 4IG3A 1J2MA 3G25A 4CHYA 4UY8O 4ZTFA 1C0TA 3FFIA 2P6RA 4C4TA 5KFCA 4YR0A 3PNCA 5SZTA 1TV6A 4M9JA 4CZJA 2LYAA 1QHAA 1YAGA 3ETLA 1JCEA 4CJEA 5KFXA 3B9JA 2BUPA 2E88A 3T1YK 3QUBA 3HP9A 5HL7L 2UVRA 2P9UA 2FSJA 3AY9A 3WK4A 3N28A 4R64A 4E7HA 3SQ2A 2I5HA 4BWMA 2IBKA 4B08A 3OVNA 1ZQEA 4DSIA 2D0PA 1CZ9A 2Z1GA 3SJHA 1SXDA 3KLHA 1A5XA 4FJ8A 4Q44A 1YJ9N 3QE9Y 8ICKA 2ODGA 2ZUBA 4Z6DA 5KG0A 1MQ2A 4EELA 1JLCA 5AM5A 3OYMA 3BUZB 1HKBA 5K4LA 5TKYA 2PFPA 2E6MA 2BQUA 3BF1A 5HHHA 3H8JA 4HWIA 4LD0A 1YI2N 2WHEA 3VQQA 3CMEN 3KHRA 3DAWA 2GLEA 3O9SA 1WWVA 2ZXIA 1Y97A 2O8BA 3MABA 4AM7A 3F9MA 3SR6A 1TKDA 3Q8LA 4FK4A 1ZXIA 1FFVA 1RBUA 1BWFO 5EE1A 4J9RA 1KQQA 3VEVA 3CQXA 1OH6A 3KHGA 1GLAG 4C1NK 4NM1A 3PX0A 4UB2A 1MA9B 2AXTU 3L6QA 1L7OA 2IGIA 3U26A 4PHEA 3BJYA 3SQIA 4O5FA 1NOYA 3GBTA 2O8BB 3VERA 1FXXA 1JIHA 5E26A 3PMNA 3JXUA 4DL4A 2G8HA 3AQEA 4CJKA 2A42A 4IO8A 1MU2A 1ZBFA 3KWIA 5HP1A 3RBEA 5DB8A 4FYDA 3RBDA 3QICA 5KGWA 1N33K 1GLFO 3ENBA 3O1WA 2F8SA 1ZC6A 4YFUA 5HMLA 3QZ8A 3IHQB 1KBUA 1ASUA 1QQCA 4FW1A 8ICAA 4M3ZA 3KZIU 5J8YA 5A2QO 3WNHA 3T5LA 4OKEA 3F2DA 4GLXA 3RVCA 4DFPA 1SV4A 4G3IA 2DFFA 5DKWA 4QZ8A 4X62K 4E3SA 4OVLA 2PBDA 5FROA 3NVVA 5GINA 5ALMA 4P0PB 4CEOA 1K6YA 1OVYA 1JN3A 3C65A 3AO1A 4H03B 3GQCA 2O4IA 5AM3A 1EWRA 2P9NB 4NCGA 1YT3A 2RKIA 4GV3A 3HILA 5KFKA 1BQMA 3H0LB 4NLCA 1SZPA 3HSTB 1JLQA 5CJ7A 3HVRA 3CFOA 1WSJA 3V7LA 2MSNA 8ICOA 1NGEA 3M8QA 3P5JA 3VN5A 1ZD4A 4FZZA 3VEYA 4KRFA 3UXNA 5TISU 1JI7A 1X2IA 3UPQA 3WK5A 4XQ8A 9ICWA 4BR9A 4PHTX 1RBSA 2Z1HA 4UAYA 2P9NA 3FYHA 1UCVA 4CEQA 2F44A 4ISFA 3TSUA 4QZHA 1N2XA 3C21A 2KSOB 4RQ7A 2UVWA 5KFIA 3D2FA 4K43A 2YHBA 5FPEA 2ZGZA 1YHQN 3PW7A 1U6ZA 3F5TA 5J2CA 1J97A 1VQKN 2PI4A 4O8KA 4BR5A 1N32K 3AVHA 3E9PA 1ZQOA 1IKYA 2KIVA 2ZTEA 4I9LA 4IQTA 1TE2A 4QIWC 1ZQGA 1VRTA 2OCEA 1S3XA 5EWFA 3MR3A 5K14A 4NCAA 1RQLA 4RZRA 9ICXA 4LSNA 4CZLA 3THVA 7ICHA 3SUOA 3KD5E 1HYVA 2QB0B 5CA7A 3ZDAA 5DM7L 4DV7K 1S77D 3FFKB 2PXIA 2XGPA 1RT6A 3KVGA 1HKCA 2ZD1A 2P9UB 3SUPA 2Y1JA 4ECWA 4H0VB 4H5TA 4Y0WA 1JXBA 3I0RA 4M7XA 3THWA 4Y2JA 1ATRA 1ZQKA 3H8WA 3IKMA 1VHXA 1QSSA 1OH5A 1NNEA 3O3HA 3O3GA 5HHIA 4R5PA 4GKKK 1JCGA 4FE3A 3PSPA 3VF4A 2PY5A 5AQNA 4W5RA 1XQSC 1U9LA 3G6EN 4CHNA 5FPMA 1Z19A 5M1FA 3F73A 3UB5A 4KI6A 2EZYA 4BE2A 4KHYA 4DU4A 5L9XA 3OYGA 3SENA 3KKRA 4OGCA 2KHQA 5AQKA 4LFCK 4RQ1A 3DLEA 4Y2RA 4KTQA 3F53A 3N4PA 5E79U 4EZ6A 4O3NA 5IIKA 2Z1IA 2FI1A 5D49A 4PZNA 3Q8RB 1NGDA 4WCEL 4JS4A 3OJSA 4OPAA 1N5XA 3ORYA 5DLGA 2GWKA 1OVQA 3VPZA 4J9MA 4TUSA 1K73O 2MRLA 2I5JA 3BZKA 3SEIA 4CIEA 1KN5A 1OKJA 3CM6A 4KMUA 5EWEA 3HVTA 3Q8QB 4B3OA 4A59A 3VEZA 4O3QA 3GV5B 4M6WA 3THXA 1ASWA 3AAQA 4DV2K 2DQNB 1BI4A 3OTQA 8ICTA 4O4GA 5AM1A 2PI5A 2VGNA 4MFFA 5DBBA 3PX4A 4CJ5A 2HVIA 3CI5A 1NZPA 4O3OA 3ZSXA 3VQCA 2O8CA 4FZNA 5CWRA 4YQWA 4UB5A 1JJ2M 1ITGA 4Y2SA 2RHKA 3QU2A 5J2IA 2ESEA 4NV0A 3V9ZA 3I8BA 3O0FA 1NJXA 4Z4CA 3TAEA 1ZQRA 3FZHA 4IOXA 4CFCA 1RT7A 4QZFA 5J0WA 1HNVA 2HNYA 3ISNC 3KKAA 1BIZA 3MAQA 1U2VA 4NXNK 1K1QA 3ATVA 4NXMK 3M6GA 3NRWA 4QZAA 1IG8A 2W6KA 3AVLA 1HNXK 4BY9C 3SQ1A 5I3UA 5ALJA 3G71N 3V6HA 1F0MA 1MQ3A 4Y2XA 3QEXA 2GWSA 4CVNE 4PH5A 4DHYA 5SWMA 4ECQA 2A1RA 3G0ZA 1N8RO 2G8UA 2OA8A 4X64K 4FJHA 1X9WA 4RUAA 5J0QA 1D9DA 4F71A 2P9LB 3UE5A 2FSKA 3H4BA 1ZQCA 3KWGA 1XO0A 4HCCA 4LC9B 2JLEA 3KOOA 1NKBA 2A3ZA 2IVPA 4JV0A 2P6UA 5AM2A 3CPEA 4JEPA 1NMDA 4Z6EA 4UB1A 2RP5A 3JPQA 4UASA 3ZSOA 8ICUA 5GTIU 1RDUA 4M3RA 4UB4A 3C6AA 3L2WA 2KV2A 5CB1A 3GIMA 4DFKA 1S1UA 4RQ2A 4RW7A 4ECVA 2ZJQL 3V6DA 4QOZB 2ITGA 3SK3A 2P9LA 2ASPA 4KBOA 3AGKA 4KHWA 5AKKA 1F21A 4TUPA 1ZQSA 5KPZA 1REVA 3WXJA 3UQ2A 2ZIWB 4B1YB 4FOIA 4UW9A 4CF3A 2PYJA 1XC3A 3LAKA 2F9TA 4AQYK 1A77A 5EU7A 4MFCA 2JV3A 1NJIO 5AQSA 2K8BB 1ZD2P 2E2QA 3FZFA 4MLHA 1NK6A 2MA1A 1C0GA 4KLHA 1MN8A 1LW2A 4IRKA 4M9GA 4LF7K 1YVNA 4BRHA 4GKJK 4B9NA 3EO3A 3VEXA 7ICEA 2BCSA 4EBDA 4KREA 1YZ7A 1BPDA 4I2PA 3UM9A 4GC6A 1FEZA 4G9ZA 3C29A 4W5QA 3QU5A 3QX7A 5J29A 4MF8A 4LF6K 1WUAA 4IG0A 2O6KA 1B9FA 1TKZA 3EZWA 3AA5X 3NE6A 2KK0A 4J9OA 3DMJA 4N47A 2AJQA 2BTFA 2A5XA 4JK7A 3GILA 1U04A 1T8EA 2BCQA 3ZT2A 3BQ2A 5EVZA 3NH0A 1NK5A 3RJGA 5F3XB 1AROP 4JI6K 3VA3A 2DY4A 3C28A 2IOHA 3OY9A 4Y2PA 4KN4A 2VCPA 4OJ5A 3DOLA 2Z7JA 3QB0A 2OHFA 3R3LA 3U4LA 4CFAA 4CIGA 4QWBA 1VSKA 1XO1A 3B0YA 3L2UA 3S3OA 4B3TK 1QZ6A 5BOLA 1NGFA 3O1BA 3B6OA 5AQZA 3SV4A 4KAZA 1TAMA 4ECRA 3H4DA 2VG6A 2G0AA 4BVPA 4E1MA 1V38A 4MO4A 3KK1A 4IQUA 3K59A 1Q82O 4DL3A 1IG9A 2G06A 3RJHA 2K4EA 4H0TB 1JLAA 2F77X 5AI5A 3J81O 4US8A 3L4PA 3IFRA 4JN4A 5KG7A 3DXMB 1PUZA 2JH1A 1EETA 4K25A 2FBVA 5KFGA 3KD1E 1KVAA 2G08A 5ALOA 1ZBSA 3OBWA 5F1XA 1XMOK 2YHXA 3H1QA 4FS1A 3AL0B 2HHSA 3B8AX 3F5EA 4KH4A 4QW9A 1K1SA 1Z26A 3CJCA 3BS5B 3NF9A 1TKTA 4RQNA 1C1CA 1HEKA 4JWMA 9ICIA 1NGJA 1T3QA 2P9KB 2VGMA 2B21A 4BG9A 3K58A 3CCVN 4ZH4A 2ZIUA 2VYPA 3L2QA 1QVGM 4PL2A 4BRNA 3AEVA 2EAPA 4FLYA 3KLEA 2IC3A 1GLBG 1XWLA 5FPDA 7ICMA 1RPLA 3RR8A 2E4LA 4CEBA 4E19A 3CQ8A 3M8RA 3H45C 4KFBA 5C25A 5C0YA 2P1JA 3A0BU 3EY1A 3LDQA 5AJ3K 4CZGA 1ZBUA 4QS7A 4OX9K 4ILHA 4QZGA 1RDDA 1COKA 3TTDA 1TAQA 4QAGA 2P9IB 4KLEA 3U6FA 2KP7A 1ILYA 1C0UA 2D1KA 1N6QA 5LMUK 4CRXA 2ASOA 3SNNA 3L3FX 1EXQA 3AVBA 3CCUN 2QWQA 2KN7A 4CF1A 3A5LC 1HIWA 2V4RA 3THYB 2FMSA 2QW9A 3UXPA 4YMOA 3LZJA 1MC8A 1KC8O 3PW4A 4JK8A 3TPQA 4DTNA 4F93B 3M9NB 2X6SA 4B3RK 1LAVA 1PVRA 1WSFA 3LPTA 4KH5A 3L4IA 1JXEA 1MWKA 8ICJA 2YB4A 5BPCA 2KQ2A 4CF5A 4H0YB 1JL1A 4QJFB 1CZBA 3M9OB 4QNLA 4LZGA 3THYA 5L1IA 5AZIA 3ZT3A 2O8FA 2H3QA 4BR4A 2VG5A 5KL1B 2J4RA 1L3VA 1OUQA 4DR1K 2OH2A 2E8OA 4Z4HA 1Q18A 4M04A 1HKGA 5AI6A 2MU2A 3SMSA 1FO4A 4YOUA 3C7NA 4GV9A 5TZVA 4ECZA 2FLNA 3R9KA 4C8KA 5EXWA 4H0OA 5HRSA 4FK0A 1JALA 1U45A 3H0MB 3VCBA 4BE1A 1SWVA 1RTHA 5AI8A 2AP1A 4Z4FA 1HQUA 4DR4K 2XHBA 4CE9A 2F7TA 3WXKA 4FLWA 1VQMN 1KFDA 1JLFA 3WXIA 1VLBA 1RYSA 3HI0A 4KV8A 3LDAA 2R8JA 4DR5K 2JZBB 1QTMA 1QQ7A 1KVBA 4ID5A 1X1PA 2CPRA 5BPLA 4ED8A 4DFMA 3OYBA 3PW5A 1LOTB 3ZSQA 3GDQA 3OJUA 2W40A 4ECUA 5AR0A 3LDSA 1S6PA 4RQ8A 4MQ3A 4N5SA 3MN9A 2F4VK 3JSMA 4Y2VA 3AV9A 4DR2K 5J2BA 2KE7A 4GXKA 2AGQA 1ATNA 3DDHA 4DCCA 1N36K 4UBBA 2VWJA 2BH1A 4MDAA 1RTDA 3ZT1A 1LVHA 4J03A 1V9PA 1RG6A 3HKZC 4AYBC 1BPYA 2KJ9A 4JKHA 4CJVA 3KKAC 5KFFA 5J2FA 4XA5A 3NMUA 4FWSA 3AM9A 2NUBA 1WUDA 5J2JA 3WKEA 4YVZA 5DGBA 1WSIA 3C5GA 3VF6A 4BDPA 1BPBA 4OJPA 3VEOA 8ICVA 1CZAN 5AQTA 2C2RA 2ASDA 3NF6A 4UB3A 4K41A 1GLJO 4BGDA 9ICTA 4KTZA 4JD2B 5DG9A 4BREA 2EANA 3C6HA 4Y2QA 4B8AB 4OCZA 4NLNA 3FLCO 1J5OA 1K5OA 4DLEA 3J7ZO 5AKJA 1NK9A 4YD2A 4BDZA 4DR6K 2D4WA 5J2QA 2RLTA 1NK7A 4DQ8A 3GIIA 3CCJN 4Z6CA 1R59O 5AQFA 2QM1A 3LDPA 3QXGA 2F1IA 2D6FC 3U3GA 1N34K 4KLDA 5FP0A 2F96A 2H5XA 2JH7A 3WK8A 5KT6A 4LY7A 2E20A 3LP2A 4FWKA 2ZG6A 3RMDA 4PWDA 2B6GA 4I2BA 5ADXH 5JLHA 5JU5A 2DBYA 3LK9A 1HX1A 3M7DA 2LM1A 2JMGA 4CF2A 4C8MA 1ASVA 3ZSYA 3NASA 2GTDA 5KPRA 3IRUA 3LP3A 1SL0A 4BG8A 1Q7YO 2XICA 4B9LA 5AQUA 2OYYA 4YXMA 4ECXA 3MXJA 1MSWD 2YB1A 2WF9A 4OJRA 3OYKA 1BO5O 3KTQA 2W7PA 1VSHA 5KQ8A 4FWQA 4UAUA 3NVKA 3O4WA 3DV9A 1DLOA 2C2EA 3AQFA 3RSEB 1X9SA 2HOIA 1H38A 4F50A 1RXVA 3ZSVA 3PLAA 3OHAA 1C1BA 2E8AA 2A1AA 3RB3A 2IMWP 3W0LA 4KB0A 5B66U 3NH2A 2FLOA 3SV3A 4RU9A 3QETA 3ZYYX 4KN7A 3RJJA 4KHUA 1DTQA 4F8RA 1J5EK 4YG2A 2KZZA 4DUYK 2G09A 2QWRA 4FL9A 1VQ9N 4P0QB 5FRMA 3FM9A 1QSLA 4FJ9A 3B0XA 3Q8MA 4C8OA 3GOIA 4QS9A 2HW3A 1O08A 3RB4A 3IS9A 3HKZF 4AYBF 4DTSA 3ENHA 5AQMA 8ICFA 2W43A 1NJZA 4QZCA 1MWMA 1KQSM 4BR2A 5LJVA 5DGAA 1C20A 2VANA 3DLKA 1S22A 4O8UA 3WUHA 2DWQA 4ID1A 2KSOA 4Z6FA 4DUZK 1Z4OA 4KLLA 2P5OA 2R8IA 4OJLA 8ICZA 1NU0A 3KLIA 3KK2A 4BDYA 3CC7N 2LBOA 4F5QA 3CCSN 4PA1A 1XHXA 4K8XA 9ICKA 3ID8A 2PFNA 5J2MA 4EBCA 4ED1A 2OM6A 3I8DA 2IVNA 1XUPO 1IV0A 5AQOA 1VSIA 4BGAA 1N61A 2KIWA 5BR9A 3V9SA 3HJEA 3E01A 1IKWA 3Q8SB 1Q3VA 3L3VA 2FBTA 1SKSA 3HPGA 1ZBIA 1HNIA 2I9GA 1NI3A 4B9MA 5AKZA 3QZ7A 2OTLN 1OW5A 3BY5A 2FE9A 4BXOB 3V7JA 1CXUA 3B6PA 2OZSA 2VA8A 2KKZA 1A0PA 4LSLA 3TWHA 4BRAA 4NXZA 1G99A 1L3TA 3GE1A 4UAVA 1HJRA 3U8XA 4HTUA 3GV8B 3AUOA 5KG5A 1P90A 4MF2A 1WAFA 3H8MA 3E9OA 2RHFA 3VQ6A 1EX4A 4YDUC 3C2KA 2WTFA 3T19A 2B4JA 3WNGA 5DB9A 4DFJA 3ZT4A 3BQ7A 4BC4A 3NGZA
chains in the Genus database with same CATH topology
4DQQA 3EKSA 4I6MB 1YF5L 4EFHA 3SYZA 2AA4A 2W9BB 8ICMA 4RTFD 4Z94A 3JPPA 1N56A 3A5NC 4RT2A 4NY8A 5J0RA 1TYQB 1ZJMA 5KFJA 1D8LA 2HBLA 3JPOA 4JAXA 1BVSA 1YJWN 4B9VA 4O3PA 1NGBA 4R63A 1E4FT 4FBUA 3ZDBA 4YOVA 3Q7CA 9ICRA 2PFQA 1TK5A 4PKHA 2E2NA 2FXUA 4FPBA 4M47A 3ZDCA 5KFBA 5C2FA 4QZ9A 3GV7B 3D2EA 3I33A 1KLNA 4IZ9A 1ZQDA 2KZ3A 2QWPA 1K8KB 3SLCA 2C2DA 3IUCA 1SZ2A 2HF3A 3QBWA 2QWLA 1ZQMA 3BDPA 4BRGA 4IR9A 4Q45A 3CF5L 4F92B 2HVHA 3Q8KA 5GIPA 3RJEA 5AFUH 1ATSA 5AQXA 5KFYA 3UKRB 1S97A 9ICAA 1DGKN 5AZJB 4NLKA 4Q8FA 4Q8EA 1ZETA 3H3NO 5DQHA 1V4TA 1KTQA 3SBGA 2KFNA 4FWLA 5GIOA 4JKEA 5BPNA 4JUZA 3RH4A 2HSTA 2GELA 4M63C 1NWKA 3HBTA 1K8AO 1Z00A 2A40A 5KT4A 2ZJRL 4YMMA 4HTLA 5AQYA 2D0OA 2IHMA 2BHNA 3M8SA 4CZFA 4BC5A 7ICNA 4QWDA 2P66A 2XCPA 5DB7A 4ED7A 3PX6A 5BN9A 1NJYA 3CHWA 4JNEA 4YR3A 3MR5A 4R65A 5J0UA 1GLDG 3EYZA 4JD2A 5ELZA 4DO9A 2ALZA 2QWNA 3UKUB 4K4IA 4CZEA 3I55N 2NRTA 1XC9A 2A6AA 4CJ7A 3LDNA 2JEIA 9ICVA 4DLGA 2CH6A 2VA3A 1M90O 1TAUA 4JK1A 1VQ5N 3M5RA 4J8FA 2NNWA 1K8KA 1EXNA 4DWIA 2XY7A 4OPHA 4H5VA 3QEAZ 1ZYQA 5F2RA 9ICJA 5D4BA 2P9SA 1B22A 3RJIA 3RJFA 2DPNA 4KLGA 8ICYA 3ZETA 4FBTA 2IHNA 5CHIA 1NGAA 4IJNA 3T7ZA 4RUCA 4M2YA 4MEYA 3MGHA 3MR6A 4I2HA 4H5WA 1VQON 2XGQA 3ZEUA 4TQRA 4LZDA 3C7NB 1L3SA 1RYRA 3CIPA 9ICQA 7ICKA 3OA9A 3LWMA 1BA1A 4B9QA 4GXIA 3PIPL 1EO1A 1KFTA 4DS4A 3FZKA 3HOSA 5DDYA 5CR4A 1KXPA 4CZIA 1YUWA 4RNMA 4DB3A 2QWOA 2FPLA 1QVFM 4F5RA 3FZMA 3HWTA 2ATLA 5J0YA 3VEWA 7ICUA 3MMVA 1BUPA 3RB6A 4RPYA 1DOQA 4F5PA 4QZEA 5AQWA 2HHVA 4GC7A 1BA0A 1JCFA 4KLMA 5KFMA 1BOTO 3M3ZA 5EX5A 4I27A 2R8KA 3PO4A 3C23A 5H1SQ 2CH5A 3O80A 3TAQA 2BR0A 1L5UA 4PKGA 3CCLN 9ICLA 4EIAA 3J8AA 2J6SA 1NKEA 4BWJA 1KAXA 3LDOA 3SI8A 4O5EA 2CGLA 1NK8A 3F2KA 2AU0A 3OSPA 3FE1A 3QBXA 3ZD9A 3TI0A 4OO1J 2P9SB 5AFUA 2W9CB 2ZJ8A 8ICGA 3T3FA 4I2FA 5HNKA 1NOMA 4ED2A 4FS2A 3C0BA 4I28A 2HF4A 3MDQA 8ICWA 3ISCA 7ICTA 3H1VX 4JK9A 3HT3A 3TSQA 2XY5A 2FSNA 4MFAA 3TSPA 4WQ5A 2BCRA 5KTQA 8ICLA 1VAZA 2UVUA 4M9HA 1JMSA 4BRCA 3E9LA 1HUZA 1SL1A 4RWTA 1U2VB 5DM6L 5KFHA 5KFQA 3RB0A 3AARA 4UQGA 2I7PA 2FLPA 2CGJA 3G4SN 2V52B 3VMFB 3GDXA 3P39A 2H3GX 4BRFA 3U9ZA 1YIJN 4ED3A 2HHTA 3CERA 3MCAB 2W8KA 1SL2A 2WC9A 2JWLA 1X9JA 3CETA 3GIJA 3TTCA 5DB6A 3CMAN 4BVOA 3O8MA 3SZ2A 4RNOA 4PL7A 2YX6A 2GUPA 4BR0A 4L3QA 3M1FA 5J0TA 2ZJAA 4ECSA 2A41A 3OSNA 4XH1A 1ZQUA 1TV9A 5M1PA 4UAZA 2BCUA 2BQ3A 3M9MB 5GAHP 2HHXA 4WQ4C 2E2PA 4KLOA 1TVAA 3P38A 5EWGA 3L4QA 4I2IA 5KFRA 2BGWA 3T69A 1SKRA 3JPTA 4A62A 3IM1A 9ICSA 5DDMA 3AGRA 4FWOA 5J2KA 3K4GA 4ELVA 2YI1A 4K4GA 1ZXOA 4M9LA 3WXLA 3CC2N 1EQYA 4O3SA 3O9TA 4BRMA 3A8YA 4KLUA 3TFSA 1ZQBA 4EHTA 3EPIA 2DPIA 5C2DA 4X5VA 5E84A 4KLJA 2PFUA 4TURA 3UKUA 3WXMB 4CI6A 3T5HA 3PV8A 1NM1A 3UXOA 3LL3A 1ZQPA 4DF8A 2JEJA 1GLLO 3NTUA 4C8NA 5KT7A 5JUMA 5BRDA 1ESVA 5F0XA 2JEGA 4RQ5A 3EKUA 4CBUA 5L1LA 5AQQA 4A5BA 5F9NA 3Q8PB 5EOZA 4IEEA 1S72N 4JKBA 3CJ7A 2YHYA 8ICCA 1K9MO 2MUTB 3SMPA 1ZQLA 1COOA 4I2GA 4RPZA 4PGXA 4P2HA 3P4IA 3O6WA 5J0PA 8ICHA 3CQYA 3BEXA 1O13A 3KZBA 4PGYA 3VOVA 3O9UA 2Q0ZX 3ZX2A 3ULEA 3SAFA 4A2AA 4BQZA 1XU4A 8ICBA 5IIIA 4ILGB 2QWMA 4QS8A 3RAXA 5BREA 2F1JA 3HZ6A 3HP6A 1HLUA 1KAZA 2Q31A 1Q81O 3H40A 5DBAA 8ICSA 4IEIA 1L3UA 2FF6A 5C5JA 1T44A 4O5KA 4JKCA 4XH4A 3GFKB 5KFZA 3KK7A 3SAGA 4B9TA 5KG1A 1XSPA 4JV2A 2P9PB 1T4GA 4XUSA 1T7PA 3IDHA 3GL1A 1QSYA 4PPXA 5JICA 8ICQA 3G6YA 1S0VA 4DSFA 3MX2A 3WQUA 4QWEA 5M1QA 2W41A 2HHWA 3CJAA 4A57A 4JWNA 4QZIA 3TTFA 4J9PA 1X3MA 2WFBA 4RNNA 3TAPA 4E0DA 4U67L 2I1QA 2BPGA 3SBTA 2FLLA 1D4XA 4DKWA 4EHUA 4BRKA 3ZEUB 4I2AA 7ICGA 2MUTA 3U9DA 3CCRN 2V4QA 3OW2M 3AU2A 3DXKA 1ZQVA 3R8EA 4B9UA 5CP2A 4KLFA 3K9JA 2UYTA 4A5AA 3MFIA 4H5RA 1RZTA 2Q1NA 4DL5A 4FVUA 5KFPA 3I56N 4YOWA 5J2DA 3C2MA 1KRPA 2NRRA 2AQ4A 3P31A 2PFOA 4A2BA 1Q86O 2KZMA 1HUOA 1GLEG 4DSKA 4DF4A 3RTVA 2DFLA 3K9KA 5DBCA 5GAGP 3A5MC 2HMPA 4B1XB 5KFLA 4CCHA 3WT0A 1N48A 1D9FA 5L1KA 3RH6A 3V6KA 4O3RA 5CHGA 3EW9A 5KFWA 2FMPA 1HJPA 4EYHB 3BP8A 3DJCA 4WFBL 3OBYA 2LYHA 3N97B 3WQTA 1UA1A 4YDUA 2IIRA 3QDKA 3BQ1A 3FZLA 2M9NA 5KFDA 5AZIB 3CCQN 3E2EA 4F9OA 4CZMA 5IINA 4ECYA 4DSEA 5LY3A 2HOEA 1IJJA 1NBWA 3DWLA 3PIOL 5IIOA 1NLVA 1SKWA 3HOTA 5KT5A 2HBMA 2P9PA 5AQLA 1DT9A 3QFUA 4DOBA 1DGSA 1NGGA 4ISGA 4E1JA 4CZKA 4IOCL 2QI2A 3L0QA 5JVHL 1T3NA 3D7EO 3CCMN 4GXJA 2NRHA 4NLBA 3O9QA 5BRFA 1SQKA 5C12A 2ISOA 4QZBA 2GX9A 2FPKA 5KG3A 4F91B 1QLNA 1VQ8N 3RAQA 1Z3EB 3MR2A 3Q7BA 2YCHA 3H6EA 4KLSA 4GV6A 4AF1A 5M1KA 4J9KA 1A76A 4RPXA 2JEFA 5DQIA 3RJKA 4JHDB 4DQIA 4FSVA 5GAEP 5J0SA 2Q0UA 1QQMA 4Q43A 4I2CA 3CJ1A 4P4PA 2DPJA 4BRIA 1MDUB 4C1NI 5KFVA 7ICRA 1M1KO 4ECTA 5KFSA 5HOOA 3HSCA 1SAZA 4YD1A 5AQVA 1U48A 1U49A 9ICBA 2HBKA 4YFKA 2FPMA 4YR2A 5BN8A 3FDSA 5HMMA 4M7YA 7ICFA 1T6DA 5LJWA 2ZUCA 5L1JA 2W9BA 4PGQA 4J9SA 4NLZA 9ICUA 3V6JA 1BU6O 3EL2A 4WFAL 3NVMA 3LDLA 7ICJA 3ATUA 3D2FB 4H0PA 3EE8A 3TFRA 3PY8A 1Y64A 2ISPA 1RFQA 5KFNA 4YOXA 5DG7A 1H1VA 1Z00B 1DKGD 3MCPA 3MWTA 5KT2A 1JXLA 5AQRA 1VQ6N 4RQ0A 1W97L 4WF9L 3VGKA 4MEXA 2ZF5O 3H3OB 3G6VA 4I2EA 5I9EB 2KTQA 1HPMA 1T6CA 4IQVA 3E1YA 4DOAA 1S0OA 3ZD8A 2XY6A 1TUUA 5DG8A 2ZGYA 4BRPA 3EZ5A 4KLIA 3CXCM 2ASLA 4RT3A 2J6TA 5J2AA 2OTJN 4R66A 4F4ZA 1C0FA 5BOMA 2AQ0A 1VQLN 1HJOA 4F5NA 4IJAA 3O08A 2W9CA 3ISDA 2V7YA 4B1WB 1BPEA 5KFUA 1ZQAA 2NLXA 4RQ6A 3ZDEA 2A1JA 3MFHA 4R8UA 2OWOA 1ZQWA 1RGIA 5M1OA 1JX4A 1CUKA 4CBWA 3E66A 2Q97A 3LM2A 1PZNA 3MX5A 4PHDA 3S41A 4YMNA 3BQTA 3MDAA 4UAWA 5ADXA 1D8YA 1ZQFA 4I29A 2JZBA 4IFEA 4YCXA 4C23A 7ICPA 3C2LA 4B9SA 4O9MA 2AGOA 3RRGA 3MGIA 4LVSA 9ICGA 4IXCA 4M9NA 4XEIA 3HPOA 3A0IX 5J0OA 4M0AA 3EWAA 2FF3B 4EZ9A 3O9RA 2V7ZA 3VETA 2IA6A 3ULEB 3LM9A 3VESA 4PHAA 2V9WA 4GNIA 2PAVA 4YXJA 4P4OA 3RR7A 3WEEB 5JLFA 4CZHA 4C8LA 2VWBA 3A5OC 3MBYA 4KLTA 4IQWA 3NGDA 5F9LA 4TQSA 4BC2A 2VA2A 4MDBA 1KDHA 1ZQHA 5KG4A 4F4WA 2KLAA 1NK4A 3ZETB 3MDCA 2XO7A 2RDIA 3TU5A 3KHLA 5TKWA 4F3OA 5C10A 4DQRA 1E4GT 2JWKA 1LCUA 1YJNN 4F2RA 2ZUDA 1BPZA 2V51B 2XC9A 4YOTA 1HUXA 2QXLA 5J2EA 4QWAA 3CJ9A 5J2HA 1IM4A 2C28A 4H5NA 1NJWA 4QZDA 3FR0A 4WQ5C 1BGXT 4JKAA 4BQLA 4DCHA 4DS5A 2ASMA 4XRHA 2NRZA 3ISBA 8ICEA 4ELTA 3JS6A 1X9MA 3MWPA 2P9KA 3ID6A 3RRHA 2J6UA 2GEMA 1BG3A 4K42A 3QEBZ 1V4SA 5AQHA 8ICPA 1J6ZA 2OANA 4RQ3A 1T3VA 9ICOA 3H7IA 3VF2A 3R6MA 4YP3A 4DL6A 3DXKB 4U7BA 5FPNA 2ZJPL 1NKCA 3JPSA 4YORA 4GY2B 4FO6A 4JV1A 4UBCA 1LB2B 2RDJA 3PW0A 2MAXA 4J9LA 1NGIA 5CR0A 4KH6A 2BQRA 5KFAA 3WEEA 3OHBA 3UQ0A 3G6XA 3MN6A 4DQSA 1ZJNA 4BRLA 4AM6A 3JPRA 5AQJA 4IWVA 3HRGA 1X3NA 1BDGA 2YHWA 4WQ4A 3CCEN 7ICLA 3T5JA 5MLCQ 1NGCA 1TK0A 3MN5A 1ZQXA 7ICQA 1VQ4N 4YN4A 5KG2A 8ICIA 5DLFA 2WBNA 1NGHA 2YJEA 4JKGA 2E1YA 4RCHA 1Y88A 5KFTA 2A1JB 3T5KA 4PHPA 1YXQA 1C7YA 5EY4A 5KQDA 3QMLA 4I2JA 2XCAA 3MN7A 2GWJA 1ZQJA 4BR7A 3DLLL 4CBXA 4F4XA 4BROA 2C22A 1VQ7N 4QW8A 3PMLA 1S0MA 1TUYA 4FO0A 3LWLA 4CD3A 3DXMA 3ZX3A 3ZDDA 3UKRA 3ZX0A 9ICFA 4BC3A 4QWCA 1U47A 4JKDA 4EAHD 4EBEA 5JMVA 1KEJA 3W3DA 3HW8A 2HHUA 1W2BM 3VENA 2CGKA 2BPFA 1ZQQA 1KAYA 4NO7A 4BRDA 1GLCG 4DSLA 5KPTA 2QA4N 4R8UB 3CC4N 1XSLA 9ICEA 1RXWA 2W9AA 1S9FA 3BQ0A 2NZTA 5KFEA 4FWPA 1VQNN 3O5BA 1UT8A 5KFOA 4HYKA 9ICMA 2YJFA 1B43A 4FWNA 5B8HA 4GVEA 2QEXN 1QZ5A 4DL7A 4R79A 4CD1A 2IVOA 1NK0A 4I2DA 4IR1A 4DSJA 1U4BA 3EE9A 3FGUA 3V72A 4ELUA 3JPNA 1WCNA 4ISEA 7ICIA 5KG6A 4NLGA 3PR5B 3OGUA 4F2SA 8ICNA 1TK8A 4J9QA 3EN9A 3TANA 3C1ZA 1Z05A 3VTIA 2NRWA 2Q2RA 4NM2A 4RQ4A 1TFRA 3PR4A 7ICSA 3PO5A 2P9IA 1WOQA 4FOEA 4EEYA 4DQPA 2I7NA 1S0NA 5GADP 1ZQTA 5IIMA 4I6MA 4PL8A 8ICRA 9ICPA 1ZQZA 2R8GA 2F9WA 4B1ZA 4YOYA 4FWMA 1UT5A 2BPCA 3K75D 4EYIB 1QQNA 5DQGA 3VGMA 4KITB 2ASJA 2RE2A 4F4YA 4DL2A 4H0XB 3C1YA 4JKGB 1IXRA 1DEJA 4JHDA 3SAHA 1KD1O 4P4MA 5AZJA 1SS6A 4FWRA 4IDHA 9ICCA 3AU6A 1XSNA 3CPWM 4XH5A 4F5OA 2NRXA 2UVVA 4O0IA 3V7KA 4K4HA 9ICHA 3ENOA 4BGBA 5IILA 9ICNA 5IIJA 2ZWHA 3H8SA 4PKIA 4M6WB 3TQ1A 2BDPA 2Y1IA 3VTHA 3IMXA 1S10A 3BF3A 3MK6A 2F1HA 4WFNL 3N4QA 4NB4A 1CEZA 5AQIA 1Z6RA 3EPGA 4J9NA 2Q36A 5KT3A 3R1XA 5CE3A 5AQPA 5J0XA 2BKEA 2NRVA 4A61A 4IRCA 3D6RA 1BPXA 3QFPA 1TYQA 1ZQNA 4BXOA 1P8ZA 2AGPA 3PVXA 7ICOA 5BRHA 3KHHA 5C15A 4ED0A 2BCVA 7ICVA 3KHYA 5HP4A 4TUQA 1UA0A 2KFZA 3VGLA 3GG4A 3OHRA 3RH5A 2ZJ5A 4KLQA 1KFSA 4MLEA 4IOAL 1QQOA 4B1VA 1LV5A 3CJBA 1WCLA 2FMQA 3HM8A 8ICXA 4ED6A 2WUSA 2E1ZA 5JVGL 2W8LA 4O5CA 2HHQA 4FPAA 3C5FA 3HTVA 3AAPA 3TARA 2EWSA 2ZTDA 2ZTCA 1S76D 2Q0RA 1ZQIA 3GIKA 4WYBA 2R8HA 4IRDA 4MO5A 4BRQA 3CD6N 2W9MA 3RSEA 5J2GA 3PW2A 2HBJA 5D46A 1KSPA 2QTDA 2KHOA 1XS9D 5AQGA 4F4KA 1YITN 5BPMA 4DEZA 4DOCA 4JKFA 2ITMA 3HX0A 4ILJA 3N4MB 5EOYA 1RDWX 1ZQYA 5M1NA 3H46O 4IO9L 2E2OA 3D2EB 1VQPN 4B1UB 3G25A 4UY8O 2P6RA 5KFCA 4YR0A 3PNCA 4M9JA 4CZJA 1QHAA 1YAGA 3ETLA 1JCEA 5KFXA 2BUPA 2E88A 5HL7L 2UVRA 2P9UA 2FSJA 3AY9A 4R64A 4BWMA 2IBKA 1ZQEA 4DSIA 2D0PA 3SJHA 4Q44A 1YJ9N 3QE9Y 8ICKA 2ZUBA 4Z6DA 5KG0A 1MQ2A 3BUZB 1HKBA 5TKYA 2PFPA 2BQUA 3BF1A 5HHHA 3H8JA 4HWIA 1YI2N 3CMEN 3KHRA 3DAWA 3O9SA 3MABA 4AM7A 3F9MA 1TKDA 3Q8LA 1BWFO 4J9RA 3VEVA 3CQXA 3KHGA 1GLAG 4C1NK 4NM1A 3PX0A 4UB2A 1MA9B 3L6QA 4PHEA 3BJYA 4O5FA 3GBTA 3VERA 1JIHA 5E26A 3PMNA 3JXUA 4DL4A 2A42A 4IO8A 3KWIA 3RBEA 5DB8A 3RBDA 3QICA 1GLFO 3ENBA 3O1WA 1ZC6A 5HMLA 3QZ8A 3IHQB 8ICAA 3T5LA 4GLXA 3RVCA 4DFPA 4G3IA 5DKWA 4QZ8A 2PBDA 5GINA 1OVYA 1JN3A 3C65A 4H03B 3GQCA 2P9NB 4GV3A 5KFKA 4NLCA 1SZPA 5CJ7A 3V7LA 8ICOA 1NGEA 3VEYA 3UXNA 1X2IA 3UPQA 4XQ8A 9ICWA 4BR9A 4PHTX 4UAYA 2P9NA 3FYHA 4ISFA<