2NRWA

Crystal structure of the c terminal half of uvrc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
217
structure length
204
Chain Sequence
b'GLRKEALEELMKLLNMKDFPYRIEGIDISHTVASLVVFEDGFPKKGDYRRYKIEQDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 63
structure length 204
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrwA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrwA01
5J2BA 4Z6CA 3MR3A 2DFLA 4M04A 1HJPA 1ZQEA 4ED6A 4RUAA 5KFUA 4J9LA 4FS2A 4J9OA 1NKEA 4UB3A 7ICJA 1X9SA 3H4DA 2BQRA 1ZQFA 4EBCA 7ICNA 5CB1A 4ED7A 2PXIA 9ICOA 4Z6FA 4RQ6A 5J2KA 4C8LA 1UT5A 4IRCA 4FBUA 3PNCA 4YG2A 2F1HA 5J2CA 1N48A 5CR0A 2XGQA 4B9VA 4B9TA 7ICKA 5KFSA 1UT8A 1UA0A 1RYSA 5KFXA 4F92B 1ZJMA 4IQVA 2BQ3A 4KN7A 1NK0A 2W9MA 2RDJA 3NTUA 8ICZA 3M8RA 5KG6A 3PR5B 4R64A 1MC8A 5DQIA 3C21A 4DOBA 5KFOA 2BGWA 4B9MA 3GV8B 4KLIA 2W9BA 3C23A 4TQSA 2AGOA 1XWLA 5HMMA 2ASDA 4F50A 4DL4A 2R8GA 2J6UA 5J0UA 4O3RA 2R8KA 7ICHA 4EEYA 2JEIA 3RH5A 4DLGA 4QW8A 4BDPA 4UAZA 7ICEA 1JN3A 3ZDEA 4RNOA 2VA3A 1NK7A 1ZQVA 4QZ9A 2HW3A 4BWMA 2PI4A 4KLUA 7ICIA 4RQ2A 2ISOA 2IHMA 5CWRA 4B9LA 4PGYA 5CHGA 4J9NA 2BKEA 5J2HA 2C28A 3EW9A 3H40A 4O3SA 4KLMA 4I2FA 3LWLA 4DQRA 2JEFA 3V6HA 9ICEA 1KSPA 5J0QA 2DPIA 9ICBA 4O0IA 3M9NB 4K4HA 4KLSA 5CA7A 3RJFA 2VANA 3KHRA 9ICTA 2XY7A 4QZBA 7ICLA 1ZQLA 4F93B 4NLNA 1T7PA 9ICWA 2PFPA 3IHQB 1ZQWA 3JPRA 3M8SA 3GIJA 4BXOA 5F9LA 3PMNA 1T3NA 2KTQA 1S0MA 4F4WA 4O3NA 2XCAA 4R8UB 3OJUA 3GDXA 2HHQA 1CUKA 3UXOA 2JEGA 2HVHA 2XC9A 8ICPA 1TAQA 4YN4A 4RNNA 4PHAA 3KHLA 2BPCA 5KT4A 3MGHA 8ICVA 2FLLA 4M47A 9ICKA 4M2YA 5DB6A 4MFCA 3G6XA 5KFLA 2LYHA 1XSLA 5KFWA 3PVXA 2FLPA 2AQ0A 8ICBA 4YR3A 2FMSA 2ISPA 1ZQTA 2UVVA 4JV1A 4DQSA 4M9GA 9ICRA 4ED3A 4DFMA 3V7JA 1ZQJA 4NLGA 4IRDA 3RRHA 4F5NA 2A1JA 5KT2A 1ZQKA 2OWOA 3HWTA 2V4RA 4I2AA 4PGQA 2FMQA 3GIKA 1XSNA 9ICCA 1KFDA 5J2DA 4J9PA 4P4MA 4ED8A 4RQ8A 3OJSA 1Y88A 2DPJA 3MABA 1BPZA 3PR4A 4JWNA 4Q45A 1S97A 1T8EA 4ED0A 4I2DA 1NK8A 2BDPA 1U45A 1RXWA 4O9MA 4Q8FA 4TQRA 1CEZA 3FDSA 4F4ZA 7ICFA 4DSKA 3QE9Y 3AU2A 1ZQAA 1XC9A 4QZEA 2KN7A 5J29A 2C2EA 1U47A 3ISCA 4EZ6A 1XU4A 5DG7A 1NK5A 1SKSA 3RJKA 3BQ2A 3C2KA 5J2IA 2XCPA 2GWSA 2HHWA 3EPGA 1EXNA 8ICAA 4TUPA 4M9LA 4J9QA 5DLFA 4UAWA 2VA2A 3SI8A 2BCVA 1QLNA 5DBBA 5KG4A 4F91B 2XGPA 9ICPA 5DB7A 3C2LA 1SL1A 4YP3A 5KFMA 1S77D 3Q8RB 4QWEA 4UB5A 9ICVA 3OSNA 4O5EA 3AUOA 3M9OB 4YD1A 2XY6A 2V4QA 1NKCA 1DGSA 4ED2A 5KFQA 2KZ3A 3LK9A 4UQGA 2AU0A 4IQWA 9ICQA 4RQ5A 4NY8A 1B43A 5EOZA 2FPLA 4ED1A 3V6JA 4YMMA 3JPOA 2IBKA 4I27A 1KDHA 2PFNA 1ZQHA 4I29A 2C2RA 5J2GA 5L1KA 1JMSA 3N4MB 3GV5B 4YCXA 4ECTA 1NJXA 4C8OA 4ZH4A 4EYHB 3C2MA 1SKWA 4ELUA 1IXRA 3V6KA 4DQPA 3C1YA 3B0YA 4YXMA 4JWMA 3ISBA 9ICSA 1MQ2A 2J6SA 4J9RA 3NGDA 1LB2B 4I2IA 4NM1A 4XUSA 9ICIA 4DSJA 4JK1A 1A77A 2J6TA 2Q0ZX 5KFDA 3H4BA 3EZ5A 5IILA 5DG8A 1ZQNA 3QEAZ 2FLNA 2I1QA 5KFNA 4KLTA 1S10A 4IQUA 3QEBZ 4F3OA 4MEYA 5L1JA 4HYKA 4DLEA 2C22A 4UB2A 4FS1A 2IMWP 3RRGA 1MSWD 2MUTB 4KLGA 1RXVA 1Z3EB 4R8UA 4GC6A 3SZ2A 4DFPA 1TV9A 1NJWA 8ICXA 3QZ7A 2AJQA 1B22A 4RPZA 1NKBA 3RTVA 3RB0A 1AROP 3QZ8A 4KLHA 2ALZA 5J0OA 2AQ4A 4DO9A 1L3UA 1NK4A 2UVRA 4PGXA 8ICTA 1N56A 4DL7A 2AGQA 4QW9A 3V72A 3RJGA 4Q8EA 2HHSA 5KFCA 1ZQZA 4M6WB 3GQCA 5DQGA 1S9FA 5KT6A 3PW2A 4P4OA 4O3QA 4IRKA 4I2BA 5L9XA 4QZFA 5DBAA 4F5QA 9ICNA 5DB8A 3HPOA 5BOLA 3BQ0A 5J2JA 1Z00B 4MFFA 2ASLA 1HUOA 1X9MA 4M0AA 5KFIA 5DB9A 1NJYA 4KITB 1RZTA 2BCSA 1T4GA 3ORYA 4F4YA 1U4BA 2BR0A 4ECXA 4YFKA 1WCLA 5KFGA 4XRHA 3KHGA 5DDMA 5KG0A 4RT2A 4I2JA 4DSEA 4ECRA 3C5GA 5HP4A 1C7YA 5KG7A 5J0PA 1KFSA 9ICJA 3T5KA 3H7IA 2Y1IA 1IM4A 4DS5A 3RAQA 8ICKA 8ICWA 4QZGA 1V9PA 5DDYA 4TUQA 1NK9A 2PFQA 1D8YA 1JXLA 3LDAA 1ZQDA 1QSSA 3T5LA 1SKRA 1ZQIA 5KFFA 3OSPA 3OHBA 2HHTA 1X9WA 3MFIA 2HHUA 5HHIA 1ZQXA 3H8WA 4NLZA 1XO1A 3RB3A 4X5VA 4NXZA 8ICLA 4ECWA 4I2HA 5J2AA 4PHPA 2HHXA 2RDIA 4XA5A 1L5UA 3PW4A 1X2IA 5J0TA 7ICGA 1S0VA 3SV4A 4LZDA 4QWCA 1K1QA 1L3SA 4P2HA 2UVUA 4MEXA 1BPYA 3TQ1A 5BPCA 5KFRA 2ZTEA 7ICMA 2C2DA 4DL6A 4F8RA 1UA1A 3ZD9A 3H8SA 5KFHA 1S76D 4ECSA 7ICVA 4YR0A 1QSYA 2Y1JA 1NK6A 1S0OA 1JX4A 1JIHA 4KLFA 3B0XA 1ZQPA 4Q43A 1BPDA 3MGIA 2V9WA 2W9AA 4R63A 5DGAA 4I2CA 4DFKA 2BCUA 4M9HA 4BWJA 4YXJA 5KTQA 3RJHA 3PO5A 3ZDBA 3MR5A 3HX0A 2P6RA 4F5RA 4CCHA 5KFZA 3RH6A 3ZDCA 3SYZA 4DQQA 1PZNA 8ICFA 3JPQA 3EPIA 3JPTA 3TAPA 3UPQA 2KFNA 4GXKA 3HP6A 2FPMA 4E0DA 5J2FA 3KHHA 3BDPA 3AU6A 2NRWA 4I28A 4EYIB 4DEZA 4PH5A 8ICRA 8ICYA 5EWGA 4I2GA 4IR9A 3TANA 1RPLA 4TUSA 5IIIA 2P66A 9ICLA 3PO4A 5DLGA 4QWAA 5KFBA 3TI0A 2JZBB 4B9SA 2W9CB 3PMLA 4KTQA 4DSLA 1A76A 4BXOB 3GFKB 3TARA 1HUZA 1D9DA 5J0SA 1BGXT 3PX0A 1L3TA 3HW8A 1NJZA 4M9NA 3V7LA 1D8LA 2MUTA 3RB6A 5TZVA 3RR7A 2ZJAA 4DL2A 4EBEA 3RH4A 2KZZA 4RT3A 1KTQA 2FPKA 4GC7A 5JUMA 5IIKA 2I9GA 1ZQGA 4QZIA 1NOMA 3GILA 4P4PA 4KLEA 1BVSA 2FMPA 5HHHA 5KG3A 1BPEA 3T5JA 3T3FA 1ZYQA 9ICFA 4XQ8A 7ICRA 4UB4A 3C65A 2VA8A 4M6WA 3EYZA 4JUZA 4DOAA 3M9MB 2ZJ5A 3C1ZA 4GLXA 5D4BA 5KT3A 4PHDA 2WTFA 4DF4A 7ICSA 2ZTDA 3OGUA 3Q8MA 1BPBA 2W8KA 5KFKA 4DSFA 4O3PA 3PX6A 1Z00A 4K4IA 4RNMA 5KG5A 4B9UA 4R66A 4G3IA 3JPSA 4GXIA 3LWMA 2KZMA 4MF8A 4KMUA 4LVSA 2MAXA 5CJ7A 2UVWA 1TKDA 5KFJA 1LV5A 5KT5A 1RYRA 7ICUA 5DG9A 4JV2A 3UQ0A 4TURA 2ZUCA 3GIIA 5KFPA 4DQIA 8ICCA 4NM2A 1XSPA 2R8IA 5J0RA 3Q8LA 4ELVA 5IIOA 5IINA 4EBDA 4FBTA 1JXEA 4PHEA 8ICHA 5IIMA 5KFVA 5EWEA 4DL5A 7ICOA 4O5KA 7ICTA 1U48A 4KLLA 4RQ4A 4RQ1A 4R65A 2ZUBA 1TK0A 3T5HA 2ATLA 4IR1A 3RJIA 3UXPA 5DQHA 9ICAA 2AGPA 1ZQBA 3PW0A 4KLDA 4QZ8A 4QZCA 1WCNA 4IQTA 5J2EA 1ZQCA 2M9NA 2KFZA 4YMNA 4RPYA 3TFRA 4RQ3A 3RJEA 2ASJA 8ICIA 3RBDA 2PI5A 2F1IA 4UBBA 3MDCA 5KG1A 2W9BB 3Q8KA 5D46A 1COOA 4RPXA 4MF2A 4QWBA 3PV8A 5L1LA 8ICUA 4LZGA 1QTMA 1TK8A 8ICGA 5KG2A 3IM1A 5KFYA 4MFAA 3Q8PB 5DGBA 4UB1A 1ZQOA 4EZ9A 5D49A 2NRVA 2IA6A 5HNKA 1K1SA 2H5XA 3PW7A 3N97B 2PFOA 3HT3A 9ICGA 5DKWA 3OHAA 1D9FA 5C5JA 3K4GA 4UBCA 3GV7B 1TVAA 3KTQA 8ICQA 2NRXA 1H38A 3PW5A 2BPFA 5J0WA 1L3VA 3PY8A 4NLKA 2BHNA 2P6UA 4J9MA 1XS9D 3JPNA 4ECQA 2XY5A 3PX4A 3MR6A 4ECYA 4O3OA 3RB4A 5KFAA 3MFHA 9ICMA 1DOQA 3BQTA 3K75D 3RJJA 1ZQUA 4RUCA 3RAXA 1ZQRA 1KEJA 4I2EA 2BPGA 3MBYA 1SL0A 4ELTA 4YD2A 4Z6DA 1TFRA 4QWDA 3SV3A 4ECVA 3BJYA 8ICEA 5DBCA 4RQ0A 8ICSA 3UQ2A 3FYHA 5F9NA 5KT7A 3BQ1A 1SZPA 3THVA 4YMOA 3ISDA 4DSIA 4K4GA 2NRRA 4DS4A 3V7KA 4Z6EA 4KN4A 1ZJNA 1ZQYA 4Q44A 2ZUDA 3MDAA 3TAQA 3UXNA 1TK5A 1ZQSA 4QZHA 3ZDAA 2JZBA 8ICMA 2W9CA 4F5OA 4GXJA 1BPXA 2HHVA 4RQ7A 5KFTA 4F2RA 3H8JA 3Q8SB 1ZQQA 9ICXA 4KLOA 4PPXA 2XO7A 2BCQA 5J0XA 2B21A 1KFTA 1KRPA 1U9LA 4JV0A 1QSLA 4KLQA 7ICQA 4J9SA 4F5PA 3ZDDA 4RU9A 4YQWA 1ZQMA 4C8KA 5CP2A 1ZETA 4DL3A 3ZD8A 3Q8QB 3GIMA 8ICJA 1TAUA 4YVZA 4C8MA 3ETLA 5KFEA 1S0NA 5L1IA 2F1JA 3JPPA 2ZTCA 3RR8A 4M9JA 4DWIA 2A1JB 4DOCA 3TFSA 4UAYA 2JEJA 4F4KA 4F2SA 5EWFA 2HVIA 2ZJ8A 4YR2A 4J9KA 4QZAA 5BOMA 8ICNA 3C5FA 1U49A 2W8LA 4DFJA 9ICUA 1MQ3A 2BCRA 4KLJA 2NRTA 4F4XA 8ICOA 2NRZA 4C8NA 7ICPA 5J0YA 3E2EA 3G6VA 4FO6A 4ECUA 4QZDA 4DF8A 2IHNA 4B9NA 3G6YA 4BGDA 2R8HA 4ECZA 1SL2A 2BQUA 4O5CA 9ICHA 3RBEA 1KLNA 2R8JA 5HMLA 4RZRA 3EWAA 3MR2A 5IIJA
chains in the Genus database with same CATH superfamily
3MR3A 4HUEA 4M04A 1ZQEA 1VQLN 5C24A 3AVNA 5KFUA 4J9LA 5AQJA 2OTJN 1X9SA 3CP8A 4UARA 4OPJA 2BE2A 4UY8O 5CB1A 3K5OA 4RQ6A 5EE0A 3LYSA 2GX9A 3K58A 3CCJN 3QYPA 1LWFA 1HMVA 4FBUA 5GIPA 2FLOA 2K4EA 4C1NK 2XVTA 4JKCA 4JI2K 4B9TA 5KFSA 1UA0A 3LZJA 1CZ9A 3P5JA 1ZJMA 5BRHA 3H3OB 4IQVA 1NK0A 3DJCA 4IOXA 5DMRA 5I9EB 2WB1C 3VGKA 4B9MA 1YUWA 2BGWA 4CVNE 3GV8B 4KLIA 5AFUA 3H0LB 4FVMA 3DOLA 4CZEA 3IAYA 2W3RA 2AGOA 2RPIA 3LAMA 3HYFA 5HMMA 3SUPA 4DL4A 2E88A 4IXCA 3QB0A 2KJ5A 5J0UA 4O3RA 1BCMA 2IGIA 3O4NA 4DTOA 3RH5A 4DLGA 2NLXA 4DKWA 4RNOA 1FXXA 3AO3A 2YNIA 3D2EA 3ZEUA 2PI4A 4LY7A 4RQ2A 1MDUB 2VWBA 5CHGA 4KB0A 3LL3A 5AKEA 2HHHK 4LC9B 3UM9A 4M3YA 3U9DA 4Z4CA 5E84A 2H3ZA 3LWLA 3V6HA 1U6ZA 2OPQA 5AQZA 3BQ7A 3ASMA 2DPIA 3B6PA 4O0IA 2IOHA 4K4HA 3KBBA 3SQIA 2ZJPL 5KGXA 3RJFA 1S6QA 3A0IX 3ZT0A 5AZIB 4FWQA 7ICLA 1YZ6A 1QVFM 4NLNA 1BA1A 1T7PA 4BRGA 4JD2B 1JI7A 3JPRA 3GIJA 1WBDA 4DTMA 1HX1A 3T69A 4QIWF 3UXOA 2HVHA 8ICPA 2XC9A 1QZ5A 4YOWA 3THWB 4CJLA 2ZE2A 4RNNA 3EE8A 2NYVA 4CK2A 1FFVA 1VSLA 4M47A 4BUGA 4M2YA 4K0KK 2DTUA 4MFCA 1REVA 2ISPA 4H5VA 2UVVA 1N5WA 4DQSA 1LWCA 9ICRA 4ED3A 4FVUA 5C2DA 4NLGA 1J53A 2GWKA 3ZT1A 4E7IA 2E6LA 1K8KB 4EELA 3SUQA 2RLTA 1A5VA 3ICXA 4Y2SA 3QFPA 1ZBHA 2ZM6K 2FMQA 3RFAA 9ICCA 1KFDA 3M6ZA 2QARA 5AM4A 4ED8A 5EX5A 3CNHA 4GFJA 1Y88A 3K9JA 2DPJA 3F2KA 3MWTA 1N33K 2G5IB 3PR4A 3I1YA 4I2PA 1NJIO 4FXDA 2EH9A 1S97A 3T1YK 3VEZA 1U45A 3G0ZA 3AVHA 4CIEA 2NO4A 3AVMA 5J1EA 7ICFA 3AO1A 3QE9Y 3KHYA 3AU2A 3B6OA 5ALRA 3HL8A 4H4OA 2KN7A 4I2QA 4JEPA 1N6QA 4FJJA 3ISCA 3RJKA 1SKSA 2MU2A 5LJVA 3DLLL 4GV9A 2W11A 3C2KA 2G8VA 3CJ1A 1UHUA 3AA2A 4DQ8A 3WQUA 3AAQA 3THYA 3EPGA 3M6KA 1Z4NA 4PQUA 1DK2A 3J8AA 4M9LA 4Y2RA 3PUFA 5AQOA 1FKPA 3WUHA 3OY9A 4KI6A 3SI8A 1ASWA 2JGUA 3VQBA 1YTUA 5DBBA 4F91B 4K8XA 5BPMA 4QWEA 3C7NB 3OYJA 5ELZA 5DM6L 3M9OB 3IG1A 4QIWC 4YD1A 3CPWM 3T7ZA 1DGSA 5KFQA 4KMOB 2AU0A 2H3IA 5EOZA 2FPLA 1S5LU 4CIFA 4BDYA 5T14A 2D1KA 1ZQHA 4JI8K 4I6MA 3NE6A 5L1KA 4M3WA 2NO5A 3T79A 4C8OA 2D0PA 4EYHB 3C2MA 2IVPA 1OW5A 2DUYA 4DQPA 3C1YA 3B0YA 1NGBA 2RKIA 3O9RA 3ISBA 4WJ3B 1MQ2A 9ICSA 4IO9L 2P9IA 3NGDA 1LB2B 4I2IA 4OVLA 2X6NA 1RT2A 4MQ3A 4NJ8A 4JK1A 4BREA 3SNNA 3QUQA 5KFDA 4OJLA 3H4BA 3EZ5A 3U9ZA 2ESEA 4LSLA 1R0AA 4OJPA 2FC0A 3HPGA 4CHPA 1X6IA 3HJFA 2F8TA 3H8MA 3JSMA 2O8DB 4F71A 4IQUA 1S10A 3O08A 3K1RB 3TACB 3LDLA 3O0FA 4H5NA 3KFUF 3P38A 5L1JA 4HYKA 1FFUA 5ALLA 1HPZA 4QS8A 5M1OA 5KPZA 2VGMA 4JHDB 1X1PA 3CXCM 3RRGA 1NGIA 1S1XA 1JXBA 4IZ9A 3QO9A 4R8UA 1ZD3A 2P9PB 1BOTO 3KOOA 2J4RA 3IDHA 3VQEA 4RW6A 1B22A 4RPZA 3RTVA 4IDHA 3NRZA 3QZ8A 2ALZA 2AQ4A 4PKIA 3KK3A 3S3NA 4DO9A 4CFDA 4Y2QA 2QWPA 2UVRA 1N56A 2AGQA 1TVRA 4OPAA 1ZBUA 1ZBIA 5BRFA 4F3TA 4O3QA 3A5LC 4F5QA 3MCAB 1VQNN 3FFIA 3V9XA 5BOLA 3BQ0A 5J2JA 1VK0A 3O3GA 4PL2A 1T6DA 2ASLA 1X9MA 5DB9A 4UW9A 1NMNA 1JCFA 4E89A 4KITB 5AQLA 4Z94A 1U4BA 4KPYA 4YFKA 5ALZA 1WSIA 3M8QA 1FIQA 2Q0UA 3C5GA 3MEGA 5J0PA 2FBYA 3T5KA 3H7IA 8ICKA 5BN9A 3MGVA 1V9PA 1K9MO 2PFQA 2JWKA 3D2FA 5EVZA 4ISFA 1QSSA 4JI3K 1F21A 3SUOA 5KFFA 2E8PA 3OHBA 3HZ6A 3NFAA 3VQ7A 4N56A 3AM9A 4E3SA 5AQYA 3S3MA 1WWVA 3ZSRA 2YMQA 2Y9TA 3H8WA 4NLZA 2Q36A 5FDLA 2HMPA 2Z1IA 4BRFA 2BUPA 5IT9O 3KKAC 5J2AA 4PHPA 2HHXA 1RILA 4EFHA 1L5UA 5J0TA 3DLRA 4FE3A 1RCHA 3FZFA 3AO2A 1L3SA 3M1FA 5CHIA 4CGDA 5E41A 1NG9A 1I3AA 7ICMA 3K5LA 4DL6A 3NHGA 1UA1A 3ZD9A 3SD7A 3L4PA 1O08A 1S76D 4ECSA 4NLBA 3ENOA 4A61A 2LM4A 3BP8A 4BRHA 4CHQA 3GL1A 3WNGA 1ZQPA 4B3SK 4Y2TA 3MGIA 1S22A 3VQCA 1ZC6A 1QHTA 3CJBA 3QMLA 5LJWA 4YXJA 2YKMA 1S6PA 4DR2K 2DF4B 3MC1A 3B9JA 1GOCA 1TKXA 3CJCA 4DQQA 5AM2A 2H3FA 2Y0SF 1OVYA 3NGYA 1IH7A 4CEDA 1SZ2A 2B4JA 4E0DA 3SPZA 3RF9A 3SLCA 3BDPA 2KJ9A 2ITMA 5HL7L 2IOFK 2F2AB 1BIUA 1WBBA 4EYIB 5ALTA 4PH5A 3DOKA 3PZPA 3TANA 1Q8IA 4XH5A 4RWTA 3QXGA 4TUSA 3AAPA 3HRDD 2F7TA 4P0QB 4B9SA 4FWNA 4OCZA 3KZXA 3VQPA 4HHTA 4Z4HA 4DSLA 1A76A 2E6MA 5J0SA 1TL1A 3EN9A 1L3TA 3J7AP 5ALGA 5LMUK 4KB1A 1QQMA 4EBEA 2PBDA 2KZZA 2O4IA 3NMUA 1KTQA 3PIPL 4KHSA 1F0MA 5JUMA 4GC7A 4FWSA 3CD6N 4B3TK 2I9GA 1IBLK 3UKUA 4P4PA 4KLEA 1FEZA 2E8NA 1K6YA 4FOIA 4J2DA 3T5JA 3T3FA 1ZYQA 3V1OA 2YNFA 4AHVA 1TE2A 2LM1A 1SQKA 3MN9A 1Q81O 4Z4EA 2VA8A 3MX2A 3EYZA 5AZIA 3C0BA 3DLKA 2UUCK 2ASPA 2ZJ5A 2ITGA 2A19A 2YMPA 2EHGA 4A62A 4U6PA 3DRRA 3NCIA 3VCBA 1L8OA 2G09A 2ODGA 2K4IA 5KFKA 1NGHA 2NZTA 4MFBA 3L2VA 4K4IA 2A40A 4H5WA 4A5AA 2NV3A 5H2FU 1FJGK 4E7LA 4A59A 2G0AA 2F3NA 5GAEP 3OHRA 1DK3A 3G4SN 3THWA 1HYSA 4G3IA 2NNWA 3QU4A 4GXIA 4KH4A 1XNQK 4W5RA 3C6AA 2JH1A 2ZQBA 3DV9A 4LVSA 2MAXA 2NUBA 2F77X 4CGHA 1RYRA 2P9KA 1SV0C 3UQ0A 4X64K 4TURA 2ZUCA 2D0CA 3TR8A 4A5BA 4NM2A 4ELVA 4YDUC 3OYLA 4EBDA 4PY5A 3E58A 5IIMA 5EWEA 3AMZA 2DGZA 4RQ4A 1NGJA 3HXMA 4JKFA 2ATLA 3RJIA 5DQHA 2AGPA 1KBUA 4KLDA 1E4GT 4QZ8A 4QZCA 3NF8A 2HCFA 1ZXOA 3DM2A 3AEVA 3RMDA 3TFRA 4RQ3A 8ICIA 4OD0A 4KX5A 4EX7A 3LVWA 3MDCA 2OPPA 3QUCA 1SWWA 4RPXA 2HF3A 2YHWA 4MF2A 3BZKA 3QUBA 2VKQA 4IEIA 4LZGA 5JLFA 1S8OA 4L8RB 1HYZA 5KG2A 1D8BA 1ZQOA 4ILHA 3J81O 4NL9A 5D49A 1MA7A 1S1TA 5IWAK 3N97B 5DKWA 3D2EB 3ZEUB 1OH6A 1C0UA 3K4GA 4UBCA 5KAIU 5ALQA 3GV7B 8ICQA 1QS4A 3ZSQA 4IFYA 1H38A 3MAQA 1VJ5A 2BPFA 3WKCA 4JI6K 2BHNA 2HBMA 4ECQA 3KIOA 3MR6A 3RB4A 2WTUA 1HNWK 1PK3A 1DOQA 2K60A 3HI0A 1KEJA 4CHNA 2BPGA 3MBYA 1SL0A 1YVUA 1N5XA 1TFRA 3VQAA 5BR9A 5GTIU 2QXFA 3KWIA 8ICSA 1KN5A 3FYHA 3THVA 3OYIA 4C4SA 4DTNA 1SWVA 2PMZF 4YMOA 1RG6A 4DS4A 3OPXA 4PJ0U 3V7KA 1COKA 1WUAA 1YXQA 1ZJNA 1ZQYA 2YCHA 2G5HB 1A5XA 8ICMA 2BH1A 5M1NA 4QZHA 1C0MA 4CF8A 1A5WA 1BCOA 5KFTA 4CJUA 4F2RA 4FO0A 4KAZA 4JK7A 2A41A 3M8PA 4KBOA 1YAGA 3VERA 4CFCA 4FM2A 2G8HA 3ZSOA 3MEEA 1LOTB 5JMVA 2B0CA 4DV3K 5E26A 4RU9A 4YQWA 4C8KA 1ZETA 3Q8QB 8ICJA 1TAUA 4YVZA 3QIPA 3ETLA 3HO1A 1W7AA 3TFSA 2KVCA 2ZIWB 2HVIA 1RT1A 3OYCA 4YR2A 3HOSA 1NLVA 4QZAA 5BOMA 3QDKA 4DB3A 1U49A 2W8LA 4PKHA 4M3XA 4LF8K 4F4XA 1KLMA 2NRZA 7ICPA 2QARB 4FJ9A 1DT9A 3E2EA 5ALIA 2W54A 4ECUA 4QZDA 1UAXA 2D8CA 2JGAA 2BQUA 3R8EA 2X78A 4BE1A 4CJWA 3EWAA 1RBUA 5AKGA 3Q8LA 2W40A 4CZMA 4RUAA 2YNHA 3OYEA 3R9PA 4BC4A 4PZNA 3LDOA 3TADC 4J9OA 7ICJA 3I55N 1B4FA 4U7BA 5AQHA 5B66U 3LALA 2PXIA 3OYGA 9ICOA 4Z6FA 3NDKA 1HKGA 4TSXA 1XUPO 4CE9A 5FROA 1Q82O 5KPTA 4OO1J 3THYB 4C8LA 1UT5A 1B92A 1BUPA 5C25A 3IG5A 5HOOA 1ATNA 4B9VA 5J2CA 1MWKA 2OZMA 2P9LA 3O80A 2A5XA 4G1QA 2K8BB 4CGFA 3LDSA 3MK6A 2PMZC 3K0SA 4JN4A 4CJPA 4I9LA 4FWKA 4UB6U 4F92B 4K41A 1JROA 4KN7A 5AJ3K 5AM5A 2RDJA 3NTUA 8ICZA 3M8RA 3PR5B 4R64A 1M90O 5KFOA 5ALOA 1Q3UA 2H3QA 2E1FA 4BJQA 2DKZA 2LHTA 4XH1A 3CW2C 3KZIU 3K1ZA 1UQVA 1JLGA 2KICA 4F50A 4M42A 1O13A 3F5TA 4U67L 2WF6A 2R8KA 7ICHA 3IS9A 4CD3A 2JEIA 2E2NA 3A8YA 4I6MB 4FW2A 4BDPA 2UXDK 3NVWA 3DYAA 3THXA 1JN3A 2FBTA 2VA3A 2HW3A 4QZ9A 1ATSA 5EE9A 4B9LA 4Q5VA 4ID5A 5CWRA 1NMDA 2P9IB 4N41A 2KHVA 3K5MA 2HI0A 4J9NA 3M1YA 2C28A 4DU4A 4J2EA 3EW9A 4DCHA 2VWJA 9ICEA 2KG5A 3MCPA 3PIOL 3HM9A 2Q0RA 4ISGA 3M9NB 4IG3A 2VG6A 4KLSA 3D0PA 4QNLA 2VANA 1L6NA 2AP1A 3VPZA 4GW6A 4M41A 1ZQLA 5ALDA 5EU7A 9ICWA 4I2AA 3IHQB 1DGKN 1Z26A 5EY4A 3K57A 4FJ5A 5F9LA 4IS7A 1S0MA 3WXJA 2BTFA 2KKPA 4R8UB 3GDXA 3LP3A 4K25A 1CUKA 2CXYA 3BF1A 3U3GA 4NCAA 2W7OA 2JEGA 2EQYA 1RDUA 5ALMA 3KHLA 5AKKA 3MGHA 4ILJA 2ZIVB 1HYVA 1WAJA 2RP5A 1A6SA 1XSLA 4DUYK 4WF9L 2R18A 3DLBA 4M9GA 4DFMA 1ZQJA 4IRDA 4CGGA 1TKZA 1S9GA 1ZQKA 3ULDA 3VTHA 4W5OA 2DKXA 5ALKA 1YITN 5K4LA 4FLYA 2WB1F 4ID1A 4J9PA 3H3NO 3WKDA 3OJSA 2HB5A 1VDVA 3TAEA 1BPZA 1K73O 2BZFA 4M45A 3OYDA 4JI4K 4JRPA 5HP1A 4Q8FA 5JS1A 4TQRA 3EO3A 4JKDA 3FDSA 4F4ZA 5JRTA 2WONA 4DSKA 3U4LA 3EL2A 3QU5A 5J29A 1QQ6A 2ETJA 1NK5A 2W7PA 4CHYA 4X66K 3BQ2A 3D2FB 5AQPA 5ALJA 3IN5A 3CM6A 2P9NB 1EXNA 3S41A 8ICAA 5CZ2A 5ALFA 1WSFA 3JYTA 2KEYA 1QLNA 3QIOA 1VSJA 5KG4A 2P5OA 3HRGA 3AV9A 4YP3A 3VEYA 4FM0A 1XHZA 4H0PA 3L2UA 2G8UA 4O5EA 3G6EN 3AUOA 4FWPA 5M1FA 1VAZA 2XY6A 2V4QA 3O9UA 3P39A 4O8UA 4ED2A 2KZ3A 3LK9A 1RT7A 1DKGD 1KQQA 4NY8A 3WXKA 3V6JA 1HKCA 3WK9A 4CEAA 3JPOA 1TUYA 1M6YA 3K5NA 4E7HA 5ALVA 4I29A 5J2GA 3N4MB 1JMSA 3FZKA 1URJA 4OJRA 1SKWA 1MN8A 1IXRA 3V6KA 5KRSA 1RDWX 3K9KA 4YXMA 4JWMA 1VRUA 4FK2A 4XUSA 9ICIA 2G07A 1A77A 2EAOA 2D0AA 2DY4A 5IILA 1S1WA 2QKKA 2FLNA 5AKJA 5AKZA 5AQQA 4CF2A 2F4VK 4H0OA 1TYQA 1N61A 4J8FA 3RMAA 4CE6A 2Z1GA 3I0RA 4L3QA 4A8EA 2A3ZA 2C22A 4UB2A 4FS1A 3SBGA 2BGGA 3TADA 2IMWP 5CZ1A 2ZGZA 3BEXA 4CDGA 4YOVA 3UIQA 4CF4A 1RXVA 3HTVA 4MDBA 3LZIA 2ZGYA 1Z3EB 4GC6A 3BY5A 4OLAA 2KJ8A 2AJQA 5ALWA 1NKBA 1VSMA 1VSIA 4MDAA 4KLHA 4E1NA 3G25A 5J0OA 4OPKA 3UKUB 3B8AX 4WCEL 8ICTA 4QW9A 3LPUA 1YHQN 5E79U 2D4WA 5ALPA 2O6KA 5KFCA 3A0HU 1S9FA 5KT6A 3PW2A 1VSHA 4CEBA 4CJ4A 2KHQA 1C20A 3OS1A 3I28A 4I2BA 4QZFA 2OPRA 1VQKN 2KKVA 2E2QA 5DB8A 1IKYA 4BR9A 4MFFA 4MO4A 1S1VA 2VJ4A 2E4LA 1HUOA 1PK1B 3G71N 4DV0K 3WK7A 1X42A 1NJYA 1HKBA 2KSOA 1L7OA 1RZTA 1TUUA 5TKYA 3ORYA 2GUPA 3SJJA 5AK6A 1GLDG 4CHOA 3N4QA 4BRPA 1HJRA 3OS0A 4B1ZA 1C7YA 1OKJA 1GO3F 1N34K 9ICJA 2P9KB 1NGCA 3RAQA 1IM4A 4DS5A 4CI6A 5AQVA 4YOYA 4OPHA 4CEFA 4M7XA 4H0XB 2CRXA 2ZIWA 3E0FA 3IDWA 3TKAA 3FZMA 1YTAA 2G06A 2KV2A 1ZQIA 3OSPA 3L0QA 2HHTA 2FF3B 3MFIA 1SV4A 4QS7A 1YI2N 4ICLA 4NXZA 3CQXA 4I2HA 3OYBA 1TL3A 4XA5A 1RTDA 3E9PA 3N7RC 1S0VA 3SV4A 1DEJA 4EENA 2XY8A 4YORA 4GIBA 4QWCA 3FAHA 1RTHA 3ZSWA 4P2HA 3V9UA 1Z19A 3DRPA 1BPYA 1W2BM 2Q1NA 5BPCA 5KFRA 1D5AA 1B0XA 2C2DA 4HVJA 4DMNA 1N32K 2YN4A 2QEXN 7ICVA 1YVNA 1JLEA 1GLJO 2NRHA 3NVKA 5A0LA 2R7YA 4CZJA 4AQYK 4GKJK 1ASVA 2GTDA 4JYAK 2V9WA 3HM8A 1JKHA 3NVVA 4EAHD 4WQ4A 3LDNA 4I2CA 2ATQA 4M9HA 3QNNA 5FP0A 2WBNA 4X62K 3BF3A 4YY3K 4F5RA 3RH6A 2A6AA 1BI4A 4BRKA 3RSEA 3EPIA 3DLGA 5GAHP 4FZZA 2KFNA 1BG3A 2GOLA 4CJRA 2GH1A 2CGLA 2BDUA 1QQ7A 2F96A 3V4IA 2XIDA 3W3DA 4DEZA 8ICRA 5D3GA 1NOYA 4I2GA 3SPYA 5AQUA 3VQ4A 5IIIA 2P66A 1CXQA 5DLGA 1L7PA 3GDQA 3OBWA 3OBYA 3A2FA 4A2AA 3CQYA 2ZXIA 1JL2A 3WEEA 3IRUA 5EE3A 1NJZA 5CY4A 5KQDA 4M9NA 2LPEA 1NI3A 3V7LA 3CCEN 1E3MA 3VQDA 2MUTA 4WQ5C 3RR7A 1Z1VA 3LANA 5I3UA 3CCVN 1VSEA 1V38A 1QQOA 5C0YA 4PL1A 3VOVA 1G99A 2IDOA 3EZWA 3UE5A 1ZQGA 3C28A 3EE9A 1RDCA 1FK9A 3H46O 2FMPA 5HHHA 3CCQN 5AICA 3EKSA 4OJ5A 1RDAA 1ITGA 4UB4A 2QWLA 4JUZA 4DOAA 3M9MB 3WKAA 5AIBA 3L3UA 4GLXA 5D4BA 1E4FT 2WTFA 4DF4A 3OGUA 3Q8MA 3SUNA 4MLHA 3F2BA 3O4WA 5KG5A 3NVMA 4R5PA 4R66A 3KKSA 2EZYA 4RCHA 5I42A 5ALXA 2A3VA 3R3LA 4GMJB 4CD1A 4B3RK 3LWMA 4HUFA 4FJKA 3TAMA 3VA0A 2ZIVA 3O5BA 5AKXA 2W41A 1BU6O 5DG9A 1NNEA 4B3OA 2CPRA 3GIIA 3IG8A 4JS5A 1XSPA 1RBSA 3E1YA 4CJSA 4FBTA 1JXEA 4PHEA 3QEPA 5KFVA 1YJ9N 2P9LB 3ZYYX 3SMSA 5FLXO 4FJHA 7ICTA 2FSJA 4HCCA 5AK4A 4R65A 1KXPA 1Z05A 1TK0A 4DR1K 3TTDA 1T05A 1D4XA 9ICAA 2HOIA 1ZRNA 3O3FA 1BISA 2VGNA 4IQTA 5ALEA 3QINA 1ZQCA 2P1JA 2V7ZA 2KFZA 4YMNA 5JS2A 3RBDA 2PI5A 3RMBA 5KG1A 1EQYA 2PFUA 4N76A 5L1LA 8ICUA 1BWFO 4K42A 3OTOK 4CF9A 4RW7A 2W04A 1C1CA 1HIWA 3A0BU 5KFYA 1JCEA 3Q8PB 2F9TA 3HKZC 2YI1A 2QXLA 4UB1A 1FW6A 4DTJA 2HF4A 2IA6A 3THXB 1GOBA 4RQNA 1N8RO 1D9FA 1TVAA 2P9NA 2K4PA 4IOCL 4FJXA 2NRXA 1SUQA 4PUOA 3PY8A 3VEXA 2E5SA 3HP9A 5AQNA 4J9MA 5M1PA 2QLTA 1WYGA 3LP2A 4IWVA 3FZLA 1U2VB 4ECYA 2Q2RA 5KPRA 4I9QA 5KFAA 3LP0A 2DPNA 3BQTA 3NF9A 3O9QA 4DR4K 4YOXA 4Y2PA 4GV6A 3F2CA 4QWDA 2KOBA 4Z4GA 3BJYA 4LFBK 3WK6A 4K8ZA 1O1WA 4DHYA 4QCLA 4O8KA 2I5HA 3BQ1A 5F9NA 4DSIA 1SZPA 4K4GA 3S9HA 3ATVA 4Z6EA 1ZQSA 3ZDAA 1T44A 3QBXA 4KO0A 3ZLJA 3NS1A 4JAXA 2FI1A 1RGIA 2H3VA 2HHVA 4RQ7A 4F9OA 5AKIA 2DFFA 5KL1B 9ICXA 2JHDA 4FZLA 1JALA 2FBXA 5AQWA 3WXIA 4RW8A 4AHTA 4JV0A 1C0GA 3ZI4A 4KLQA 2PZSA 3G10A 2EDUA 1WSJA 2QWQA 1R59O 3I8BA 4F5PA 1ZQMA 1XQSC 4FW1A 5ALSA 4DL3A 3GIMA 3SEIA 5HROA 2F1JA 3JPPA 2ZTCA 3RR8A 4AF1A 4O44A 4DOCA 5AM1A 2JEJA 4UAYA 4F4KA 5EWFA 1KCFA 4IFEA 4BC2A 4FK4A 8ICNA 9ICUA 4DFJA 1YZ7A 1MQ3A 2YHXA 2FXUA 3VGMA 3AVCA 3C6TA 3ENBA 3DI6A 3DXKA 4J2AA 5BR8K 4B9NA 4DF8A 4O3MA 4RTFD 4FFDA 2R8HA 4ECZA 4FZXC 1OH5A 3NGIA 3AA4A 2PY5A 1KLNA 2R8JA 2EX3A 3EEQA 4DTSA 3QICA 1LW2A 5J2BA 2DFLA 1HJPA 4ED6A 5AQRA 1ASUA 3AO4A 4FS2A 1NKEA 5G5GA 3ZSZA 3AVBA 3H4DA 2BQRA 1ZQFA 4EBCA 7ICNA 3ALRA 2RHKA 4NB4A 1VQ6N 4CZLA 1GLEG 1KKXA 3N4PA 4FLVA 4ICAA 2F8KA 3PNCA 4AHRA 2F1HA 3N7PD 3SAGA 2XGQA 1N48A 2B6AA 2E1YA 3V1QA 3J80O 3IV6A 1UT8A 4WFNL 1RYSA 4AHUA 1V97A 2F8SA 3DDHA 3NRWA 1PK1A 3AVIA 2W9MA 1RFQA 2O8FA 4BR5A 1Q9XA 5KG6A 1IG6A 1MC8A 5DQIA 4DOBA 3AVKA 4O4GA 1CZAN 2W9BA 3E66A 3VQ9A 3BZCA 3O1WA 4TQSA 2JH7A 3C29A 1OUQA 1RBRA 2YKNA 1XWLA 3ETRA 4O5BA 2QA4N 4FM1A 1KC8O 4Q0BA 3H45C 2J6UA 2UUAK 4QJFB 4MO5A 2GELA 3ZX2A 1EO1A 4M3ZA 1Z25A 4UAZA 4CEOA 1OH7A 3ZDEA 4FWOA 1NK7A 1ZQVA 2Q97A 1V4TA 3ZT4A 4PL7A 3RVCA 7ICIA 1HEKA 2OPSA 2IHMA 2CH6A 2Z1JA 4KH5A 4B9QA 3WK5A 4PGYA 1NGEA 3CC4N 2BKEA 4B8CA 4FJLA 4PHTX 2YNGA 2LI6A 3QU2A 4KLMA 4I2FA 4DQRA 2YMMA 4CF5A 2JEFA 1KSPA 2FE9A 5J8YC 4F72A 9ICBA 2MSNA 3DXMB 1ESVA 2LKYA 1SS6A 4EP4A 5CA7A 1TYQB 2DL0A 3FR0A 2YQEA 2V52B 2XY7A 1L8LA 4F93B 4EIAA 4CEQA 4C4TA 3UKRB 3PMNA 2KTQA 1T3NA 3AQEA 2B6GA 1NGDA 4B1WB 4O3NA 2DFEA 3OJUA 2Q31A 3V1RA 2P5GA 2HHQA 1J5OA 4XIUA 1VQ9N 4YN4A 1IG8A 5FPDA 4PHAA 2UXBK 1BDGA 4K43A 2BPCA 4CFBA 2HDOA 3NASA 3VC8A 8ICVA 4PA1A 9ICKA 4BG9A 3VF4A 3TWHA 4JKAA 3G6XA 8ICBA 2UUBK 5KFWA 3O3HA 3KD1E 3L6QA 4YR3A 2FMSA 4IG0A 4CBUA 1ZQTA 2ZWHA 4CK3A 1F44A 3QEWA 2IS3A 4Z0UA 4QS9A 3V7JA 3TSUA 3RRHA 4F5NA 2OWOA 1SIJA 5GADP 2IAJA 3MN5A 3SQ2A 3HWTA 3ATUA 5AI4A 3UB5A 5CR4A 4FZYA 4YNQA 4FZNA 4PGQA 4CECA 2QM1A 3GIKA 4ZHRA 2KSOB 2W55A 3NH2A 3HOTA 3MABA 1U04A 3ZETB 1KAYA 4ED0A 1NK8A 2BDPA 1Z1BA 1RXWA 4O9MA 1CEZA 3AVLA 3K2PA 3ZSVA 2AA4A 1S1UA 3QNOA 3KD5E 1EP4A 1ZQAA 4QZEA 2C2EA 3H0RB 4EZ6A 5DG7A 1TKTA 4BQLA 3ALYA 3L3VA 5J2IA 4IJNA 2V7YA 2XCPA 3O6WA 3KKAA 2HMIA 2HHWA 3H0MB 3OYMA 5K14A 4HTLA 2AH5A 1BA0A 5LY3A 2FJ6A 4TUPA 4FWLA 5DLFA 4UAWA 2VA2A 5ADXA 1X9XA 2BCVA 3LPTA 2QB1A 3WQTA 1QE1A 2FSNA 5DB7A 1L7NA 1SL1A 3AVAA 4IO8A 2HOEA 5KFMA 3FZHA 1S77D 3Q8RB 2G8WA 4P0PB 9ICVA 3NVZA 4BR7A 3QETA 2GWJA 2KQ2A 1Z6RA 1WOQA 4FLZA 1N2XA 3QEVA 4OKKA 4OGCA 5GAGP 2F76X 4ED1A 4I27A 2EWSA 4YMMA 1N62A 1VLBA 2IBKA 4KFBA 4Z4FA 2PFNA 4KH6A 2C2RA 4XEIA 3GV5B 1NJXA 3M5RA 3ZCMA 1RT5A 2FF6A 2WF5A 3AGKA 3AGRA 2JXJA 4IDKA 2AXTU 1C1AA 4CGJA 1N60A 3AN1A 3DEEA 1BI4B 1OVQA 3RSEB 4MHVA 5TISU 3JXUA 1RDBA 5FRMA 4DTRA 5HRNA 1VQ7N 2P9SA 4N47A 3VQ8A 4B1XB 4FCYA 2G8KA 4RW4A 1ZQNA 3QEAZ 5C10A 4FOEA 3I0SA 4AM6A 1JJ2M 5BRDA 3AA3A 2I1QA 4AYBF 1L7MA 1W0HA 3ID8A 4BRQA 4KLTA 3SMVA 1IJJA 3NAEA 3UMBA 3MX5A 3VMFB 5AI5A 1LAVA 4F3OA 2V51B 3AVJA 5AI9A 4DR5K 3UMCA 1FKOA 4FJIA 2YY6A 4DLEA 3WEEB 3PSTA 2ZIXA 4CJ3A 3PSPA 2O8CB 4YOUA 2MUTB 4Y2UA 4CJFA 4FLUA 3SZ2A 4DFPA 1TV9A 3CRXA 3WK8A 8ICXA 3P83D 5HLFA 1S72N 3M7DA 3WT0A 1RT3A 4BC3A 4CJVA 3RB0A 4AP9A 1AROP 4X65K 1YT3A 1ECWA 2E1ZA 1U2VA 4M63C 4BE0A 3OTQA 2QKQA 4PGXA 3FM9A 4DL7A 3U6FA 2OA8A 2A42A 3D7EO 1RT6A 3QERA 3H6EA 1MWMA 3CCUN 4NCBA 4V19S 2EAMA 3QNMA 1LWEA 3GG4A 4EHUA 2QWOA 3OYFA 4P4OA 4IRKA 1BQNA 9ICNA 2XICA 2YTUA 3AL0B 3L2QA 2ZIUA 1GLCG 4M0AA 5KFIA 4IBNA 2BCSA 3OVNA 3H1VX 1SV0A 2K4HA 1T4GA 1GOAA 2F9WA 4R79A 2QKBA 2HMXA 2HNDA 1J9AA 1TV6A 1WCLA 3TSQA 3ULEA 4KHNA 5JVHL 4YDUA 3AARA 1T3VA 4XRHA 3E9LA 5DM7L 5KG0A 4FJMA 4DSEA 5F2RA 5CYMA 4BC5A 4ECRA 4FJ8A 1AQ6A 4A2BA 5KG7A 4N5SA 4KHYA 1KFSA 1EWQA 3SQ1A 8ICWA 4AHSA 4QZGA 3BUZB 1NK9A 5AM0A 2LBOA 2IC3A 4DV4K 1JXLA 3M6GA 3LDAA 2YV0X 1ZQDA 3T5LA 1SKRA 4B8AB 4AYBC 4O0JA 2HHUA 5HHIA 4AHCA 1XNRK 1ZQXA 2Z7JA 3D2SA 2KD1A 3RB3A 4X5VA 2DQNB 2RDIA 7ICGA 2HBJA 4H03B 1X2IA 4KHUA 4LZDA 5JU5A 3VESA 1ATRA 3VF6A 2UVUA 5AQSA 1PUZA 2W43A 4MEXA 3AO5A 4JRQA 5LMNK 3I8DA 2ZTEA 1BL3A 1B9FA 4F8RA 1IV8A 3H8SA 1G15A 4PKGA 3TTFA 3T19A 4YR0A 3Q7BA 3KLGA 1ZBSA 1NK6A 4M7YA 1S0OA 1DTTA 4E1MA 4KLFA 2E3TA 1EXQA 4Q43A 3CYMA 2W9AA 5MLCQ 2KMDA 2ZJQL 1IV0A 4R63A 5DGAA 1J6ZA 2BCUA 1SXDA 1V4SA 3RJHA 4JKBA 3CCSN 2FBVA 4HUGA 2UU9K 4DR7K 2P6RA 4CCHA 2HOQA 5KFZA 1RQNA 1PZNA 1YIJN 3JPQA 3TAPA 3UPQA 2OZSA 4GXKA 1ZD5A 1IKVA 1IKWA 4CK1A 2MA1A 4ZOHC 4FL9A 4I28A 2GEMA 8ICYA 3KKRA 1VQ4N 4FK0A 3D2QA 5EWGA 4CJKA 1RPLA 2YJFA 3SI6A 4B6JA 4M3RA 3PO4A 4RW9A 4QWAA 3O1BA 4OKJA 2PYJA 4KTQA 2YB1A 4CGZA 3GFKB 3ZSYA 4KX3A 3PX0A 1IKXA 2CGJA 5T7BA 2F8LA 3P1GA 1NZPA 3IUCA 3SK3A 3L2WA 1JRPA 1D8LA 4OX9K 4Y2VA 2A1SA 5F3XB 2ZJAA 4DL2A 3RH4A 4IEEA 3PSFA 5HR7A 4DV7K 2WFAA 2FPKA 1DXSA 1SXEA 4C4RA 1ZXIA 1SGGA 5IIKA 4BVPA 1J5EK 1NOMA 1HQEA 4I7FA 3Q7CA 3JS6A 3DXMA 9ICFA 1BNPA 4XQ8A 1EKEA 4PL8A 1VSKA 2F44A 4M6WA 3CM5A 3DXKB 5KAFU 1A0PA 1Z4OA 7ICSA 4CF0A 4DCCA 3CERA 1BPBA 2GBZA 2KP7A 1JLBA 3C95A 3UKRA 2QB0A 4O3PA 3SQ0A 1Z00A 1WSGA 3CG7A 4M3UA 4B3MK 2W03A 4MF8A 1SZHA 2KZMA 4KMUA 2AHOB 2P9UB 3CHWA 4DV6K 1LV5A 5KFJA 5C2FA 3IMXA 3J7YP 5KT5A 7ICUA 4JV2A 1KVAA 3L4IA 4AH9A 8ICCA 2K8CB 2O4GA 4GKKK 4FYDA 1ZQ1C 5IIOA 1P7DA 8ICHA 4EHTA 2G8FA 2YX6A 4NLCA 4O5KA 2QWMA 2WFBA 4O55A 4OLBA 4LF7K 2ZUBA 1W9HA 4IR1A 1RYUA 2RQ5A 1KAZA 4CZIA 3UXPA 4KTZA 1O03A 4MLEA 4H8KA 3PW0A 5AHXA 4CJQA 3WXMB 2O8FB 1LAWA 3AQFA 1WSEA 2ASOA 4JK9A 2M9NA 4Y1CA 2JMGA 4KHPK 2KKZA 4IJAA 4BE2A 2F1IA 2W9BB 3BS5A 3ZETA 4DV1K 5D46A 1WWUA 1BHLA 3E01A 4FJ7A 2QK9A 4H5TA 1B9DA 3PV8A 4US8A 2ZXHA 5J2QA 1QTMA 1TK8A 5BPNA 2YX8A 1CRXA 4MFAA 2IVOA 2O8BB 4GNIA 2WF8A 4EZ9A 3ZT2A 3LAKA 4DU3A 1K1SA 2H5XA 3PW7A 4B1UB 9ICGA 3HT3A 3A5OC 3ISNC 5KL8B 5C5JA 1LKYA 4HCBA 2KE7A 3HJEA 1SV5A 3VENA 4FLWA 2VIXA 5J0WA 1MU2A 2P6UA 3CCLN 1FO4A 1XS9D 3I76A 2XY5A 2VQFK 2GLEA 4O3OA 3MFHA 3CCMN 4BY9C 5FPNA 9ICMA 4Y1DA 3QU7A 2E2PA 4JKGB 1WN7A 3K75D 3RJJA 2DFHA 4P0PA 1ZQUA 4RUCA 3RAXA 5FPEA 4IOAL 1ZQRA 1CXUA 4ELTA 1N36K 3S3OA 3F2DA 4ECVA 1J97A 2KLAA 3NH1A 1NU0A 3UQ2A 5KT7A 1OXJA 2NRRA 4DUZK 4CGIA 4WFAL 4NYFA 3LM2A 1NZBA 4KN4A 4Q44A 1NBWA 2ZUDA 4CEZA 3TAQA 3UXNA 4Z4IA 2JZBA 4USAA 4Y2XA 2W9CA 4F5OA 4GXJA 3MMVA 3GBTA 4BR0A 3H8JA 5ALHA 3WU2U 3Q8SB 1ZQQA 4CZFA 1XI1A 4PPXA 2RF2A 2XO7A 2BCQA 5J0XA 4H0YB 5AM3A 1KRPA 4DTXA 1UWBA 3WK4A 1QSLA 5KRTA 7ICQA 3HILA 1Q7YO 4BRMA 1NNLA 3ZDDA 1QHAA 5CP2A 3GU3A 4C1NI 1N63A 4UAUA 3M3ZA 4M9JA 2QI2A 3KVGA 5AZJB 3PLAA 4IC9A 4DWIA 5CEHA 3KK7A 4F2SA 1F5SA 2ZJ8A 4JB3A 4J9KA 2K89A 4ACOA 1NOZA 2VG5A 1VQMN 2BCRA 4KLJA 2NRTA 5B8HA 5C12A 3G6VA 3RWUA 1ILYA 1WG8A 4ZTFA 2IHNA 3G6YA 4BGDA 1SL2A 2GO7A 5JLHA 9ICHA 2EANA 2O8CA 2RHFA 1CI4A 4OKEA 5HMLA 3MR2A 3WNFA 4KREA 2UXCK 3LDPA 5AK3A 4Z6CA 1PVPA 1C1BA 1QQCA 3QEIA 2FDRA 3WKEA 3HKZF 4UB3A 2D6FC 3LDQA 4AM7A 3HVRA 1J2MA 4PWDA 4ED7A 3DAWA 5J2KA 5KI6A 1EETA 5HBMA 2OYQA 1Q86O 1RQLA 3D6JA 5G5HA 4IRCA 3QESA 1Q3VA 1JL1A 3CC2N 4HTUA 2IOFA 2GUIA 3ITHA 3MN6A 4YG2A 3CC7N 1V85A 3SAHA 5CR0A 3VA3A 2D0OA 4JLHA 3V9WA 4BGAA 7ICKA 4E1JA 1KD1O 1LCUA 5GTHU 5KFXA 5M1KA 4CW7B 4G9BA 4CIGA 1IIPA 2BQ3A 4NWIA 4DTUA 1DTQA 3GZFA 1RBVA 1WLJA 2CN1A 3L8BA 4CZHA 3C21A 1VQPN 2P51A 3HBTA 4JKEA 4CEEA 3C23A 1ZBFA 3J7ZO 4KHWA 3CF5L 2ASDA 4LF6K 5BREA 2R8GA 3SQ4A 4AILC 1X3NA 1GLLO 4EEYA 1NGGA 1NGAA 4OJ6A 3C6UA 1M1KO 4QW8A 2PYLA 3VN5A 7ICEA 3H1QA 3D2NA 3C94A 4GV3A 4FWRA 4BWMA 4KLUA 5C15A 1WAFA 2ISOA 3OS2A 3VEOA 3SJHA 4RQMA 5CE3A 4NL9C 2WF9A 4EEKA 5J2HA 1UOCA 3H40A 4O3SA 2P9SB 3TTCA 3V6DA 5J2MA 2X74A 5J0QA 1EWRA 3QFUA 2VQEK 1C6VA 5J2NA 5CRXA 1ZOLA 5HR6A 5CYQA 2MRLA 2O8EA 3KHRA 1XHXA 5AQIA 1N5YA 9ICTA 4QZBA 4DV5K 3TPQA 1I94K 4DTPA 1HNVA 4CESA 2JR5A 2ZIXB 2PFPA 1ZQWA 3M8SA 4BXOA 5HRSA 2PAVA 3AA5X 3CQ8A 4C7ZA 4F4WA 2XCAA 2W6KA 3SENA 4US9A 1CLQA 2WF7A 3ZSXA 4FJNA 1TAQA 3MXIA 1NGFA 4CZKA 1S3XA 5HRPA 4UATA 5KT4A 5A2QO 1JLQA 3VF2A 2FLLA 1HNIA 4LFAK 1BO5O 5DB6A 2VG7A 5EXWA 2G8IA 5KFLA 2LYHA 3PVXA 3NH0A 2FLPA 2AQ0A 3KK2A 3WXLA 4JV1A 3ZX0A 2E8MA 1TAMA 2D5RA 1HLUA 3HSCA 4BX9C 4CBXA 3VQ6A 2A1JA 2HBLA 5KT2A 2DWQA 5GINA 1LVHA 4YFUA 2OCEA 3D6RA 4JK8A 4BVOA 4Y2JA 2V4RA 2ZIUB 1XSNA 2YHAA 5J2DA 4P4MA 4RQ8A 4H5RA 4NV0A 3ULEB 3H08A 1X66A 4JWNA 3L2RA 4Q45A 3KLIA 2OXOA 3NF7A 4BQZA 1T8EA 4I2DA 4J2BA 3I33A 2I7PA 5AKYA 1XMQK 3O9SA 3MXMA 1XC9A 4GVMA 1U47A 1XU4A 3TAFA 3KLHA 4FZMA 4U7CA 1PVQA 3DWLA 5HRRA 3L4QA 3W0LA 2E1EA 5JICA 3SBTA 2GWSA 1Y97A 5SZTA 3F9MA 3KLFA 2EZXA 4BR4A 5AI0A 2QTDA 1WB9A 4J9QA 3GE1A 4BRDA 5AQGA 4ILGB 1QQ5A 4FJGA 3OYNA 2XGPA 9ICPA 2ASMA 1Q8KA 3C2LA 3SMPA 2RE2A 3MDQA 4UB5A 1TGOA 5EE1A 1GLAG 1RT4A 1H1VA 3OSNA 1VHXA 3EKUA 4BRIA 1MA9B 3MXJA 1XO0A 1NKCA 4BGBA 2XI9A 3F53A 1VQ5N 2CGKA 4QAGA 3HVTA 4UQGA 2P9UA 4IQWA 2WUSA 4IFVA 9ICQA 4RQ5A 3U3YA 1B43A 4LH4A 4JS4A 3FFKB 3R1XA 4W5NA 2OANA 5AQXA 3CJAA 1KDHA 4M3TA 4LFCK 2E8AA 2A1RA 3S6JA 4YCXA 4ECTA 4ZH4A 3SAFA 4ELUA 1QQNA 1DRGA 1XNSA 4J9RA 2J6SA 1P8ZA 3O9TA 1IG9A 1WUDA 4KV8A 4NM1A 4DSJA 2J6TA 2OH2A 4KTWA 2Q0ZX 3HSTB 3QLHA 2ZD1A 1KL9A 2JRZA 1SAZA 5AR0A 1UCVA 5DG8A 1NM1A 3VQQA 2OTLN 2YB4A 1W97L 4BR2A 5KFNA 2ZG6A 4CERA 3VETA 3F5AA 3FC4A 3QEBZ 1RNHA 4WQ5A 4MEYA 4LJXA 2O8BA 1T6CA 3KWGA 4JMUA 4JD2A 3CJ7A 1MSWD 3CI5A 4KLGA 2H3GX 1QH9A 3E9OA 1NJWA 3K59A 1ZD4A 3QZ7A 4CNQA 2QWRA 3R6MA 5JVGL 4E7KA 4IL6U 3KZBA 3J81j 4CJ7A 1L3UA 1NK4A 3F9KA 3QBWA 4JKGA 1QCKA 2FSKA 3V72A 1X3MA 1YJWN 3RJGA 4Q8EA 2WAQF 4JI7K 2HHSA 2Y0SC 3DLEA 4WFBL 1ZQZA 4M6WB 3GQCA 5DQGA 1BQMA 1JLCA 4E7JA 2JLEA 3CIPA 4H0TB 5AQMA 3CMEN 3QU9A 5L9XA 5DBAA 1K8KA 2HBKA 4JNEA 4YHHK 3HPOA 4WE1A 2QB0B 5ADXH 1Z00B 3BS7A 3OYKA 2Y9UA 3A5NC 3T1HK 1BIZA 4BRLA 1GLBG 3CFOA 4O5FA 4F4YA 4KRFA 3IFRA 2BR0A 4CBWA 4ECXA 4FWMA 5KFGA 3ID6A 2OYYA 4UAVA 2GV9A 1K5OA 3KHGA 3LM9A 5DDMA 4RT2A 4I2JA 2W6LA 5HP4A 2ZF5O 2W3SA 3TAGA 4CFAA 4LD0A 2IIRA 2Y1IA 5H1SQ 5AQTA 2XRIA 2E8OA 5KQ8A 5DDYA 4TUQA 1JCGA 1LW0A 3LP1A 4CHZA 5AZJA 4HWIA 1D8YA 4DR3K 4Y2YA 2YJEA 2QW9A 4ISEA 2HSZA 4BRNA 4ZTJA 1RTJA 1X9WA 5J2PA 4EP5A 3WKBA 1JLFA 1XO1A 5F0XA 2W42A 4FLTA 2E20A 3NGZA 4WYBA 8ICLA 1X40A 4ECWA 1P90A 3PW4A 4NCGA 1VQON 2KIWA 1CZBA 3AY9A 3BS5B 3CPEA 4LSNA 1RTIA 4C23A 4BACA 3V81A 1K1QA 1SB3C 3N7SC 3KD3A 1C0FA 1S5JA 3C7NA 4H4MA 1JLAA 3TQ1A 4H0VB 4EX6A 4NXMK 2X6SA 2D3DA 5KFHA 3VQ5A 4FPAA 3U8XA 1IBKK 1QSYA 1HQUA 2Y1JA 1JX4A 1JIHA 4NXNK 1HRHA 3T1AA 1I39A 2RN2A 3B0XA 3MWPA 3VTIA 1NWKA 4CJTA 1LKYB 4C80A 1BPDA 4DG1A 2WAQC 1XMOK 3P31A 3NUQA 5AI6A 1WNSA 4DFKA 4BWJA 5KTQA 3PO5A 3ZDBA 1VRTA 3MR5A 3QEXA 4Y0WA 2IOCA 3HX0A 1X6JA 1PVRA 2UYTA 2XHBA 2Q4TA 3ZDCA 3SYZA 3NVYA 1T94A 8ICFA 3PSIA 3JPTA 4W5TA 2JV3A 2YHYA 4A57A 3NF6A 3HP6A 2FPMA 1S9EA 1QZ6A 3MEDA 1HNZK 2VJ5A 1C0TA 5J2FA 3KHHA 3AU6A 3GOIA 3MN7A 2NRWA 1J54A 1HJOA 1HPMA 3O8MA 4NYNA 1VQ8N 1ZD2P 3IP4B 4IR9A 3OW2M 3TSPA 1KQSM 2O8DA 9ICLA 5KFBA 3TI0A 2JZBB 5BPLA 2W9CB 3PMLA 3U26A 1KW4A 2I7NA 2I6XA 3N28A 5M1QA 3TARA 1HUZA 1D9DA 3P4IA 1BGXT 5KGWA 2HNYA 3HW8A 1OH8A 1HNXK 4JHDA 1RDDA 5AI8A 3RB6A 3WNEA 5EOYA 5TZVA 1DGJA 2P9PA 2I5JA 5BN8A 2L5YA 4GY2B 4RT3A 3ZT3A 4C7YA 1YF5L 1DLOA 2VYPA 2WOMA 4KI4A 4IKFA 3HK2A 3IRXA 2HOFA 4QZIA 3GILA 1Q18A 1BVSA 2LMRA 5AK5A 5KG3A 2E5LK 1BPEA 3KLEA 5ALUA 5KNIA 4FPBA 3VEWA 5AIAA 7ICRA 3C65A 1J2NA 1Q9YA 1T3QA 4NO7A 4CJ5A 3WNHA 2PKEA 4FLXA 4BROA 2VWKA 3C1ZA 3BGRA 3FLCO 5KT3A 2LYBA 4HAIA 4PHDA 4CJEA 5F1XA 2ZTDA 3EUB2 3KK1A 4LF4K 2W8KA 4DSFA 3PX6A 3O4QA 4RNMA 3TABA 1XC3A 4PZOA 3VEVA 2ZJRL 5ALNA 4B9UA 4B1YB 3QUTA 5ALYA 3SCXA 3V9SA 3JPSA 4BG8A 4DU1A 3CJ9A 4DV2K 2UVWA 5CJ7A 1TKDA 1ZBLA 5AKLA 3FGUA 2JWLA 2HSTA 4DQIA 5KFPA 3DMJA 3MECA 3F73A 2R8IA 5J0RA 1QVGM 1IBMK 4JV5K 3NBPA 5IINA 4B08A 1EX4A 2OM6A 4YOTA 2KVSA 4DL5A 2OHFA 2KK0A 4J03A 7ICOA 1U48A 2Z1HA 4KLLA 5FRNA 3RMCA 4RQ1A 1UPHA 4UASA 4BDZA 3T5HA 2HNZA 1ZQBA 3QX7A 3OYHA 3F5EA 5SWMA 1WCNA 5J2EA 2VCPA 3CMAN 3CETA 2OEHA 4RPYA 1K8AO 3RJEA 2ASJA 3ENHA 2LYAA 4UBBA 3Q8KA 3KJVA 4LF9K 4LH5A 1ZRMA 1COOA 2A1AA 2N1RA 3FE1A 4QWBA 4QOZB 3UMGA 5DK5A 4JI5K 3DLHA 8ICGA 3IM1A 3CFRA 5DGBA 2KHOA 2P35A 2NRVA 3OYAA 5HNKA 3ZX3A 2PFOA 1KVCA 2YMLA 5L1MA 2CH5A 2LSNA 4CF1A 2E2OA 3OHAA 4JI0K 4LF5K 2WC9A 2BANA 3KTQA 3IKMA 4W5QA 2B5JA 2Q3SA 1RBTA 2KW4A 1Y64A 5J8YA 4GVEA 3PW5A 1VSFA 4NLKA 1L3VA 1KAXA 1RDFA 3JPNA 5C42A 5AKHA 4CRXA 3PX4A 1RM6C 3VGLA 4E19A 5B5EU 3SR6A 4B1VA 1Q46A 2M0NA 4WQ4C 1IO2A 2EZZA 4I2EA 1VSDA 4DR6K 4DFDA 4YD2A 4Z6DA 4CF3A 3HPHA 3SV3A 2O8EB 3L5KA 5JTIA 8ICEA 4FSVA 2G08A 5LL6Z 3I56N 5DBCA 4RQ0A 3C6HA 5FPMA 4CZGA 2QWNA 4OJOA 3JAMO 3ISDA 3CFPA 2IVNA 1HR0K 4UB8U 4KKOA 4BXOB 1TK5A 3MDAA 4P0QA 5TKWA 1T03A 1BPXA 3V9ZA 4G9ZA 5AQFA 4KLOA 4JI1K 4BRAA 1KVBA 3EY1A 2B21A 3LVVA 1KFTA 1U9LA 4C0ZA 3AVFA 2ES6A 4J9SA 3D45A 3CCRN 4OGEA 2RRDA 1YJNN 1GLFO 2D0BA 1JUDA 3OA9A 5AQKA 5AFUH 3ZD8A 3DRSA 4C8MA 5KFEA 1S0NA 3R9KA 5L1IA 2A1JB 1BNOA 3ONNA 1X9JA 4XH4A 1WSHA 3ED5A 2WHEA 1ED1A 3C5FA 4BRCA 2EAPA 8ICOA 4C8NA 3AVGA 4JKHA 5GIOA 5J0YA 4KHQA 4FO6A 4RG8A 2KIVA 2DBYA 3L3FX 4O5CA 3TU5A 2K8AA 3RBEA 3A5MC 1HUXA 4RZRA 2KNJA 2YHBA 5IIJA
chains in the Genus database with same CATH topology
3MR3A 4M04A 1ZQEA 1VQLN 5KFUA 4J9LA 5AQJA 2OTJN 1X9SA 4UY8O 5CB1A 4RQ6A 2GX9A 3CCJN 4FBUA 5GIPA 2FLOA 4C1NK 4JKCA 4B9TA 5KFSA 1UA0A 1ZJMA 5BRHA 3H3OB 4IQVA 1NK0A 3DJCA 4IOXA 5I9EB 3VGKA 4B9MA 1YUWA 2BGWA 3GV8B 4KLIA 5AFUA 4CZEA 2AGOA 5HMMA 4DL4A 2E88A 4IXCA 3QB0A 5J0UA 4O3RA 3RH5A 4DLGA 2NLXA 4DKWA 4RNOA 3D2EA 3ZEUA 2PI4A 4RQ2A 1MDUB 2VWBA 5CHGA 3LL3A 4LC9B 3U9DA 5E84A 3LWLA 3V6HA 1U6ZA 5AQZA 2DPIA 4O0IA 4K4HA 2ZJPL 3RJFA 3A0IX 5AZIB 4FWQA 7ICLA 1QVFM 4NLNA 1BA1A 1T7PA 4BRGA 4JD2B 3JPRA 3GIJA 1HX1A 3T69A 4YOWA 3UXOA 2HVHA 8ICPA 2XC9A 1QZ5A 4RNNA 3EE8A 4M47A 4M2YA 4MFCA 2ISPA 4H5VA 2UVVA 4DQSA 4FVUA 9ICRA 4ED3A 5C2DA 4NLGA 2GWKA 1K8KB 3QFPA 2FMQA 9ICCA 1KFDA 4ED8A 5EX5A 3K9JA 1Y88A 2DPJA 3F2KA 3MWTA 3PR4A 1NJIO 1S97A 3VEZA 1U45A 7ICFA 3QE9Y 3KHYA 3AU2A 4JEPA 2KN7A 3ISCA 3RJKA 1SKSA 3DLLL 5LJVA 4GV9A 3C2KA 3CJ1A 4DQ8A 3WQUA 3AAQA 3EPGA 3J8AA 4M9LA 5AQOA 3WUHA 3SI8A 5DBBA 4F91B 5BPMA 4QWEA 3C7NB 5ELZA 5DM6L 3M9OB 4YD1A 3CPWM 3T7ZA 1DGSA 5KFQA 2AU0A 5EOZA 2FPLA 2D1KA 1ZQHA 4I6MA 5L1KA 4C8OA 2D0PA 4EYHB 3C2MA 2IVPA 4DQPA 1NGBA 3C1YA 3B0YA 4IO9L 3O9RA 3ISBA 9ICSA 1MQ2A 2P9IA 3NGDA 1LB2B 4I2IA 4BREA 4JK1A 5KFDA 3H4BA 3EZ5A 3U9ZA 1S10A 4IQUA 3O08A 3LDLA 4H5NA 3P38A 5L1JA 4HYKA 5M1OA 4QS8A 5KPZA 2VGMA 4JHDB 3CXCM 3RRGA 1NGIA 4IZ9A 4R8UA 2P9PB 1BOTO 2J4RA 3IDHA 1B22A 4RPZA 3RTVA 4IDHA 3QZ8A 2ALZA 2AQ4A 4PKIA 4DO9A 2QWPA 2UVRA 1N56A 2AGQA 4OPAA 5BRFA 4O3QA 3A5LC 4F5QA 3MCAB 1VQNN 5BOLA 3BQ0A 5J2JA 1T6DA 2ASLA 1X9MA 5DB9A 1JCFA 4KITB 5AQLA 4Z94A 1U4BA 4YFKA 2Q0UA 3C5GA 5J0PA 3T5KA 3H7IA 8ICKA 5BN9A 1V9PA 1K9MO 2PFQA 2JWKA 3D2FA 5EVZA 4ISFA 1QSSA 5KFFA 3OHBA 3HZ6A 5AQYA 3H8WA 4NLZA 2Q36A 2HMPA 4BRFA 2BUPA 5J2AA 4PHPA 2HHXA 4EFHA 1L5UA 5J0TA 3FZFA 1L3SA 3M1FA 5CHIA 7ICMA 4DL6A 1UA1A 3ZD9A 1S76D 4ECSA 3ENOA 4NLBA 4A61A 4BRHA 3BP8A 3GL1A 1ZQPA 3MGIA 1S22A 1ZC6A 3CJBA 3QMLA 4YXJA 3CJCA 4DQQA 1OVYA 1SZ2A 4E0DA 3SLCA 3BDPA 2ITMA 5HL7L 4EYIB 4PH5A 3TANA 4XH5A 4RWTA 4TUSA 3AAPA 2F7TA 4B9SA 4FWNA 4DSLA 1A76A 5J0SA 3EN9A 1L3TA 1QQMA 4EBEA 2PBDA 2KZZA 3NMUA 1KTQA 3PIPL 4GC7A 5JUMA 4FWSA 3CD6N 2I9GA 3UKUA 4P4PA 4KLEA 4FOIA 3T5JA 3T3FA 1ZYQA 1SQKA 3MN9A 1Q81O 2VA8A 3MX2A 3EYZA 5AZIA 3C0BA 2ASPA 2ZJ5A 4A62A 2NZTA 5KFKA 1NGHA 4K4IA 2A40A 4H5WA 4A5AA 4A59A 5GAEP 3OHRA 3G4SN 4G3IA 2NNWA 4GXIA 4KH4A 3C6AA 4LVSA 2MAXA 1RYRA 2P9KA 3UQ0A 4TURA 2ZUCA 4A5BA 4NM2A 4ELVA 4YDUC 4EBDA 5IIMA 5EWEA 4RQ4A 1NGJA 4JKFA 2ATLA 3RJIA 5DQHA 2AGPA 4KLDA 1E4GT 4QZ8A 4QZCA 1ZXOA 3TFRA 4RQ3A 8ICIA 3MDCA 4RPXA 2HF3A 2YHWA 4MF2A 4IEIA 4LZGA 5JLFA 5KG2A 1ZQOA 4ILHA 5D49A 3N97B 5DKWA 3D2EB 3ZEUB 3K4GA 4UBCA 3GV7B 8ICQA 1H38A 2BPFA 2BHNA 4ECQA 2HBMA 3MR6A 3RB4A 1DOQA 3HI0A 1KEJA 2BPGA 3MBYA 1SL0A 1TFRA 5BR9A 3KWIA 8ICSA 3FYHA 3THVA 4YMOA 4DS4A 1WUAA 2YCHA 3V7KA 1YXQA 3WXIA 3CCVN 1ZJNA 1ZQYA 2BH1A 8ICMA 5M1NA 4QZHA 5KFTA 4F2RA 4FO0A 4JK7A 2A41A 4KBOA 3VERA 1YAGA 1LOTB 5JMVA 5E26A 4RU9A 4YQWA 4C8KA 1ZETA 3Q8QB 8ICJA 1TAUA 4YVZA 3ETLA 3TFSA 2HVIA 4YR2A 3HOSA 1NLVA 4QZAA 5BOMA 3QDKA 4DB3A 1U49A 2W8LA 4PKHA 4F4XA 2NRZA 7ICPA 1DT9A 3E2EA 4ECUA 4QZDA 2BQUA 3R8EA 3EWAA 3Q8LA 2W40A 4CZMA 4RUAA 3R9PA 4BC4A 3LDOA 7ICJA 4J9OA 3I55N 4U7BA 5AQHA 2PXIA 9ICOA 4Z6FA 1HKGA 1XUPO 1Q82O 5KPTA 4OO1J 4C8LA 1UT5A 1BUPA 5HOOA 1ATNA 4B9VA 5J2CA 1MWKA 2P9LA 3O80A 2A5XA 3MK6A 4JN4A 4FWKA 4F92B 4K41A 4KN7A 2RDJA 3NTUA 8ICZA 3M8RA 3PR5B 4R64A 1M90O 5KFOA 4XH1A 4F50A 1O13A 3F5TA 4U67L 2R8KA 7ICHA 4CD3A 2JEIA 2E2NA 3A8YA 4I6MB 4BDPA 1JN3A 2VA3A 2HW3A 4QZ9A 1ATSA 4B9LA 5CWRA 1NMDA 2P9IB 4J9NA 2C28A 3EW9A 4DCHA 9ICEA 3MCPA 3PIOL 2Q0RA 4ISGA 3M9NB 4KLSA 2VANA 2AP1A 3VPZA 1ZQLA 9ICWA 4I2AA 3IHQB 1DGKN 5EY4A 5F9LA 1S0MA 3WXJA 2BTFA 4R8UB 3GDXA 4K25A 1CUKA 3BF1A 2JEGA 1RDUA 3KHLA 3MGHA 4ILJA 1XSLA 4WF9L 4M9GA 4DFMA 1ZQJA 4IRDA 1ZQKA 3VTHA 1YITN 4J9PA 3H3NO 3OJSA 1BPZA 1K73O 4Q8FA 4TQRA 3EO3A 4JKDA 3FDSA 4F4ZA 3U4LA 4DSKA 3EL2A 5J29A 1NK5A 3BQ2A 3D2FB 5AQPA 2P9NB 1EXNA 3S41A 8ICAA 1QLNA 5KG4A 3HRGA 4YP3A 3VEYA 4H0PA 4O5EA 3G6EN 3AUOA 4FWPA 5M1FA 1VAZA 2XY6A 2V4QA 3O9UA 3P39A 4O8UA 4ED2A 2KZ3A 3LK9A 1DKGD 3WXKA 4NY8A 3V6JA 1HKCA 3JPOA 1TUYA 4I29A 5J2GA 3N4MB 1JMSA 3FZKA 1SKWA 1IXRA 3V6KA 1RDWX 3K9KA 4YXMA 4JWMA 4XUSA 9ICIA 1A77A 5IILA 2FLNA 5AQQA 4H0OA 1TYQA 4J8FA 4L3QA 2A3ZA 2C22A 4UB2A 4FS1A 3SBGA 2IMWP 2ZGZA 3BEXA 4YOVA 1RXVA 3HTVA 4MDBA 2ZGYA 1Z3EB 4GC6A 2AJQA 1NKBA 4MDAA 4KLHA 3G25A 5J0OA 3UKUB 3B8AX 4WCEL 8ICTA 4QW9A 1YHQN 2D4WA 5KFCA 1S9FA 5KT6A 3PW2A 4I2BA 4QZFA 1VQKN 2E2QA 5DB8A 4BR9A 4MFFA 4MO4A 3G71N 1HUOA 1NJYA 1HKBA 1RZTA 1TUUA 5TKYA 3ORYA 2GUPA 1GLDG 3N4QA 4BRPA 4B1ZA 1C7YA 1OKJA 9ICJA 2P9KB 1NGCA 3RAQA 1IM4A 4DS5A 4CI6A 5AQVA 4YOYA 4OPHA 4M7XA 4H0XB 3FZMA 3L0QA 1ZQIA 3OSPA 2HHTA 2FF3B 3MFIA 4QS7A 1YI2N 4NXZA 3CQXA 4I2HA 4XA5A 3E9PA 1S0VA 3SV4A 1DEJA 4YORA 4QWCA 4P2HA 1BPYA 1W2BM 2Q1NA 5BPCA 5KFRA 2C2DA 2QEXN 7ICVA 1YVNA 1GLJO 2NRHA 3NVKA 4CZJA 2GTDA 2V9WA 3HM8A 4EAHD 4WQ4A 3LDNA 4I2CA 4M9HA 2WBNA 3BF3A 4F5RA 3RH6A 2A6AA 4BRKA 3RSEA 3EPIA 5GAHP 2KFNA 1BG3A 2CGLA 3W3DA 4DEZA 8ICRA 4I2GA 5AQUA 5IIIA 2P66A 5DLGA 3OBWA 3GDQA 3OBYA 4A2AA 3CQYA 3WEEA 1NJZA 5KQDA 4M9NA 3CCEN 3V7LA 2MUTA 4WQ5C 3RR7A 3VOVA 1QQOA 5C0YA 1G99A 3EZWA 3UE5A 1ZQGA 3EE9A 3H46O 2FMPA 5HHHA 3CCQN 3EKSA 4UB4A 2QWLA 4JUZA 4DOAA 3M9MB 4GLXA 5D4BA 1E4FT 2WTFA 4DF4A 3OGUA 3Q8MA 4MLHA 3O4WA 5KG5A 3NVMA 4R66A 4RCHA 3R3LA 4CD1A 3LWMA 3O5BA 2W41A 1BU6O 5DG9A 3GIIA 1XSPA 3E1YA 4FBTA 1JXEA 4PHEA 5KFVA 1YJ9N 2P9LB 3ZYYX 3SMSA 7ICTA 2FSJA 4R65A 1KXPA 1Z05A 1TK0A 3TTDA 1D4XA 9ICAA 2VGNA 4IQTA 1ZQCA 2V7ZA 2KFZA 4YMNA 3RBDA 2PI5A 5KG1A 1EQYA 2PFUA 5L1LA 8ICUA 1BWFO 4K42A 2YI1A 5LJWA 5KFYA 1JCEA 3Q8PB 2F9TA 2QXLA 4UB1A 2HF4A 2IA6A 1N8RO 1D9FA 1TVAA 2P9NA 4IOCL 2NRXA 3PY8A 3VEXA 5AQNA 4J9MA 5M1PA 4IWVA 3FZLA 1U2VB 4ECYA 2Q2RA 5KPRA 5KFAA 2DPNA 3BQTA 3O9QA 4YOXA 4GV6A 4QWDA 3BJYA 4DHYA 4O8KA 3BQ1A 5F9NA 4DSIA 1SZPA 4K4GA 3ATVA 4Z6EA 1ZQSA 3ZDAA 1T44A 3QBXA 4JAXA 1RGIA 2HHVA 4RQ7A 4F9OA 9ICXA 5AQWA 4JV0A 1C0GA 4KLQA 2QWQA 1R59O 3I8BA 4F5PA 1ZQMA 1XQSC 4DL3A 3GIMA 2F1JA 3JPPA 2ZTCA 3RR8A 4AF1A 4DOCA 4F4KA 2JEJA 4UAYA 5EWFA 4IFEA 4BC2A 8ICNA 9ICUA 4DFJA 2YHXA 1MQ3A 3VGMA 2FXUA 3ENBA 3DXKA 4B9NA 4DF8A 4RTFD 2R8HA 4ECZA 1KLNA 2R8JA 3QICA 5J2BA 2DFLA 1HJPA 4ED6A 5AQRA 4FS2A 1NKEA 3H4DA 2BQRA 1ZQFA 4EBCA 7ICNA 2RHKA 4NB4A 1VQ6N 4CZLA 1GLEG 3N4PA 3PNCA 2F1HA 3SAGA 1N48A 2XGQA 2E1YA 1UT8A 4WFNL 1RYSA 2W9MA 1RFQA 4BR5A 5KG6A 1MC8A 5DQIA 4DOBA 1CZAN 2W9BA 3E66A 3O1WA 4TQSA 1KC8O 1XWLA 2QA4N 3H45C 2J6UA 4MO5A 2GELA 3ZX2A 1EO1A 4UAZA 3ZDEA 4FWOA 1NK7A 1ZQVA 2Q97A 1V4TA 4PL7A 3RVCA 7ICIA 4KH5A 2IHMA 2CH6A 4B9QA 4PGYA 1NGEA 3CC4N 2BKEA 4PHTX 4KLMA 4I2FA 4DQRA 2JEFA 1KSPA 9ICBA 3DXMB 1ESVA 1SS6A 5CA7A 1TYQB 3FR0A 2V52B 2XY7A 4F93B 4EIAA 3UKRB 3PMNA 2KTQA 1T3NA 1NGDA 4B1WB 4O3NA 3OJUA 2Q31A 2HHQA 1VQ9N 4YN4A 1IG8A 5FPDA 4PHAA 1BDGA 4K43A 2BPCA 8ICVA 9ICKA 4BG9A 4JKAA 3G6XA 8ICBA 5KFWA 3L6QA 4YR3A 2FMSA 4CBUA 1ZQTA 2ZWHA 4QS9A 3V7JA 3TSUA 3RRHA 4F5NA 2OWOA 5GADP 3MN5A 3HWTA 3ATUA 3UB5A 5CR4A 4PGQA 2QM1A 3GIKA 3HOTA 3MABA 3ZETB 1KAYA 4ED0A 1NK8A 2BDPA 1RXWA 4O9MA 1CEZA 2AA4A 1ZQAA 4QZEA 2C2EA 4EZ6A 5DG7A 4BQLA 5J2IA 4IJNA 2V7YA 2XCPA 3O6WA 2HHWA 4HTLA 1BA0A 5LY3A 4TUPA 4FWLA 5DLFA 4UAWA 2VA2A 5ADXA 2BCVA 3WQTA 2FSNA 5DB7A 4IO8A 1SL1A 2HOEA 5KFMA 3FZHA 1S77D 3Q8RB 9ICVA 4BR7A 2GWJA 1Z6RA 1WOQA 5GAGP 4ED1A 4I27A 2EWSA 4YMMA 2IBKA 2PFNA 4KH6A 2C2RA 4XEIA 3GV5B 1NJXA 3M5RA 2FF6A 3AGRA 3AGKA 3RSEB 3JXUA 1VQ7N 2P9SA 4B1XB 1ZQNA 3QEAZ 5C10A 4FOEA 4AM6A 1JJ2M 5BRDA 3ID8A 2I1QA 4BRQA 4KLTA 1IJJA 3MX5A 3VMFB 4F3OA 2V51B 4DLEA 3WEEB 4YOUA 2MUTB 3SZ2A 4DFPA 1TV9A 8ICXA 1S72N 3WT0A 4BC3A 3RB0A 1AROP 2E1ZA 1U2VA 4M63C 4PGXA 4DL7A 2A42A 3D7EO 3H6EA 1MWMA 3CCUN 3GG4A 4EHUA 2QWOA 4P4OA 4IRKA 9ICNA 1GLCG 4M0AA 5KFIA 2BCSA 3H1VX 4R79A 2F9WA 1T4GA 3TSQA 1WCLA 3ULEA 5JVHL 4YDUA 3AARA 1T3VA 4XRHA 3E9LA 5DM7L 5KG0A 4DSEA 5F2RA 4BC5A 4ECRA 4A2BA 5KG7A 1KFSA 8ICWA 4QZGA 3BUZB 1NK9A 1JXLA 3M6GA 3LDAA 1ZQDA 3T5LA 1SKRA 2HHUA 5HHIA 1ZQXA 3RB3A 4X5VA 2RDIA 7ICGA 2HBJA 4H03B 1X2IA 4LZDA 3VF6A 3VESA 1ATRA 2UVUA 5AQSA 4MEXA 2ZTEA 4F8RA 3H8SA 4PKGA 3TTFA 4YR0A 3Q7BA 1ZBSA 1NK6A 4M7YA 1S0OA 4KLFA 4Q43A 2W9AA 5MLCQ 2ZJQL 4R63A 5DGAA 1J6ZA 1V4SA 2BCUA 3RJHA 4JKBA 3CCSN 2P6RA 4CCHA 5KFZA 1PZNA 1YIJN 3JPQA 3TAPA 3UPQA 4GXKA 4FL9A 4I28A 2GEMA 8ICYA 1VQ4N 5EWGA 1RPLA 2YJFA 3PO4A 4QWAA 3O1BA 4KTQA 3GFKB 3PX0A 2CGJA 3SK3A 3IUCA 1D8LA 2ZJAA 4DL2A 3RH4A 4IEEA 2FPKA 4BVPA 5IIKA 1NOMA 3Q7CA 3JS6A 3DXMA 9ICFA 4XQ8A 4PL8A 4M6WA 3DXKB 7ICSA 3CERA 1BPBA 3UKRA 4O3PA 1Z00A 2KZMA 4MF8A 4KMUA 2P9UB 3CHWA 1LV5A 5KFJA 5C2FA 3IMXA 5KT5A 7ICUA 4JV2A 3L4IA 8ICCA 5IIOA 8ICHA 4EHTA 2YX6A 4O5KA 2QWMA 2WFBA 4NLCA 2ZUBA 4IR1A 1KAZA 4CZIA 3UXPA 4MLEA 3PW0A 3WXMB 2ASOA 4JK9A 2M9NA 2KKZA 4IJAA 2F1IA 2W9BB 3ZETA 5D46A 4H5TA 3PV8A 1QTMA 1TK8A 5BPNA 4MFAA 2IVOA 4GNIA 4EZ9A 1K1SA 2H5XA 3PW7A 4B1UB 9ICGA 3HT3A 3A5OC 5C5JA 3VENA 5J0WA 2P6UA 3CCLN 1XS9D 2XY5A 4O3OA 3MFHA 3CCMN 4BY9C 5FPNA 9ICMA 2E2PA 4JKGB 3K75D 3RJJA 4IOAL 1ZQUA 4RUCA 3RAXA 5FPEA 1ZQRA 4ELTA 4ECVA 2KLAA 3UQ2A 5KT7A 2NRRA 4WFAL 3LM2A 4KN4A 1NBWA 4Q44A 2ZUDA 3TAQA 3UXNA 2JZBA 2W9CA 4F5OA 4GXJA 3MMVA 3GBTA 4BR0A 3H8JA 4CZFA 3Q8SB 1ZQQA 4PPXA 2XO7A 2BCQA 5J0XA 4H0YB 1KRPA 1QSLA 7ICQA 1Q7YO 4BRMA 3ZDDA 1QHAA 5CP2A