2NRWA

Crystal structure of the c terminal half of uvrc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
217
structure length
204
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHTVASLVVFEDGFPKKGDYRRYKIEQDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 63
structure length 204
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrwA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrwA01
8ICQA 4R8UA 8ICCA 2AJQA 2W9MA 3UXPA 2NRWA 3TFRA 4GXIA 3HPOA 4P4OA 4B9UA 1ZQNA 3JPPA 3G6XA 1ZQIA 4F2SA 9ICXA 2NRZA 2XY5A 1KEJA 9ICUA 4DFPA 5KFQA 3C2KA 5KFGA 1BPDA 3K4GA 4PHEA 4TUSA 2PFOA 1CEZA 8ICAA 1D8YA 8ICVA 4JV1A 5IIKA 3HT3A 1Z00B 3BQ1A 5L1JA 4TQRA 9ICOA 1KLNA 3ZDDA 4DL7A 3RH4A 1ZJNA 4QZHA 1BPZA 1BPBA 4IQTA 1UT5A 2C22A 1NK6A 4FS2A 4K4IA 5J0TA 5KG6A 3KHRA 4ECTA 7ICSA 2MUTB 1SL1A 2KN7A 2FMPA 4ECYA 1TKDA 4F4XA 3H8JA 1TAQA 3GIIA 1SZPA 4XRHA 3EPIA 4DOAA 1ZQMA 2R8JA 9ICKA 2WTFA 2J6TA 2A1JA 3JPOA 1AROP 1U9LA 2JZBB 8ICWA 4BWMA 3GDXA 2LYHA 3FYHA 4NM1A 4QZ9A 5KFTA 1DGSA 3MFIA 5L1KA 1U4BA 3GV7B 2ASDA 1T4GA 3LDAA 3V6JA 4C8KA 4RT3A 4F5QA 4F93B 5CP2A 5KFXA 5IINA 1JXEA 2PFQA 2ZJ5A 2Y1IA 1TK5A 1NK9A 4NLNA 4RQ8A 2BKEA 1L5UA 4M9GA 1TK8A 4Q44A 4UAZA 4ECVA 3MABA 1RXWA 1TVAA 4UB5A 4RZRA 3V7JA 4UAWA 4DFKA 3PX4A 1QTMA 3LK9A 4RQ0A 2HHVA 9ICWA 1BVSA 3BQ0A 4RPYA 3PX6A 3RR7A 4I2AA 1HJPA 4YP3A 8ICKA 4KLJA 5BOMA 1IM4A 4I2HA 4DF4A 2P6UA 1NK0A 5HMLA 5CWRA 4ECZA 1D9FA 1JX4A 1WCLA 1KFDA 5JUMA 1BPYA 3SV3A 8ICEA 1SKSA 4TUQA 3HP6A 4ED3A 1SKRA 4C8OA 4F2RA 3NGDA 4NXZA 4RQ4A 3MR6A 5DDYA 3JPRA 2AQ4A 2NRVA 5KFIA 4DSKA 1NK4A 3C65A 4QWEA 2J6UA 4Q8EA 5J2HA 4YVZA 5KFCA 3H8WA 4I29A 4I2EA 1XSNA 5KT5A 5KFMA 1X9SA 9ICVA 1NKEA 5DQHA 4IR1A 3RH6A 4PPXA 4RQ7A 4GLXA 4DQQA 3PNCA 1QSYA 4I27A 3QEAZ 8ICBA 2HVIA 3FDSA 3RJKA 3M9NB 1NJZA 1KRPA 3PW4A 4J9OA 4R65A 4M2YA 5KG4A 8ICLA 5J0SA 1NOMA 2ZTEA 4R64A 4F50A 4GC6A 4R8UB 2R8HA 3UQ2A 4E0DA 7ICTA 3ZDCA 4F4KA 4UB3A 3GILA 1DOQA 4RU9A 1Z00A 1ZETA 4YN4A 4DSEA 4NLGA 4YXMA 1S10A 4ED6A 2OWOA 5J2KA 2UVUA 4RQ2A 4FO6A 2IBKA 4ECQA 1S0VA 5J0WA 8ICHA 4RNMA 2NRXA 4PGQA 3RBDA 1T3NA 1KSPA 1Y88A 3C2MA 4UB4A 4ECWA 2A1JB 2DPIA 5DB8A 3HWTA 2FMQA 1XWLA 1ZQDA 4GC7A 5KG2A 4DWIA 4B9SA 4K4GA 4YD2A 2AGQA 2HHSA 2XY7A 1XS9D 4X5VA 2B21A 5J2DA 5KG5A 3JPTA 7ICKA 4DLEA 2IMWP 1RYSA 2I1QA 3RR8A 2FLNA 2IHMA 2BCRA 4I2BA 5DLFA 7ICMA 3ISBA 4J9KA 2C2EA 3N4MB 2IHNA 1JN3A 1T7PA 4YFKA 4J9MA 4JWNA 4BWJA 1XU4A 1MSWD 3TQ1A 2W9CA 4J9QA 9ICBA 3PX0A 1X2IA 4UB2A 4B9TA 4PGXA 3PW5A 2JEFA 2XGPA 4JK1A 5KFLA 4DEZA 2XCAA 3C5GA 2XGQA 4F4YA 2KZMA 4YXJA 3Q8PB 5J0YA 5HHIA 2W9CB 1D8LA 4DOCA 9ICNA 1KFTA 2VA8A 2ISPA 4IRDA 7ICHA 1BPEA 4QZAA 3G6YA 1CUKA 3MR3A 3BDPA 9ICHA 4I2IA 5DG8A 4DO9A 2XO7A 2F1HA 7ICVA 1SKWA 2BPGA 4M9LA 4K4HA 4ECSA 4DL2A 5KFBA 1L3UA 8ICYA 4LZGA 3Q8SB 1BPXA 4JUZA 2F1IA 3OSPA 5J0XA 4F4WA 5DQGA 3GIKA 2AGPA 8ICPA 3UXOA 4MFFA 3EZ5A 5KFRA 5EWFA 1ZQBA 3RJIA 4BDPA 3ZD9A 1QSSA 4EBCA 3RBEA 4KLOA 3IHQB 3TAQA 7ICPA 1TFRA 4IQUA 2BQUA 3H4BA 1WCNA 1JIHA 3EPGA 3PO4A 9ICMA 5KG3A 4RQ5A 3E2EA 1C7YA 1HUOA 4DSLA 4IQVA 4M6WB 5DGAA 2BCUA 4KLEA 2HHXA 8ICUA 3MGHA 4DL4A 4FBUA 5HMMA 4RNNA 4ECXA 1IXRA 5F9LA 4QWDA 4DS4A 4MEYA 3AU6A 3Q8QB 1XC9A 4F5PA 2FMSA 8ICOA 3V6KA 2HHQA 2NRTA 1ZQAA 5KT4A 4EEYA 4R66A 3RAXA 5CR0A 3B0YA 2HHTA 2HHUA 2PI5A 3RTVA 2KTQA 8ICFA 4M47A 8ICIA 1LV5A 3PMLA 4NLKA 3SI8A 4FS1A 4O5KA 2HW3A 1COOA 1X9MA 4O9MA 1RPLA 3K75D 5DBAA 3JPQA 3M8RA 4J9PA 5DB6A 3OHAA 1MC8A 3SYZA 4KLFA 4JV0A 5KFPA 2ISOA 4NLZA 1MQ2A 4XQ8A 2JEIA 2BDPA 2R8IA 4EYIB 2Q0ZX 5EOZA 3LWLA 4YR0A 3T5KA 2KFNA 2UVWA 5KG7A 9ICFA 1UA0A 1NJYA 1S97A 3PVXA 4RQ6A 1S0OA 4MEXA 5IIIA 4BXOB 4I2GA 4F5NA 1T8EA 3H8SA 4MFCA 1ZQFA 4DQRA 3C1YA 4KTQA 3BQTA 4EYHB 2BPCA 2FLPA 1ZQHA 2BGWA 4XA5A 4B9MA 4RPZA 2W8KA 5IIMA 1ZQJA 2JEGA 3T5LA 4DLGA 4GXKA 4Z6CA 1NK5A 4QZDA 4O3QA 3HW8A 2RDIA 2P66A 3H4DA 2ATLA 1TAUA 4RPXA 3PW7A 1LB2B 4CCHA 3TAPA 4EZ6A 4QW8A 2RDJA 3V7KA 1XO1A 2AQ0A 3C21A 4RQ3A 4DFJA 2ALZA 1D9DA 5IIJA 2BCQA 3RJEA 3OHBA 3ZDAA 2ZUCA 4Z6EA 5BOLA 3QEBZ 9ICCA 2MAXA 4P4MA 5DLGA 4QWCA 3C2LA 4J9SA 1X9WA 1RXVA 5J2JA 4O3PA 4BGDA 3Q8KA 5KFHA 3ZDEA 5KFEA 4TQSA 1U48A 4LVSA 4KN4A 5J0PA 2C2RA 2P6RA 4YD1A 1ZQOA 1S77D 2M9NA 1ZQTA 5HHHA 4YCXA 4KLLA 3ETLA 4QZCA 3RRHA 2HHWA 3OSNA 2FPMA 1B43A 2ZJAA 3EW9A 1SL0A 5F9NA 5KT3A 5DBBA 3PMNA 2ASLA 1ZQSA 4I2DA 1QSLA 2XY6A 3QZ7A 1ZQCA 3PR5B 2PFPA 8ICJA 2Y1JA 1TV9A 2BCVA 1Z3EB 5KG1A 4TURA 2XC9A 3RAQA 1S76D 4ZH4A 2JEJA 5J2IA 3KHHA 3BJYA 4I2FA 3GIMA 4QWBA 5IILA 4M0AA 5KT7A 3H7IA 3OJSA 4KLQA 4ED1A 4KLIA 3PW2A 1KFSA 2FPKA 4YMOA 7ICOA 1N48A 5EWGA 4RUAA 4UQGA 1ZQQA 1ZQUA 5KFNA 5KFOA 3UPQA 1ZYQA 3PO5A 3G6VA 8ICXA 2XCPA 4TUPA 4C8MA 2F1JA 2BHNA 4O3NA 5KG0A 3PR4A 4DS5A 5HNKA 1U49A 1ZQGA 3RB3A 4QZ8A 5TZVA 3OJUA 3M9OB 5DG7A 7ICRA 3T5JA 4J9LA 4ED8A 4RQ1A 5KFWA 4NY8A 1JMSA 4QZFA 5CA7A 1L3TA 7ICJA 4EBDA 5J2CA 1S0MA 3UQ0A 5IIOA 3OGUA 9ICGA 5DKWA 1MQ3A 3KHLA 3JPSA 1ZQPA 4R63A 2W8LA 2ZJ8A 5CJ7A 3TARA 2IA6A 1U45A 4YMMA 4DOBA 8ICRA 3HX0A 2FLLA 7ICIA 5L1IA 4Q43A 4DFMA 2V4QA 3ORYA 3LWMA 4J9NA 5KFSA 5J2FA 3Q8RB 2VANA 3TANA 4Z6DA 3C5FA 4ED0A 3T5HA 5DB9A 3AUOA 3PW0A 4QWAA 7ICEA 4UBCA 9ICLA 3MFHA 9ICAA 1QLNA 1K1SA 5KFZA 1UA1A 4I2CA 4LZDA 5KFYA 4ED2A 1SL2A 3RB6A 4F8RA 5DBCA 2R8GA 5KFDA 5DDMA 4ECUA 4O5CA 1NK8A 4DSIA 4I28A 4F91B 3SV4A 1ZQYA 4PH5A 4O3SA 1KTQA 4M9HA 2FPLA 3ISCA 3ISDA 8ICNA 5L9XA 5BPCA 2BCSA 5DG9A 4EBEA 2ZTDA 4QZEA 2UVRA 4DSFA 4PHDA 3T3FA 3EYZA 2NRRA 2VA3A 4F5OA 3MBYA 5HP4A 3RJHA 4MFAA 5KFJA 3RJFA 3H40A 3QZ8A 4P2HA 5DQIA 5J2EA 4KLSA 3RH5A 2BQRA 4JWMA 3PV8A 4F3OA 3Q8LA 2ZUBA 4Q8FA 2W9BB 4Z6FA 4RUCA 5DB7A 5CB1A 5KT6A 1TK0A 5D4BA 3RJGA 5C5JA 4M9NA 4F4ZA 9ICSA 3V72A 4ECRA 1NJXA 2JZBA 4O3OA 4DL3A 1JXLA 3GQCA 3NTUA 5EWEA 2R8KA 4F5RA 1EXNA 1L3VA 5L1LA 5D46A 2ASJA 4M9JA 1NKCA 8ICTA 8ICZA 2PFNA 4QW9A 1S0NA 8ICMA 1ZQRA 8ICSA 4NM2A 3EWAA 4UBBA 7ICFA 1S9FA 1RYRA 1KDHA 1A77A 4YR3A 3QE9Y 4RT2A 1BGXT 4C8LA 5J0OA 4C8NA 5J0RA 5KFFA 3N97B 1L3SA 4DQIA 1RZTA 4KLTA 1NKBA 7ICLA 3SZ2A 3C1ZA 4Q45A 1NJWA 2BPFA 5KTQA 3MR5A 5J2GA 1V9PA 4IR9A 2BR0A 9ICEA 4F92B 4HYKA 3Q8MA 3RJJA 3BQ2A 1ZQLA 3RB0A 4MF2A 4KLDA 4YG2A 2BQ3A 4DSJA 4KLMA 7ICNA 2AGOA 4DF8A 4QZBA 4G3IA 5KFUA 4P4PA 1HUZA 4IRKA 1ZQWA 3M8SA 2W9BA 1NK7A 1ZQEA 4YR2A 4ED7A 3V6HA 2ZUDA 2C28A 2GWSA 4IRCA 5J2AA 9ICJA 3C23A 4XUSA 1ZQVA 8ICGA 5J29A 4JV2A 3M9MB 4J9RA 3GV8B 4IQWA 3ZDBA 2MUTA 1B22A 5J0QA 4QZGA 1ZJMA 3GV5B 4UB1A 4BXOA 4ELVA 4EZ9A 4KLUA 1ZQXA 9ICRA 2W9AA 4PHPA 5J0UA 3B0XA 2ZTCA 4PHAA 9ICQA 1ZQKA 2PI4A 2V9WA 3ZD8A 9ICIA 3TFSA 1PZNA 4QZIA 4GXJA 5KT2A 3KTQA 7ICUA 1XSLA 4KLHA 5KFAA 1UT8A 1A76A 2I9GA 2KZZA 4O0IA 2J6SA 4B9VA 1N56A 3JPNA 1U47A 3THVA 2DPJA 4O5EA 4O3RA 9ICPA 3RB4A 2KFZA 5KFKA 3AU2A 2VA2A 4DQPA 3MGIA 4FBTA 4KLGA 3GIJA 4YQWA 4YMNA 2H5XA 5CHGA 4UAYA 7ICGA 3PY8A 4RNOA 4M04A 4MF8A 5KFVA 4DL5A 3MR2A 2AU0A 2KZ3A 3KHGA 1XSPA 4KMUA 9ICTA 4DQSA 3GFKB 2V4RA 2C2DA 4KN7A 4KITB 2DFLA 2UVVA 3V7LA 4I2JA 3UXNA 5DGBA 4B9NA 3MDAA 1ZQZA 3RRGA 5J2BA 4DL6A 2PXIA 3TI0A 1K1QA 2HVHA 1H38A 4M6WA 3MDCA 4B9LA 3IM1A 4PGYA 7ICQA 4ELTA 4ELUA 5D49A
chains in the Genus database with same CATH superfamily
3T7ZA 1ZD3A 1NGJA 5CYQA 5LJVA 3UXPA 3GDQA 3TFRA 3HPOA 1ZBLA 4P4OA 4CIFA 4F2SA 4MO5A 5AHXA 4Y2PA 9ICUA 2CH6A 1K8AO 2A41A 4QNLA 3C2KA 1BPDA 3I8DA 2PFOA 3QUQA 5AQIA 4BC2A 3RFAA 8ICVA 5EU7A 1NGCA 4JV1A 3QEWA 1Z00B 4BRNA 9ICOA 1MWKA 1YJ9N 3OYCA 2I7PA 2K89A 3ZDDA 1T44A 1QQMA 4B1YB 1IG8A 2F44A 2W7PA 5CYMA 3LANA 1RT5A 2C22A 2XRIA 3HBTA 3KLIA 5AZJA 1TYQB 4H5WA 2B6GA 5KG6A 3O9TA 2HBJA 3TPQA 3ENHA 1BIUA 3SBGA 5HBMA 1VQLN 4DTXA 1VDVA 4BQZA 1SZPA 3O6WA 1J6ZA 1DEJA 2A1JA 1VQON 1AROP 8ICWA 4BWMA 4DR5K 3FC4A 2ASOA 3DRSA 5K4LA 5AQRA 1JLBA 1P90A 3V6JA 3K2PA 4RT3A 4F5QA 5KFXA 1JXEA 2Y1IA 1NK9A 1L5UA 4BACA 5AQXA 4NCAA 2PYJA 3LPUA 4ECVA 3OYKA 3MABA 1RXWA 3CW2C 4CRXA 2QWRA 4BRCA 1ITGA 4UAWA 1E3MA 5AM3A 3AAPA 4DR3K 2CXYA 2HHVA 3KZXA 5M1PA 3LP2A 1HJPA 3ATUA 4UW9A 3UMCA 2RKIA 1Q3UA 3H8MA 3ZSRA 4B3SK 4BDYA 2VGNA 4KHNA 1VQ6N 1X6IA 4E7JA 2D1KA 3E01A 4KTZA 2X78A 3L4PA 2PMZF 5FPNA 4ECZA 4OKJA 1D9FA 1HMVA 1JX4A 4N76A 2QW9A 3UB5A 1WCLA 1KFDA 4DTMA 5JUMA 3QUTA 2D0AA 4IOXA 3SV3A 1W0HA 4TUQA 3HP6A 2FF6A 4BRDA 1SKRA 4C8OA 4A5BA 4NXZA 1BL3A 2E2PA 4EIAA 2OA8A 4F3TA 4IG0A 5KFCA 2FBVA 3VQQA 1OH5A 3W3DA 1WSEA 5AK6A 5DQHA 3HP9A 2ZF5O 2KJ8A 5F1XA 3SNNA 1BNOA 1ZD2P 1RDAA 2X6NA 1QSYA 4I27A 8ICBA 3CCJN 3FDSA 3WXMB 3RJKA 2A1AA 4X62K 3PW4A 4J9OA 1EXQA 4H4MA 4GC6A 3WNGA 1M1KO 3AARA 2JLEA 4E0DA 4JK7A 2OM6A 2YY6A 1XHXA 2WBNA 1DOQA 2HOEA 4F72A 2OEHA 4KH5A 3BF1A 3E9LA 2YNIA 3EEQA 1DTQA 3KFUF 1QQNA 3CCVN 3KIOA 2UVUA 4H0TB 4ECQA 2Q0UA 1T3NA 3F2KA 4DR6K 1Y88A 4ECWA 3U9ZA 3LP0A 1YITN 4GC7A 2CGLA 4DWIA 4B9SA 2DFHA 1JROA 1GLCG 4H5RA 2XICA 4E89A 1WAJA 2BZFA 1WSFA 3CCSN 3ASMA 5J2DA 4B08A 2KIVA 4DR7K 1KCFA 4CEEA 2IMWP 4ILJA 2I1QA 1RT2A 1Z19A 3AQFA 1N33K 4O5BA 4CJLA 3N4MB 4BE2A 1JN3A 4YFKA 2VWBA 3PUFA 1IV0A 3TQ1A 2HDOA 3L3FX 2W9CA 4J9QA 1B9FA 3DLRA 3NBPA 1X2IA 4PGXA 3PW5A 4LF8K 4DEZA 2XIDA 1L8LA 3EN9A 3O4QA 5J0YA 1F21A 5KPRA 2OANA 1JLCA 3I33A 3BDPA 1CUKA 4I2IA 2XO7A 4L8RB 4CFAA 3UKRB 4M9LA 3H1QA 2VGMA 5KFBA 1L3UA 8ICYA 2OHFA 1EKEA 4LZGA 5ALIA 1UOCA 1SWVA 2XHBA 4FLXA 1BI4B 4BUGA 3G71N 5ALOA 3MEEA 3CCRN 3P39A 2P9IB 4C7ZA 3QYPA 4MLEA 3K5OA 3OYGA 3ZD9A 1QSSA 4EBCA 3IFRA 2UUCK 1TUUA 5E84A 1ZRNA 4DCHA 3E2EA 1IBMK 4Y2SA 2ASPA 2KICA 2Y0SC 4KX5A 3DXKB 4FJHA 2JH1A 3HILA 4KLEA 3SAHA 3OS0A 4DL4A 4FBUA 4RNNA 3ALYA 4RQMA 4QWDA 4DS4A 1RFQA 3SPYA 3R3LA 3AU6A 3Q8QB 2VCPA 1HYSA 4F5PA 2BTFA 3S9HA 3H3OB 3THYB 2YKMA 2KLAA 4N41A 1YVUA 4KHQA 4R66A 4FCYA 4FYDA 2W03A 2HHTA 5ALRA 2PI5A 4JV5K 3RTVA 2KTQA 4JRPA 4Y2YA 5AQFA 4ISEA 4X64K 4WQ4A 8ICIA 1LV5A 3PMLA 2P9PA 4USAA 3LDPA 4FS1A 1X9MA 3TSQA 3JPQA 3SYZA 4WFNL 2F77X 1MC8A 1QQCA 1MQ2A 4XQ8A 3QESA 2R8IA 3LWLA 5LY3A 2KFNA 4AM6A 3K58A 4FE3A 2MU2A 9ICFA 2FF3B 2LPEA 5AKEA 1UAXA 3ICXA 3PVXA 1S0OA 3DI6A 3HRGA 3P38A 4ICAA 3SK3A 2E2QA 1HJOA 4H0PA 4MQ3A 4J2AA 1SB3C 1Y64A 4FOIA 4DQRA 3C1YA 1X9XA 4FWMA 3JAMO 4QIWF 4EYHB 4G1QA 3SJJA 1BISA 2R7YA 2FLPA 3WKCA 4KBOA 3BP8A 4XA5A 3EZWA 2W8KA 5IIMA 5C10A 1ZQJA 3M6ZA 4O3QA 2P66A 3OVNA 4FWSA 3QNNA 4LF6K 1TAUA 3HKZF 4YOXA 2K4EA 3PW7A 3TAPA 5BN9A 4EZ6A 4LF5K 5IT9O 3V7KA 2ZIUA 4RW6A 4RQ3A 3RJEA 3DLBA 3NVYA 3RVCA 2BCQA 4C1NI 5FP0A 3OHBA 1SV0C 4AHCA 4ZTJA 2MAXA 4J9SA 1KLMA 1X9WA 1TYQA 4J8FA 1RYUA 2LYAA 5AQPA 4KB0A 1ZQTA 2UUBK 4I6MA 5ALJA 4C7YA 3RRHA 1WAFA 4DFDA 1J97A 5C12A 4FLTA 2ZJAA 3KK7A 5J2PA 1ZQSA 5KT3A 4DTUA 1QSLA 2XY6A 2YMPA 3V81A 4RTFD 1DK3A 3JSMA 1TV9A 3NFAA 5KG1A 3RAQA 2A19A 2NYVA 3M5RA 1K5OA 5EE0A 2ZE2A 5J8YA 1RT1A 3CJBA 2LBOA 4M0AA 4CD3A 5KT7A 4KLQA 5ALNA 2P9KA 4ED1A 4KLIA 4BC3A 3PW2A 1KFSA 2MA1A 2I5JA 1N48A 4JI6K 1ZQUA 5KFOA 4AQYK 3PO5A 8ICXA 2BE2A 1SWWA 4BGBA 1NGHA 4CEOA 2Q97A 1C0UA 3RB3A 5BRFA 3M9OB 1WSJA 3VC8A 5KRTA 1JCFA 1JMSA 4I9LA 7ICJA 3O4NA 3E9PA 5IIOA 3AVHA 2W6LA 1MQ3A 3TAMA 4DU4A 5ALYA 3IAYA 4DV7K 1U45A 4DOBA 4UB6U 1KKXA 3HX0A 5AK5A 2FLLA 3VQ4A 2QWLA 4CJ7A 3K1RB 2PKEA 3VF6A 1BO5O 2YJEA 3LWMA 5A2QO 1T3QA 3Q8RB 2VANA 4KFBA 3PW0A 2GO7A 5DB9A 4RWTA 1XHZA 4H0XB 1QLNA 1YTAA 1UA1A 2AXTU 2A6AA 1CZBA 3EUB2 2KSOA 5DDMA 4ECUA 1H1VA 3MXMA 2Q4TA 3HJFA 4CEFA 4N56A 1U6ZA 2H3IA 4CJQA 4CF9A 3TAFA 1RQLA 1RDCA 3ISCA 3ISDA 8ICNA 1EWQA 5L9XA 5E41A 3B9JA 2UVRA 4DSFA 4BG8A 5ALSA 2O8BA 4EX7A 2NRRA 2IOCA 5KNIA 3LVVA 2VA3A 3B6OA 3OYMA 5AQTA 1CXUA 1CZAN 3MBYA 5HP4A 3RJHA 5CR4A 4MFAA 3CERA 3E9OA 3N7SC 4CFCA 3QZ8A 5J2EA 4KLSA 3AO1A 3DOKA 4CF1A 4EEKA 2QKKA 1N2XA 4JWMA 2K4HA 2M0NA 3IG8A 2ZUBA 5KAIU 4KHPK 4RUCA 4JKFA 4LH4A 3VOVA 3NMUA 5KT6A 2KKVA 1ZBFA 4B3TK 2W7OA 1XUPO 3THXA 1S72N 4AP9A 2CN1A 2YHAA 5ALZA 2KHVA 2JZBA 4DL3A 1MDUB 3NTUA 5AKIA 2R8KA 1QH9A 5D46A 3O08A 1NKCA 3LPTA 4J2BA 4Y2VA 3H45C 1KN5A 3AA5X 4I7FA 1NU0A 4AHSA 8ICMA 3J8AA 4CGGA 1TL3A 2FBTA 2IS3A 4NYFA 1RYRA 3IDWA 4FJKA 4C8LA 5J0OA 5FPMA 2KNJA 4C8NA 1UPHA 4OJPA 5J0RA 5J1EA 1VQPN 3I0RA 4BRHA 1YZ6A 2P9NB 3OBWA 4RW8A 1NKBA 2G8VA 4P0PA 4HVJA 2BPFA 4FJIA 3SQ2A 4AHUA 4IR9A 3A5OC 3C0BA 9ICEA 3SQ0A 1N63A 3Q8MA 4CBWA 3BQ2A 4MF2A 2B6AA 4CHPA 4JKCA 1NBWA 3KKSA 1UWBA 4DSJA 2G5HB 3H08A 2VG7A 4DKWA 3I1YA 1RT6A 1HIWA 1BCOA 4DF8A 4JK8A 3AA4A 1Z26A 4G3IA 2V51B 5KFUA 5FPDA 4IRKA 3QEXA 2G8IA 2Z1JA 2KKPA 5GTIU 2W9BA 2PY5A 1Z4OA 4US8A 1CLQA 1B0XA 3VF2A 4ED7A 3V6HA 1PVPA 2C28A 1QQ5A 3C23A 1YUWA 1ZQVA 1TL1A 1Z4NA 1KXPA 2Q0RA 4BRPA 3DLLL 4Q0BA 2GWKA 1EO1A 4GKKK 4KH6A 4IQWA 2BH1A 1IG6A 2MUTA 2OTLN 2E20A 4BXOA 1OH8A 2H3VA 9ICRA 2DTUA 2F96A 4CHOA 2DWQA 3WXKA 1ZQKA 4GY2B 3BS5A 1NGAA 3DOLA 3WNFA 3HK2A 1WNSA 4AHTA 2NO4A 4ZOHC 4H03B 4A57A 2Q3SA 3F53A 4O0IA 1N56A 2ZJQL 3UMGA 4LFAK 9ICPA 2DPJA 5ALFA 1BNPA 5M1FA 3L4QA 4QS8A 5AKKA 4B1VA 1A5WA 2G07A 4YOTA 5AQUA 1JUDA 2A1RA 4YMNA 2H5XA 3CCMN 2HHHK 5AI9A 3PY8A 3NCIA 1JLFA 2P51A 3AVGA 5KFVA 4O8KA 4DL5A 5BR9A 3KHGA 3DXMB 3D6JA 3EKSA 9ICTA 3F9MA 2O6KA 4NCBA 3ZSQA 4Y2UA 3QIPA 2ZXHA 5BRDA 3ZX3A 3C28A 3O80A 4I2JA 3I28A 3D7EO 5AQSA 3E1YA 3TI0A 1UQVA 4B8AB 3S6JA 4BROA 1VQNN 1Z25A 1AQ6A 4GVMA 3GBTA 4DTNA 1MWMA 3QERA 1TKZA 1Z6RA 3P83D 8ICCA 4JMUA 2UXBK 4JKHA 3J80O 4GXIA 3CJCA 2XI9A 3PSPA 2CGJA 2P9SA 2OYQA 3UKUA 1ZQNA 3G6XA 2P1JA 3FZFA 2XY5A 4BE0A 5JS2A 2RRDA 3FGUA 2UYTA 1VQMN 2O8BB 5KFGA 4TUSA 1SUQA 1M6YA 2ITGA 8ICAA 1N6QA 4FZLA 4DG1A 1L7NA 3BQ1A 5L1JA 5ALWA 4QIWC 1KAZA 3U9DA 4JK9A 4Q5VA 3RH4A 4Y2QA 3CHWA 1BPBA 1S6QA 1UT5A 4PUOA 1KW4A 4WQ5C 4X65K 4KI6A 4MLHA 2E1ZA 4FW2A 2CPRA 1HQUA 4FM1A 1W7AA 2FSNA 3OYBA 3UMBA 2MUTB 2Z1IA 3K57A 2O4IA 3C6UA 3FFIA 2FMPA 3AVAA 4N5SA 4F4XA 3H8JA 1TAQA 3GIIA 3EPIA 9ICKA 4CJ4A 2L5YA 5SWMA 5AQQA 2QKBA 4WF9L 5JS1A 2JZBB 1OXJA 2LYHA 3FYHA 3ZI4A 1S9GA 4CEQA 3MFIA 5L1KA 4C8KA 2JGAA 4F93B 1L7OA 4JYAK 2ZJ5A 4ISFA 4M9GA 3KWIA 3L8BA 4QS7A 2IDOA 4UAZA 4JI3K 3VQAA 4H0YB 1RCHA 1QTMA 3LP1A 3F73A 3LK9A 9ICWA 3BQ0A 3PX6A 4RPYA 3RR7A 4P0PB 4NCGA 3MAQA 2E5LK 3MMVA 2F3NA 1S5JA 3I76A 4JKBA 4KLJA 2ZJPL 3VENA 4OPJA 1BHLA 1IM4A 4I2HA 3IKMA 4DF4A 2P6UA 5HMLA 3B8AX 2EANA 4GMJB 1Q9YA 2JWKA 4FFDA 2K8CB 5AI6A 3ETRA 5B8HA 4WFAL 1VSFA 3AO2A 1SKSA 4CD1A 3LP3A 3VTIA 4IDHA 1O03A 4F2RA 3NGDA 4PKGA 1SV4A 5DDYA 4FPAA 1LKYB 5KFIA 4C80A 1NK4A 3WXIA 3OW2M 1YIJN 5ALQA 3CXCM 2J6UA 5J2HA 1S1XA 4Y2RA 1XSNA 1Q81O 3NDKA 2KQ2A 1X9SA 9ICVA 4B8CA 4F9OA 1YI2N 1NGIA 3MK6A 4AYBF 4RQ7A 3WK9A 3HI0A 4E1NA 5EE9A 5KPZA 3M9NB 3QU4A 1KRPA 2VQEK 1DLOA 3SMVA 2IOFK 1ATSA 5KG4A 1GLBG 5J0SA 3H0LB 2G09A 2R8HA 2E1YA 4CGDA 4BX9C 5AM4A 7ICTA 4CZIA 3ZDCA 4F4KA 4OO1J 4AILC 4NLGA 4DSEA 5H1SQ 3ID8A 3SJHA 5J2KA 3WEEA 1S0VA 2IBKA 4Z4HA 1YHQN 5J0WA 4RNMA 3DRRA 4PGQA 3VEOA 1JRPA 5KQ8A 3S3OA 1YJWN 4QAGA 5AK3A 3SR6A 3HWTA 1ZQDA 2DGZA 5KG2A 3A5LC 4JAXA 2AGQA 3GOIA 4JS5A 4LFBK 3SMPA 4DTRA 1NG9A 4DLEA 2V7ZA 4A62A 3NF6A 3IG1A 4Z4CA 4CZJA 5DLFA 3ISBA 4J9KA 2C2EA 4J9MA 4V19S 2PBDA 1MSWD 2GBZA 4K8ZA 3QNMA 3IN5A 3KJVA 2P9PB 3ID6A 2KZMA 4HHTA 3C5GA 3QDKA 3KK2A 3NVMA 3CFPA 3UIQA 4YXJA 4U7CA 3Q8PB 1KFTA 4JKDA 1VQ9N 9ICNA 3ZSXA 7ICHA 4KI4A 3G6YA 3MR3A 4B1XB 4UAVA 3HZ6A 3T1AA 7ICVA 3RSEB 3TSUA 4ECSA 5HRSA 2FE9A 4UB8U 3A0HU 3Q8SB 4JS4A 4PZOA 4JUZA 1N34K 2VYPA 3EKUA 2ZIUB 5HOOA 5DQGA 4BR9A 2AGPA 3UXOA 4MFFA 1NLVA 4FZMA 1ZQBA 2K60A 4BDPA 3QMLA 3SUOA 1A5VA 1LW2A 7ICPA 3RBEA 3DM2A 3ZSYA 4JKGA 1VRTA 1VQ5N 3G0ZA 4PWDA 3GG4A 4DTOA 4PL7A 1WCNA 3EPGA 3PO4A 9ICMA 1C1CA 4CE9A 4DHYA 5KG3A 4RQ5A 3PIOL 1GOBA 4FLZA 4M6WB 3MWTA 2YHBA 2KW4A 2NZTA 4X66K 4M3YA 8ICUA 3LDOA 3MGHA 1RDFA 3V4IA 1KAYA 3CJ1A 3LM2A 3D6RA 1IXRA 4A5AA 4MEYA 3VEZA 2ZIVB 1FKPA 3DYAA 3HTVA 1KD1O 5B66U 3AY9A 2I5HA 3V6KA 2HHQA 1VSJA 1LWCA 5TKWA 3VGKA 2ES6A 1RBVA 2QB0A 4BRFA 2YN4A 4CE6A 3WK6A 1NMNA 2YHYA 3DMJA 1YXQA 3CMEN 3ZLJA 3QNOA 3WQTA 2FBXA 1RG6A 2QM1A 4O5KA 2E2OA 5HRPA 3M8RA 2KMDA 7ICEA 5DB6A 1IJJA 3QX7A 4FWKA 2ISOA 3A5MC 3BF3A 3CG7A 3CF5L 3U26A 2E1FA 2BDPA 3VQBA 2GH1A 5A0LA 3O5BA 4HTLA 3LDSA 1UA0A 1LCUA 1OH7A 3O0FA 4RQ6A 2ZD1A 1NMDA 2WF6A 1Y97A 3R8EA 4DMNA 3GU3A 3V9WA 1ATNA 4MFCA 1CXQA 3DXKA 4O55A 5M1OA 4YNQA 3TWHA 4YDUA 4BR7A 1EWRA 2WF7A 1PVRA 1ZQHA 1REVA 4ID1A 2BGWA 4B9MA 2ZGYA 4RPZA 3VF4A 5JVGL 2O8CB 4FJ9A 1C1BA 4IFEA 5C24A 3ED5A 4CNQA 3HW8A 1VSLA 2E4LA 3H4DA 2ATLA 2HBMA 4CCHA 3QEIA 3KKRA 1N32K 4QW8A 1COKA 4DU1A 1XO1A 2AQ0A 4WYBA 4FJ7A 4M3RA 2P9NA 4FJ8A 3ZDAA 3KVGA 4Z6EA 9ICCA 3QEBZ 1RXVA 5ALVA 5DLGA 4QWCA 3M6KA 3IDHA 5J2JA 5KFHA 3ZDEA 5KFEA 4TQSA 5ADXH 4M3WA 3I55N 5J0PA 1JALA 4YD1A 4YOWA 5JVHL 2IC3A 4OPAA 2W42A 4KLLA 2N1RA 3SMSA 4LJXA 4JI0K 2JWLA 4AH9A 3OS1A 2KHQA 1QZ5A 2HB5A 2ASLA 3J7ZO 4I2DA 1K9MO 1IKYA 4PL8A 1ZQCA 4K43A 1TVRA 5ELZA 2H3QA 3BZKA 2Y1JA 2KKZA 1QVFM 5G5GA 2HF4A 2EDUA 3NVVA 1Z3EB 1HR0K 3S3NA 2JEJA 5J2IA 3KHHA 2ZQBA 2KSOB 3QEVA 2K4PA 4UASA 2RHKA 3HM9A 4IL6U 1X1PA 3OJSA 3G10A 2QA4N 5HP1A 2V52B 3OYNA 1XC3A 2KG5A 5BPNA 1BIZA 3AVIA 7ICOA 1GO3F 1ZQQA 1BA0A 4DUZK 1YF5L 3H3NO 3UPQA 3L0QA 1ZYQA 3MX5A 1X40A 4BVOA 4Z4IA 2KJ9A 4TUPA 3MDQA 4O3NA 3IP4B 2QB0B 3FAHA 7ICRA 1ILYA 1FXXA 4DTJA 3TAEA 4J9LA 1X6JA 1TE2A 5KFWA 4NY8A 3BS7A 5ALDA 3CCQN 4EBDA 1QE1A 1S0MA 2OZMA 3MN6A 3OGUA 3F5TA 5AI0A 4M3UA 2QWPA 1TAMA 2ZXIA 2V7YA 3MCAB 4CIGA 1EP4A 4KO0A 2O4GA 4OLBA 3O8MA 4P0QA 8ICRA 3BZCA 1VSMA 4GFJA 4Q43A 3WKAA 1BA1A 2WF9A 3E66A 2V4QA 2G5IB 5KFSA 3LVWA 5F0XA 1IO2A 5F3XB 3QFPA 4CEBA 1ZD5A 5J2FA 4DV6K 4PJ0U 4BR0A 3TANA 4Z6DA 3C5FA 4BDZA 2YNGA 3CETA 3U6FA 1L7PA 3NF7A 1RBRA 9ICAA 3IUCA 2OYYA 3EE9A 4I2CA 2F8LA 4LZDA 5KFYA 3PZPA 3IV6A 3RB6A 3CM5A 2R8GA 3V1RA 5KFDA 1HNWK 2JRZA 4JLHA 1NK8A 2O8FA 4UATA 4I28A 1K8KB 5EVZA 4QCLA 4PH5A 5AIAA 4MFBA 5AKYA 4C23A 5BPCA 3ULEB 2BCSA 3AGRA 2D0OA 4PHDA 4BQLA 1T05A 3OYFA 2DBYA 3MEGA 3VQ9A 1U2VA 3THWB 4HUFA 4FLYA 2A40A 3L2VA 1GLFO 2BANA 4NV0A 3MGVA 3NRWA 4P2HA 5DQIA 3TTDA 2B5JA 3NHGA 2UUAK 2BQRA 3PV8A 3VA3A 3KLFA 3AVNA 4Q8FA 2W9BB 5I3UA 2Q2RA 5DB7A 4N47A 1ZRMA 5CB1A 3MXIA 5D4BA 3CM6A 4K8XA 4H5NA 4M9NA 1NNEA 4GW6A 3QU9A 1YZ7A 1EETA 5ALHA 9ICSA 4ECRA 4CZKA 4BRKA 2EAPA 2CH5A 3DDHA 4CJFA 4H0VB 3GQCA 4O3MA 3C94A 3ZT3A 1L3VA 3H6EA 2ASJA 8ICZA 2JHDA 2PFNA 3IG5A 4QW9A 3MN9A 1F5SA 3ZCMA 2GLEA 4YFUA 4FZNA 1BGXT 3TSPA 3ITHA 2WAQF 1OKJA 5KTQA 4BR4A 5AM0A 4ACOA 4F92B 3O9RA 2YI1A 1Z1VA 2WF5A 5CZ1A 5EX5A 1RILA 2OCEA 3M8PA 5JTIA 1WSIA 3KLEA 1ZQ1C 2P9UA 1FFVA 3ZSVA 3MCPA 2NNWA 2KP7A 1OUQA 1I39A 1WBDA 5AI4A 3NF9A 1ZQWA 2P5OA 1IBKK 4CJEA 3M8SA 1QQOA 5CHIA 2JH7A 3F2BA 1NK7A 1ZQEA 1RTJA 3VERA 2ZUDA 1BOTO 2OPPA 2UU9K 5ALKA 3ZEUA 2EZZA 1ASVA 4W5TA 4CK1A 4YDUC 4J9RA 3LDNA 4FOEA 1RT4A 3VCBA 4JD2B 3V6DA 4QZGA 4DB3A 1BQNA 3GV5B 4UB1A 4EZ9A 4HWIA 5AQZA 4KLUA 4BRLA 4CJKA 3KK3A 2GTDA 1URJA 3VQ5A 4PHPA 2FC0A 2WONA 5J0UA 5LL6Z 1B4FA 2QEXN 2HNYA 2PI4A 3CRXA 5DM7L 5C25A 3CJ9A 5CEHA 1PZNA 4QZIA 3TFSA 4JI7K 5KT2A 3KTQA 1S1TA 2GEMA 5C15A 4DV1K 4KLHA 5KFAA 3WKEA 3OYAA 2J4RA 1KL9A 2WF8A 2I9GA 2KZZA 4CBXA 3OBYA 5BN8A 5AIBA 3IRUA 1U47A 3RB4A 1IKWA 5KFKA 2VA2A 3R6MA 2GOLA 1N8RO 4UAYA 5KL8B 4LD0A 2W3SA 4RNOA 3KKAA 3SEIA 4CEZA 1WBBA 4M04A 3WUHA 3QUCA 1X3NA 3QFUA 1XSPA 1V85A 4KN7A 2RHFA 5DGBA 4B9NA 3AVFA 4B3RK 3QU7A 1A5XA 2PXIA 3QLHA 4PL1A 1KQSM 1H38A 4JEPA 4M6WA 2XVTA 1BUPA 2KJ5A 4ELTA 4ELUA 2AQ4A 5D49A 4DU3A 8ICQA 4US9A 4KAZA 2H3GX 2AJQA 4BJQA 1RDWX 2NRWA 3A8YA 1SV5A 4IKFA 4JNEA 4AF1A 1RNHA 3AQEA 2WFAA 3JPPA 2ATQA 2H3FA 2E8MA 9ICXA 3UKRA 2NRZA 1WWVA 1BQMA 4RW4A 2HBLA 3CPEA 1NNLA 3T79A 4PHEA 3K4GA 2PZSA 1YJNN 2E1EA 1D8YA 3FM9A 2HMPA 3T1YK 3VQ7A 5IIKA 3VESA 3K9KA 4E7LA 3VEWA 4DL7A 1ZJNA 1VSEA 4C0ZA 1BPZA 5GAHP 3DLKA 3HJEA 3AMZA 2NLXA 4FS2A 4KMOB 3QU5A 3KHRA 4ECTA 7ICSA 1X9JA 4Z4EA 1VHXA 2VG6A 4QJFB 1XNQK 3AV9A 1D4XA 4RCHA 1JLQA 5TISU 4XRHA 3M1YA 5AKLA 4DOAA 2WTFA 4CGFA 2J6TA 2PAVA 1XMQK 1U9LA 1T6DA 1JLGA 5I9EB 4NM1A 4QZ9A 5C0YA 1U4BA 5AQJA 2QLTA 3GV7B 4MDBA 1ZC6A 3CCUN 3LDAA 5SZTA 4XEIA 5FPEA 2OZSA 3CMAN 4FJ5A 5CP2A 5IINA 1VSHA 3F5AA 1TK5A 3DLGA 4RQ8A 4FPBA 2BKEA 3Q7CA 3WNHA 4YOVA 2YHXA 2DKZA 2WB1C 4I2QA 3RSEA 4CGJA 4EFHA 3HO1A 4RZRA 1S1WA 2YX6A 4DFKA 3PX4A 3HVTA 4IFYA 1BVSA 2HOFA 4I2AA 1JCGA 2E8NA 2QTDA 2W6KA 3JYTA 1VSDA 2IOFA 8ICKA 1XNSA 5TKYA 1UCVA 1HEKA 3LDQA 2P35A 4I2PA 3ZYYX 1NK0A 1X3MA 4M45A 4I6MB 4CF8A 5CWRA 2VIXA 4H4OA 3PIPL 4FJJA 1GLJO 1BPYA 3OYLA 1KVAA 3H1VX 3VTHA 3WXJA 2CGKA 3KK1A 4RQ4A 2A42A 3MR6A 2GUPA 3SCXA 1Q86O 3J7AP 3JPRA 1ZBIA 2NRVA 1D8BA 4QWEA 4Q8EA 5AQOA 1WWUA 4YVZA 4I29A 4I2EA 1LKYA 3GZFA 5KT5A 5KFMA 1J2NA 2UXDK 2LMRA 4OJLA 1FK9A 2JGUA 3RH6A 3CD6N 2WC9A 4BG9A 4GLXA 4DQQA 4KHUA 1PUZA 1T6CA 3QEAZ 3THYA 3D2EB 3ZSWA 5F2RA 1NJZA 5CRXA 3L4IA 4E7HA 3FR0A 3AVJA 8ICLA 1NOMA 4R64A 3UQ2A 2WTUA 1RTHA 2IOHA 5ALXA 4UB3A 3GILA 4RU9A 1Z00A 4CJRA 4IO8A 5BR8K 4YN4A 1Q9XA 5FRNA 4YXMA 1S10A 2A3ZA 1HRHA 1HPZA 3KWGA 3JXUA 5ALGA 4FO6A 3TR8A 8ICHA 2NRXA 1Q8KA 1KSPA 3K59A 1U04A 4DQ8A 2A1JB 5DB8A 2FMQA 4BC4A 1XWLA 4K4GA 2HHSA 3E58A 4NO7A 2WB1F 4YD2A 2XY7A 2QKQA 3MN5A 3WKBA 4GKJK 2GV9A 1XS9D 4X5VA 3CFOA 1JLEA 1FFUA 4PL2A 1B92A 3AGKA 3DJCA 7ICKA 3QIOA 4CIEA 1RYSA 3OTOK 3RR8A 2FLNA 4FVUA 2BCRA 4YOYA 4I2BA 3O9UA 7ICMA 2OPSA 4PKHA 1DTTA 2IHNA 5HR7A 4OPKA 4ZTFA 2EZXA 4CF5A 5GIPA 4BWJA 1J9AA 3K9JA 3HL8A 3PX0A 4UB2A 1JCEA 5KFLA 1GOAA 4M3ZA 2F76X 2W9CB 5HHIA 2IGIA 3K1ZA 4IRDA 1BPEA 4QZAA 5KAFU 5AZIA 2LM4A 5BPLA 1NGBA 5DG8A 4DO9A 1IH7A 4FK4A 2F1HA 2JXJA 1SKWA 2FXUA 3I0SA 4FW1A 4GNIA 3MEDA 3O9SA 3VGMA 1BPXA 2DKXA 2F1IA 3OSPA 5BPMA 5AM5A 3GIKA 1OH6A 3AVLA 4K41A 8ICPA 3N28A 3SUQA 2QWQA 3EZ5A 2E5SA 1JL2A 5KFRA 3V9UA 1HKGA 4KHYA 3RJIA 2W54A 3O3HA 4KLOA 3IHQB 3TAQA 2DPNA 3AEVA 4FK0A 2FBYA 3TACB 3H4BA 5AQYA 1JIHA 2B4JA 4CDGA 3ZETA 1XNRK 4BRIA 4NLCA 1HUOA 4DSLA 3RMDA 5DGAA 2G08A 1SXDA 5ALTA 2BCUA 1VK0A 5AM2A 4IDKA 4XH4A 4FM0A 3G4SN 5CZ2A 4CZMA 1N5XA 2D3DA 3UM9A 3AVKA 5HMMA 4PKIA 2LSNA 5F9LA 1QHTA 3OA9A 5LMNK 3N7PD 2HF3A 4MO4A 4CZGA 4XIUA 2FMSA 1P7DA 8ICOA 2WOMA 2OXOA 1ZQAA 5KT4A 4EEYA 3V1OA 2F2AB 3QETA 3RAXA 1X66A 2P9LB 3VGLA 5CR0A 1FW6A 3B0YA 2HHUA 5AQKA 3SUPA 3P1GA 1L8OA 3V9SA 2OH2A 4CGZA 2IVOA 8ICFA 3KOOA 4WCEL 4GVEA 4FJGA 1KC8O 1DKGD 2NUBA 4H0OA 2HW3A 3K75D 5DBAA 4LSLA 4KLFA 3ULDA 4JV0A 2E6MA 4FL9A 2JEIA 4EYIB 2Q0ZX 1PK1A 5EOZA 1JKHA 2RN2A 2LM1A 2G0AA 3QB0A 3T5KA 3W0LA 2AH5A 2UVWA 4G9ZA 2QXFA 5C2FA 3HOTA 2LKYA 4BXOB 2HMXA 4I2GA 2LYBA 1T8EA 1G15A 3H8SA 1JLAA 2F7TA 5MLCQ 2G06A 4KTQA 1DRGA 2MSNA 2P9SB 2VG5A 2O8EA 2BPCA 2KIWA 3SD7A 1C0TA 1UHUA 3ENOA 4R5PA 4B9QA 1G99A 4CERA 4HUEA 1NK5A 4DLGA 5AQNA 4Z6CA 4QZDA 3AA3A 3OS2A 1FEZA 4CF2A 4YHHK 3D2EA 1U2VB 5ALMA 3WQUA 1N60A 2ZIXA 3WU2U 2RDJA 2ALZA 1D9DA 2IIRA 3D2SA 2ZUCA 5HRRA 4P4MA 3ISNC 3C2LA 4YOUA 1VQ8N 3M1FA 4O3PA 4BGDA 4ILHA 1VAZA 5J2NA 4KN4A 1ED1A 2C2RA 3HPGA 1S77D 1ZQOA 2OTJN 2M9NA 5GAGP 2NV3A 5HHHA 4CJ5A 4QZCA 2HHWA 2RE2A 3L2WA 3VMFB 1I3AA 1T3VA 1IG9A 1W97L 5T14A 3EW9A 4BREA 5F9NA 3SQIA 2BGGA 5JLFA 4R79A 4K0KK 2YKNA 3DRPA 4CI6A 2HBKA 2JMGA 3WK5A 4CECA 2BCVA 3QICA 1S76D 2DFEA 1NOYA 4U67L 2HMIA 1NZBA 3BJYA 5ALPA 1B9DA 4EP5A 1N5WA 4QWBA 3THXB 5IILA 4IO9L 2F4VK 5FROA 2FPKA 2ETJA 3NGIA 3J81O 3NS1A 4YMOA 1A6SA 3ATVA 3P5JA 2UXCK 4A2BA 5EWGA 5AQHA 4CK2A 5KFNA 4OX9K 3VQEA 5ALLA 3OYJA 1KBUA 2XCPA 4C8MA 2F1JA 2BHNA 5KG0A 3AVCA 4WE1A 5AR0A 1XMOK 2D0PA 5HNKA 1ZQGA 5J2MA 5TZVA 2QK9A 3SI6A 2F9TA 2JV3A 4RQ1A 4G9BA 4FXDA 4QZFA 3UQ0A 9ICGA 3G25A 5DK5A 5DKWA 3JPSA 2OPQA 4R63A 3PSIA 4GIBA 2W8LA 3AO3A 4JKAA 1PK1B 3ZT2A 4CZEA 4XH1A 2P9IA 5L1IA 4KH4A 5JLHA 4OJ5A 4DFMA 1IKXA 2FI1A 3ORYA 3R1XA 2WAQC 4DTPA 3KZIU 2E8PA 2W40A 2ZG6A 4DV4K 5AKGA 1VLBA 1M90O 2JR5A 4Z0UA 3AUOA 4ED0A 4UBCA 4O44A 3LZJA 3MFHA 1GOCA 2QARA 5KFZA 4BRQA 3ZETB 4ED2A 1KVBA 5DBCA 3QBXA 4O5FA 2O8CA 4F91B 3SV4A 4O3SA 4M9HA 1T94A 4DV0K 1F44A 3CPWM 4NL9A 2VKQA 1Q18A 2IVNA 2K8BB 2YQEA 4F71A 4QZEA 1IKVA 3T3FA 5E26A 3NAEA 3CQYA 4F5OA 3I56N 4QS9A 2KV2A 2BUPA 5FLXO 5LMUK 5EE1A 4DR2K 1ZD4A 5KFJA 2P9UB 5HRNA 3EE8A 3M8QA 1WLJA 3MX2A 3AO5A 4FZZA 1N62A 3VPZA 3OYIA 2YV0X 2HI0A 2EHGA 5H2FU 1TK0A 4MDAA 3C7NA 3NRZA 3RJGA 2QWOA 4CHNA 4BY9C 3KD5E 1Q46A 3V72A 1NJXA 1TKTA 3QEPA 4LFCK 4FK2A 2KVCA 4HUGA 1IBLK 1J53A 4FWQA 2FLOA 4DV5K 1J54A 1EXNA 8ICTA 5L1LA 4M9JA 4TSXA 4FZXC 1S0NA 4CJVA 4AM7A 1ZQRA 1HKCA 2E8OA 8ICSA 4NM2A 3EWAA 7ICFA 3MXJA 4NXNK 3TABA 3QE9Y 1KVCA 4FM2A 4KKOA 4RT2A 3U3GA 1C1AA 4BR2A 5KFFA 1L3SA 3AVBA 4DQIA 4B1WB 1RZTA 4KLTA 7ICLA 4NYNA 2E8AA 4CHQA 2EWSA 3MR5A 1RT7A 1YT3A 5J2GA 1V9PA 1ESVA 2BR0A 1MU2A 1S6PA 1ATRA 4JI1K 4HYKA 3L2QA 3K5NA 1E4GT 1ZQLA 3QO9A 3RB0A 3UKUB 3TKAA 4KLDA 4YG2A 4LF7K 4HCBA 1O13A 4E7KA 7ICNA 2AGOA 1YTUA 1N5YA 4OLAA 1CRXA 2KOBA 4BGAA 2G8WA 1SZ2A 1HUZA 4M3XA 3CCLN 3QUBA 1K6YA 3C95A 4YY3K 2K8AA 1TGOA 4IRCA 5J2AA 8ICGA 5J29A 1WB9A 3CQ8A 3M9MB 1R0AA 3N4QA 2GX9A 3NVKA 5J0QA 4CF4A 1ZJMA 1XO0A 4ELVA 3FZLA 3QINA 4FWOA 5AK4A 3ZT0A 5DM6L 1ZOLA 1BWFO 2X6SA 2HNZA 4EENA 4XH5A 4A2AA 3VA0A 3B0XA 3KD3A 4EELA 1PK3A 1NGFA 1WG8A 2V9WA 9ICIA 2W41A 3BQ7A 1HNVA 2Q31A 4K42A 4A8EA 1QS4A 4CHZA 4NWIA 4JI4K 2ZIVA 2E88A 1UT8A 5AZJB 5LJWA 4E7IA 2PMZC 3QU2A 1SAZA 2IAJA 4PQUA 1NOZA 2J6SA 4B9VA 5E79U 3JPNA 2LHTA 3THVA 4O5EA 5G5HA 2AA4A 1YAGA 1GLLO 4OPHA 4RG8A 2YNHA 3LALA 1VJ5A 1RM6C 4FBTA 4KLGA 5BRHA 3TADC 3GIJA 3FFKB 3NH1A 3CQXA 3VQ6A 3LL3A 4IOAL 3HM8A 3WEEB 4C4SA 3BUZB 4MF8A 2GELA 2PYLA 1V4SA 3CJAA 2DY4A 2EAMA 4J2DA 4BVPA 4DQSA 3GFKB 2EH9A 2V4RA 3WNEA 4KITB 2DFLA 2UVVA 3UXNA 2Y9TA 2YMLA 3RRGA 1RTIA 3O1BA 5KGWA 5J2BA 5KRSA 5AKXA 1K1QA 2RP5A 2O8EB 4B9LA 3MDCA 4CHYA 3IM1A 2YX8A 1Z1BA 4U7BA 1LVHA 3KKAC 4IWVA 3M6GA 1HPMA 1C0MA 3V1QA 3NF8A 1TUYA 3D45A 5AQVA 4R8UA 5KPTA 1Q82O 2W9MA 4B3MK 3IS9A 3S3MA 2MRLA 2YMMA 4B9UA 1C0GA 3U3YA 3CC2N 1ZQIA 3S41A 3H0MB 4B1UB 1K8KA 1KEJA 5AKZA 4DFPA 4EP4A 5KFQA 1JL1A 5AQMA 1V4TA 3U8XA 3AVMA 1JJ2M 3OYHA 1CEZA 3OYEA 3KLGA 3Q7BA 2E2NA 3SQ4A 2HOQA 3HT3A 4TQRA 4M3TA 1KLNA 4LH5A 4FSVA 2G8KA 3P4IA 4QZHA 4IZ9A 4CF0A 4LF9K 4WJ3B 4IQTA 2HCFA 5JICA 4JI5K 1NK6A 1WSGA 2WFBA 4K4IA 4YORA 5K14A 3VQPA 2Z1HA 3WT0A 3J7YP 5J0TA 4J2EA 3OPXA 1LAWA 3WKDA 2NRHA 3NE6A 2O8DA 1SL1A 2KN7A 4FZYA 2ZWHA 4CZFA 4ECYA 2FJ6A 1TKDA 1GLAG 2R8JA 1DT9A 4M63C 4PA1A 1ZQMA 3G6EN 1HNZK 3JPOA 2D0BA 3R9KA 3GDXA 1HX1A 5GIOA 2R18A 5J2QA 3HPHA 5KFTA 1DGSA 1WOQA 2ASDA 1T4GA 4FWRA 5HLFA 1P8ZA 5AICA 1BU6O 2GUIA 3C29A 2PFQA 4ZHRA 4NLNA 5AI8A 3T19A 4Z94A 5KL1B 3O1WA 3AN1A 1TK8A 3F2CA 4Q44A 4H5VA 3B6PA 5M1QA 4E3SA 4UY8O 1TVAA 4UB5A 3V7JA 3DV9A 4CBUA 3CJ7A 4L3QA 4RQ0A 2YHWA 3CC7N 2HSZA 4GV3A 3UE5A 4FJNA 2HOIA 2QI2A 4YP3A 5AFUH 1Q3VA 3NVZA 4LF4K 5BOMA 2Y0SF 1WN7A 3N7RC 1BI4A 3LDLA 3KHYA 5CE3A 4JKGB 1NGEA 1SIJA 3HVRA 3QXGA 5AJ3K 1WYGA 8ICEA 3FZKA 3RMCA 4FJLA 4ED3A 4KTWA 4C4RA 3OYDA 4CW7B 1RGIA 3SPZA 1HNXK 3CI5A 2QARB 3ZSOA 3M7DA 2OPRA 2B0CA 4DSKA 1C20A 4E1JA 3C65A 4Z4FA 3VEVA 5FRMA 1RBTA 3H8WA 4JD2A 1S5LU 1SV0A 1S8OA 3PSFA 1BG3A 3RF9A 4CF3A 1OVYA 1NKEA 4OKEA 4IR1A 3D2NA 5JU5A 4PPXA 1SS6A 1CZ9A 5L1MA 3PNCA 3DEEA 2EZYA 2HVIA 1TKXA 2I7NA 5C42A 3T1HK 4JB3A 4Y1DA 1VSIA 1ECWA 1RDUA 1RDDA 2WHEA 1W9HA 3CNHA 3LAKA 3U4LA 3NH2A 1VQ7N 1LAVA 3CFRA 4R65A 4M2YA 5I42A 4F50A 2ZTEA 4R8UB 2ZIXB 3HSCA 5ALUA 3A5NC 4NB4A 1ZETA 4CJTA 4FO0A 5AQWA 3TTCA 4ED6A 2OWOA 1HJRA 3J81j 1Q7YO 4CZHA 3K0SA 4RQ2A 5JRTA 3SLCA 1ZXIA 3RBDA 2AP1A 1ZBUA 3F9KA 3C2MA 4UB4A 2DPIA 3L3VA 5GAEP 1NJIO 1HYVA 3BY5A 5GTHU 4CFBA 2KVSA 3VQCA 4HCCA 1NGDA 1C6VA 2B21A 3TADA 4OCZA 1R59O 5KG5A 3JPTA 3MN7A 2O8DB 1KQQA 5ALEA 4WQ4C 3SUNA 2IHMA 1T7PA 1NWKA 4JWNA 1XU4A 4CEDA 4OD0A 2DUYA 3L2UA 4DV3K 3WK7A 9ICBA 4LY7A 1BDGA 4B9TA 2QXLA 2AHOB 2JEFA 2XGPA 4JK1A 2XCAA 2YCHA 4BRGA 2XGQA 4F4YA 4DOCA 1D8LA 1DGKN 1Z05A 2VA8A 4RQNA 2ISPA 4BE1A 1RTDA 3M3ZA 2I6XA 9ICHA 3MC1A 5GADP 3RMBA 2BPGA 4K4HA 4DL2A 2XY8A 4FWLA 2VQFK 4JI2K 1GLDG 3FE1A 5DMRA 4H8KA 3VN5A 2LI6A 2QWMA 5J0XA 4F4WA 2QWNA 1RQNA 3AA2A 4IEIA 1E4FT 1QCKA 2ITMA 3L2RA 4PHTX 5EWFA 1TV6A 1SZHA 1WSHA 1TFRA 4IQUA 2BQUA 1WUDA 1HYZA 2EX3A 5AM1A 3HOSA 1C7YA 4NL9C 4DR4K 4IQVA 2YNFA 5AKHA 2W3RA 4CJUA 5M1KA 4C1NK 2HHXA 2Y9UA 1ZBHA 1EX4A 4ECXA 4UAUA 3AM9A 3ULEA 1XC9A 3RWUA 1N61A 2ESEA 2KK0A 1HLUA 2NRTA 4ILGB 4PY5A 2O8FB 3C6TA 2A1SA 4K25A 4IS7A 2D4WA 3HSTB 3KLHA 4CEAA 3SAFA 1O08A 1HQEA 4M47A 5GINA 1NI3A 4O0JA 4NLKA 4BRAA 3SI8A 1COOA 4O9MA 3V9ZA 1RPLA 1HKBA 2D6FC 4J9PA 4NLZA 3OHAA 3BGRA 2A5XA 5KFPA 2FSKA 1S22A 4B3OA 4P0QB 3C6AA 3C7NB 4YR0A 3DLEA 1GLEG 5KI6A 3FZHA 4B6JA 4CJPA 3LM9A 5KG7A 1YVNA 3K5LA 1NJYA 4Y1CA 1S97A 2Z7JA 4MEXA 5IIIA 3K5MA 4KB1A 4F5NA 1ZQFA 4AHRA 4JKEA 4CJSA 3CC4N 3BQTA 4CFDA 4IC9A 3BEXA 1K73O 1FIQA 3AL0B 3VQDA 1S3XA 2RQ5A 4FJXA 2JEGA 3T5LA 4GXKA 2FSJA 2RDIA 4HAIA 1A0PA 2EAOA 1NZPA 4RPXA 1LB2B 3N4PA 1V97A 4RW9A 4DFJA 3C21A 4PZNA 4DUYK 5IIJA 2YB1A 1ASUA 3WK4A 2PFUA 5BOLA 3AO4A 2D5RA 4AHVA 2F8KA 3OY9A 3Q8KA 3CP8A 3LYSA 1U48A 4MHVA 4LVSA 1WUAA 3O9QA 2A3VA 1QZ6A 2P6RA 2X74A 1S1UA 1LOTB 4C4TA 4YCXA 4EHUA 3E0FA 3ETLA 4O4GA 3OSNA 2RLTA 2FPMA 5HR6A 2ASMA 1B43A 4QOZB 4DCCA 5EXWA 4M42A 1KAXA 2DF4B 1SL0A 3EO3A 3PMNA 5DBBA 3L6QA 4FWNA 3VETA 3HRDD 3QZ7A 2YJFA 2NO5A 4FLUA 3PR5B 2PFPA 2ZIWB 4JN4A 5IWAK 8ICJA 1Q8IA 1S1VA 3R9PA 3VQ8A 4TURA 2XC9A 1IIPA 4ZH4A 4I2FA 1DK2A 3D0PA 4CVNE 3GIMA 3H7IA 3DAWA 2ODGA 1F0MA 5AI5A 1JXBA 1LW0A 4FVMA 4W5RA 4CGHA 2W11A 5B5EU 2BDUA 2WUSA 3BS5B 4RUAA 4UQGA 2W43A 4OKKA 4JHDB 5M1NA 4DR1K 3G6VA 3WK8A 4OJRA 5AQGA 3EY1A 3PR4A 4DS5A 2HNDA 5AZIB 1U49A 4QZ8A 3OJUA 4Y2JA 5DG7A 3PSTA 1ZXOA 4Y0WA 3T5JA 4M41A 4ED8A 4BR5A 1X42A 2RPIA 3PLAA 4Y2XA 1OVQA 2HSTA 4LSNA 5CA7A 1L3TA 3F5EA 5J2CA 2Q36A 4M7XA 5EY4A 4IOCL 4KHSA 3ZX2A 3KHLA 1ZQPA 3O3GA 3SENA 2DQNB 4Z4GA 2ZJ8A 5CJ7A 3TARA 2IA6A 4YMMA 1SXEA 3I8BA 1V38A 3OHRA 4EAHD 7ICIA 4WFBL 1QQ6A 3ZX0A 1T03A 4A59A 3SAGA 4J9NA 3TU5A 3ZEUB 1XI1A 4CJ3A 4IBNA 3NGZA 5CY4A 4BC5A 1QHAA 3HYFA 3ALRA 3T5HA 1MN8A 9ICLA 4QWAA 2DL0A 4FLVA 3TTFA 1J5OA 2DFFA 1FO4A 3SQ1A 1K1SA 4F8RA 4IJNA 1SL2A 1FKOA 3CCEN 1RBSA 2KD1A 3C6HA 4O5CA 3NVWA 4KHWA 3GL1A 5EE3A 4DSIA 3NASA 3EL2A 3KZBA 4ICLA 4FJMA 4LC9B 1ZQYA 4IXCA 1DXSA 1KTQA 5AQLA 3WXLA 2FPLA 4E19A 3ZSZA 1D5AA 5DG9A 2YB4A 4EBEA 2ZTDA 2VJ4A 3KBBA 3DLHA 2D8CA 3NGYA 4OGCA 3EYZA 2E6LA 3H46O 3QBWA 4KV8A 2RF2A 5C2DA 3LZIA 4CGIA 2CRXA 4DV2K 4J03A 4NJ8A 4OVLA 3SBTA 4JRQA 1L7MA 3VEYA 2VWKA 3RJFA 3H40A 4NXMK 3THWA 1S9EA 1VQ4N 4KRFA 3RH5A 4JHDA 4F3OA 3Q8LA 1NM1A 3KD1E 3F2DA 3LAMA 3FZMA 2KE7A 4Z6FA 2ZGZA 3DXMA 4GV9A 3L5KA 3H0RB 1DGJA 5C5JA 4U6PA 2KEYA 3P31A 5HROA 2G8FA 4F4ZA 1O1WA 5J8YC 3A2FA 5KQDA 4O3OA 1JXLA 3O3FA 5EWEA 1J5EK 4F5RA 1LWFA 3D2QA 1VRUA 4B1ZA 3FLCO 1ZBSA 1L6NA 1QVGM 5ADXA 2QB1A 3A0BU 5HL7L 4UBBA 1OW5A 4ID5A 2W55A 1S9FA 4KPYA 2P9LA 1HNIA 1KDHA 3RMAA 1A77A 4YR3A 3ZT4A 2W04A 3ENBA 3HXMA 2F9WA 1SQKA 3N97B 4WQ5A 3GE1A 4BRMA 3SZ2A 3C1ZA 2YMQA 4Q45A 1NJWA 1BCMA 2KHOA 1I94K 2D0CA 3RJJA 1XQSC 5JMVA 2BQ3A 1ASWA 2E3TA 2FDRA 4UARA 4KLMA 4OJ6A 4IFVA 1IV8A 4OJOA 4EX6A 1EQYA 4QZBA 3CYMA 3AAQA 2IVPA 4FWPA 3MECA 3IRXA 3D2FB 4P4PA 3CIPA 1FJGK 2H3ZA 3L3UA 2K4IA 4I9QA 4IEEA 2EQYA 4YR2A 3V9XA 2Z1GA 9ICJA 2GWSA 4O8UA 1LWEA 4XUSA 2F8SA 3NH0A 4GV6A 4JV2A 3GV8B 3ZDBA 3IMXA 4EHTA 1B22A 3ONNA 1ZQXA 4A61A 2W9AA 1QQ7A 4KX3A 3JS6A 2ZTCA 2ZM6K 3TAGA 4PHAA 9ICQA 4CK3A 1W2BM 2VJ5A 4CESA 3A0IX 4NLBA 3ZD8A 5FDLA 1CI4A 1RDBA 3ZT1A 4GXJA 7ICUA 1C0FA 5T7BA 1J2MA 1XSLA 2P9KB 3OTQA 4ISGA 2YTUA 1VQKN 4HTUA 1A76A 4CZLA 2F8TA 1MA7A 4DTSA 3NUQA 4CJWA 4H5TA 3O4WA 4O3RA 2G8HA 5AKJA 2KFZA 3AU2A 4DQPA 3MGIA 4M7YA 1PVQA 1HUXA 5CHGA 4YQWA 4IG3A 3DWLA 3VEXA 4W5OA 4W5NA 4OGEA 7ICGA 5D3GA 2ZJRL 5EOYA 5AFUA 4JI8K 1SGGA 2G8UA 3MR2A 2AU0A 4W5QA 2KZ3A 3T69A 2P5GA 4KREA 1NGGA 4KMUA 4RW7A 2GWJA 1RBUA 1N36K 2C2DA 4FLWA 3V7LA 1RT3A 4E1MA 3MDAA 1ZQZA 4AYBC 1MA9B 4DL6A 3HKZC 1JI7A 2HVHA 1VSKA 2Q1NA 4Y2TA 5BREA 4PGYA 3D2FA 7ICQA 5KGXA 2ZIWA 2VWJA 3MWPA 4IJAA
chains in the Genus database with same CATH topology
3T7ZA 1NGJA 5LJVA 3UXPA 3GDQA 3TFRA 3HPOA 4P4OA 4F2SA 4MO5A 9ICUA 2CH6A 1K8AO 2A41A 3C2KA 1BPDA 2PFOA 5AQIA 4BC2A 8ICVA 1NGCA 4JV1A 1Z00B 4BRNA 9ICOA 1MWKA 1YJ9N 2I7PA 3ZDDA 1T44A 4B1YB 1QQMA 1IG8A 2C22A 3HBTA 5AZJA 1TYQB 4H5WA 5KG6A 3O9TA 2HBJA 3TPQA 3ENHA 3SBGA 1VQLN 4BQZA 1SZPA 3O6WA 1J6ZA 1DEJA 2A1JA 1VQON 1AROP 8ICWA 4BWMA 2ASOA 5AQRA 1P90A 3V6JA 4RT3A 4F5QA 5KFXA 1JXEA 2Y1IA 1NK9A 1L5UA 5AQXA 4ECVA 3MABA 1RXWA 2QWRA 4BRCA 4UAWA 3AAPA 2HHVA 5M1PA 1HJPA 3ATUA 2VGNA 1VQ6N 2D1KA 5FPNA 4ECZA 1D9FA 1JX4A 2QW9A 3UB5A 1WCLA 1KFDA 5JUMA 4IOXA 3SV3A 4TUQA 3HP6A 2FF6A 4BRDA 1SKRA 4C8OA 4A5BA 4NXZA 2E2PA 4EIAA 5KFCA 3W3DA 5DQHA 2ZF5O 5F1XA 1QSYA 4I27A 8ICBA 3CCJN 3FDSA 3WXMB 3RJKA 3PW4A 4J9OA 4GC6A 1M1KO 3AARA 4E0DA 4JK7A 2WBNA 1DOQA 2HOEA 4KH5A 3BF1A 3E9LA 1QQNA 3CCVN 2UVUA 4H0TB 4ECQA 2Q0UA 1T3NA 3F2KA 1Y88A 4ECWA 3U9ZA 1YITN 2CGLA 4GC7A 4DWIA 4B9SA 4H5RA 1GLCG 3CCSN 5J2DA 2IMWP 4ILJA 2I1QA 3N4MB 1JN3A 4YFKA 2VWBA 3TQ1A 2W9CA 4J9QA 1X2IA 4PGXA 3PW5A 4DEZA 3EN9A 5J0YA 5KPRA 2OANA 3I33A 3BDPA 1CUKA 4I2IA 2XO7A 3UKRB 4M9LA 3H1QA 2VGMA 5KFBA 1L3UA 8ICYA 4LZGA 3G71N 3CCRN 3P39A 2P9IB 4MLEA 3ZD9A 1QSSA 4EBCA 3IFRA 1TUUA 5E84A 4DCHA 3E2EA 3DXKB 2ASPA 4KLEA 3SAHA 4DL4A 4FBUA 4RNNA 4QWDA 4DS4A 1RFQA 3R3LA 3AU6A 3Q8QB 2VCPA 4F5PA 2BTFA 3H3OB 2KLAA 4R66A 2HHTA 2PI5A 3RTVA 2KTQA 5AQFA 4ISEA 4WQ4A 8ICIA 1LV5A 3PMLA 2P9PA 3LDPA 4FS1A 1X9MA 3TSQA 3JPQA 3SYZA 4WFNL 1MC8A 1MQ2A 4XQ8A 2R8IA 3LWLA 5LY3A 2KFNA 4AM6A 9ICFA 2FF3B 3PVXA 1S0OA 3HRGA 3P38A 3SK3A 2E2QA 1HJOA 4H0PA 1Y64A 4FOIA 4DQRA 3C1YA 4FWMA 4EYHB 2FLPA 4KBOA 3BP8A 4XA5A 3EZWA 2W8KA 5IIMA 5C10A 1ZQJA 4O3QA 2P66A 4FWSA 1TAUA 4YOXA 3PW7A 3TAPA 5BN9A 4EZ6A 3V7KA 4RQ3A 3RJEA 3RVCA 2BCQA 4C1NI 3OHBA 2MAXA 4J9SA 1X9WA 1TYQA 4J8FA 5AQPA 1ZQTA 4I6MA 3RRHA 5C12A 2ZJAA 3KK7A 1ZQSA 5KT3A 1QSLA 2XY6A 4RTFD 1TV9A 5KG1A 3RAQA 3M5RA 3CJBA 4M0AA 4CD3A 5KT7A 4KLQA 2P9KA 4ED1A 4KLIA 4BC3A 3PW2A 1KFSA 1N48A 1ZQUA 5KFOA 3PO5A 8ICXA 4BGBA 1NGHA 2Q97A 3RB3A 5BRFA 3M9OB 1JCFA 1JMSA 7ICJA 3E9PA 5IIOA 1MQ3A 1U45A 4DOBA 3HX0A 2FLLA 2QWLA 4CJ7A 3VF6A 1BO5O 2YJEA 3LWMA 3Q8RB 2VANA 3PW0A 5DB9A 4RWTA 4H0XB 1QLNA 1UA1A 2A6AA 5DDMA 4ECUA 1H1VA 1U6ZA 3ISCA 3ISDA 8ICNA 5L9XA 2UVRA 4DSFA 4BG8A 2NRRA 2VA3A 5AQTA 1CZAN 3MBYA 5HP4A 3RJHA 5CR4A 4MFAA 3CERA 3E9OA 3QZ8A 5J2EA 4KLSA 4JWMA 2ZUBA 4RUCA 4JKFA 3NMUA 3VOVA 5KT6A 1S72N 1XUPO 1MDUB 2JZBA 4DL3A 3NTUA 2R8KA 5D46A 3O08A 1NKCA 3H45C 8ICMA 3J8AA 1RYRA 4C8LA 5J0OA 5FPMA 4C8NA 5J0RA 1VQPN 4BRHA 2P9NB 3OBWA 1NKBA 2BPFA 4IR9A 3A5OC 3C0BA 9ICEA 3Q8MA 4CBWA 3BQ2A 4MF2A 4JKCA 1NBWA 4DSJA 4DKWA 4DF8A 4JK8A 4G3IA 2V51B 5KFUA 5FPDA 4IRKA 2W9BA 3VF2A 4ED7A 3V6HA 2C28A 3C23A 1YUWA 1ZQVA 2Q0RA 1KXPA 4BRPA 3DLLL 2GWKA 1EO1A 4KH6A 4IQWA 2BH1A 2MUTA 2OTLN 2E20A 4BXOA 9ICRA 3WXKA 1ZQKA 4GY2B 1NGAA 4H03B 4A57A 4O0IA 1N56A 2ZJQL 9ICPA 2DPJA 5M1FA 3L4QA 4QS8A 4B1VA 4YOTA 5AQUA 4YMNA 2H5XA 3CCMN 3PY8A 5BR9A 5KFVA 4O8KA 4DL5A 3KHGA 3DXMB 3EKSA 9ICTA 3F9MA 5BRDA 3ZX3A 3O80A 4I2JA 3D7EO 5AQSA 3E1YA 3TI0A 4BROA 1VQNN 3GBTA 1MWMA 1Z6RA 8ICCA 4JKHA 4GXIA 3CJCA 2CGJA 2P9SA 3UKUA 1ZQNA 3G6XA 3FZFA 2XY5A 3FGUA 1VQMN 2UYTA 5KFGA 4TUSA 8ICAA 3BQ1A 5L1JA 1KAZA 3U9DA 4JK9A 3RH4A 3CHWA 1BPBA 1UT5A 4WQ5C 4MLHA 2E1ZA 2FSNA 2MUTB 2FMPA 4F4XA 3H8JA 1TAQA 3GIIA 3EPIA 9ICKA 5AQQA 4WF9L 2JZBB 2LYHA 3FYHA 3MFIA 5L1KA 4C8KA 4F93B 2ZJ5A 4ISFA 4M9GA 3KWIA 4QS7A 4UAZA 4H0YB 1QTMA 3LK9A 9ICWA 3BQ0A 3PX6A 4RPYA 3RR7A 3MMVA 4JKBA 4KLJA 2ZJPL 3VENA 1IM4A 4I2HA 3IKMA 4DF4A 2P6UA 5HMLA 3B8AX 2JWKA 5B8HA 4WFAL 1SKSA 4CD1A 3VTIA 4IDHA 4F2RA 3NGDA 4PKGA 5DDYA 4FPAA 5KFIA 3OW2M 1NK4A 3WXIA 1YIJN 3CXCM 2J6UA 5J2HA 1XSNA 1Q81O 1X9SA 9ICVA 4F9OA 1YI2N 1NGIA 3MK6A 4RQ7A 3HI0A 5KPZA 3M9NB 1KRPA 1GLBG 1ATSA 5KG4A 5J0SA 2R8HA 2E1YA 4CZIA 7ICTA 3ZDCA 4F4KA 4OO1J 4NLGA 4DSEA 5H1SQ 3ID8A 3SJHA 5J2KA 3WEEA 1S0VA 2IBKA 1YHQN 5J0WA 4RNMA 4PGQA 3VEOA 5KQ8A 1YJWN 3HWTA 1ZQDA 5KG2A 4JAXA 3A5LC 2AGQA 3GOIA 3SMPA 4DLEA 2V7ZA 4A62A 4CZJA 5DLFA 3ISBA 4J9KA 2C2EA 4J9MA 2PBDA 1MSWD 2P9PB 3ID6A 2KZMA 3C5GA 3QDKA 3NVMA 4YXJA 3Q8PB 1KFTA 4JKDA 1VQ9N 9ICNA 7ICHA 3G6YA 3MR3A 4B1XB 3HZ6A 7ICVA 3RSEB 3TSUA 4ECSA 3Q8SB 4JUZA 2VYPA 3EKUA 5HOOA 5DQGA 4BR9A 2AGPA 3UXOA 4MFFA 1NLVA 1ZQBA 3QMLA 4BDPA 7ICPA 3RBEA 4JKGA 1VQ5N 3GG4A 4PL7A 1WCNA 3EPGA 3PO4A 9ICMA 4DHYA 3PIOL 5KG3A 4RQ5A 4M6WB 3MWTA 2NZTA 8ICUA 3LDOA 3MGHA 1KAYA 3CJ1A 3LM2A 3D6RA 1IXRA 4A5AA 4MEYA 3VEZA 3HTVA 1KD1O 3AY9A 3V6KA 2HHQA 3VGKA 5TKWA 4BRFA 2YHYA 1YXQA 3CMEN 3WQTA 2QM1A 4O5KA 2E2OA 3M8RA 7ICEA 4FWKA 5DB6A 1IJJA 2ISOA 3A5MC 3BF3A 3CF5L 2BDPA 3O5BA 4HTLA 1UA0A 1LCUA 4RQ6A 1NMDA 3R8EA 1ATNA 4MFCA 3DXKA 5M1OA 4YDUA 4BR7A 1ZQHA 2BGWA 4B9MA 2ZGYA 4RPZA 3VF4A 5JVGL 4IFEA 3HW8A 3H4DA 2ATLA 2HBMA 4CCHA 4QW8A 1XO1A 2AQ0A 4WYBA 2P9NA 3ZDAA 3KVGA 4Z6EA 9ICCA 3QEBZ 1RXVA 5DLGA 4QWCA 3IDHA 5J2JA 5KFHA 3ZDEA 5KFEA 4TQSA 5ADXH 3I55N 5J0PA 4YD1A 4YOWA 5JVHL 4OPAA 4KLLA 3SMSA 2JWLA 1QZ5A 3J7ZO 2ASLA 4I2DA 1K9MO 4PL8A 1ZQCA 4K43A 5ELZA 1QVFM 2Y1JA 2KKZA 2HF4A 1Z3EB 2JEJA 5J2IA 3KHHA 2RHKA 2QA4N 3OJSA 2V52B 1XC3A 5BPNA 7ICOA 1ZQQA 1BA0A 1YF5L 3H3NO 3UPQA 3L0QA 1ZYQA 3MX5A 4BVOA 4TUPA 3MDQA 4O3NA 7ICRA 1ILYA 4J9LA 5KFWA 4NY8A 3CCQN 4EBDA 1S0MA 3MN6A 3OGUA 3F5TA 2QWPA 3MCAB 2V7YA 3O8MA 8ICRA 4Q43A 1BA1A 3E66A 2V4QA 5KFSA 5F0XA 3QFPA 5J2FA 4BR0A 3TANA 4Z6DA 3C5FA 3CETA 9ICAA 3IUCA 3EE9A 4I2CA 4LZDA 5KFYA 3RB6A 2R8GA 5KFDA 1NK8A 4I28A 1K8KB 5EVZA 4PH5A 4C23A 5BPCA 3ULEB 2BCSA 3AGRA 2D0OA 4PHDA 4BQLA 1U2VA 2A40A 1GLFO 4P2HA 5DQIA 3TTDA 2BQRA 3PV8A 4Q8FA 2W9BB 2Q2RA 5DB7A 5CB1A 5D4BA 4H5NA 4M9NA 9ICSA 4CZKA 4ECRA 4BRKA 2CH5A 4H0VB 3GQCA 1L3VA 3H6EA 2ASJA 8ICZA 2PFNA 4QW9A 3MN9A 1BGXT 3TSPA 1OKJA 5KTQA 4BR4A 4F92B 3O9RA 2YI1A 5EX5A 2P9UA 3MCPA 2NNWA 1ZQWA 5CHIA 3M8SA 1QQOA 1NK7A 1ZQEA 3VERA 2ZUDA 1BOTO 3ZEUA 4YDUC 4J9RA 3LDNA 4FOEA 4JD2B 4QZGA 4DB3A 3GV5B 4UB1A 4EZ9A 4HWIA 5AQZA 4KLUA 4BRLA 2GTDA 4PHPA 5J0UA 2QEXN 2PI4A 5DM7L 3CJ9A 3TFSA 1PZNA 4QZIA 5KT2A 3KTQA 2GEMA 5C15A 4KLHA 5KFAA 2J4RA 4CBXA 2I9GA 5BN8A 2KZZA 3OBYA 1U47A 3RB4A 5KFKA 2VA2A 3R6MA 1N8RO 4UAYA 4RNOA 4M04A 3WUHA 1X3NA 3QFUA 1XSPA 4KN7A 5DGBA 4B9NA 2PXIA 1KQSM 1H38A 4JEPA 4M6WA 1BUPA 4ELTA 4ELUA 2AQ4A 5D49A 8ICQA 2H3GX 2AJQA 1RDWX 2NRWA 3A8YA 4JNEA 4AF1A 3JPPA 3UKRA 9ICXA 2NRZA 2HBLA 3CPEA 4PHEA 3K4GA 1YJNN 1D8YA 2HMPA 5IIKA 3VESA 3K9KA 3VEWA 4DL7A 1ZJNA 5GAHP 1BPZA 2NLXA 4FS2A 3KHRA 4ECTA 7ICSA 1X9JA 1D4XA 4RCHA 4XRHA 4DOAA 2WTFA 2J6TA 2PAVA 1U9LA 1T6DA 5I9EB 4NM1A 4QZ9A 5C0YA 1U4BA 5AQJA 3GV7B 4MDBA 1ZC6A 3CCUN 3LDAA 4XEIA 5FPEA 3CMAN 5CP2A 5IINA 1TK5A 4RQ8A 4FPBA 2BKEA 3Q7CA 4YOVA 2YHXA 4EFHA 3RSEA 4RZRA 2YX6A 4DFKA 3PX4A 1BVSA 4I2AA 1JCGA 2QTDA 5TKYA 8ICKA 3LDQA 3ZYYX 1NK0A 1X3MA 4I6MB 5CWRA 3PIPL 1GLJO 1BPYA 3H1VX 3VTHA 3WXJA 2CGKA 4RQ4A 2A42A 3MR6A 2GUPA 1Q86O 3JPRA 2NRVA 4QWEA 4Q8EA 5AQOA 4YVZA 4I29A 4I2EA 5KT5A 5KFMA 3RH6A 3CD6N 2WC9A 4BG9A 4GLXA 4DQQA 1T6CA 3QEAZ 3D2EB 5F2RA 1NJZA 3L4IA 3FR0A 8ICLA 1NOMA 4R64A 3UQ2A 4UB3A 3GILA 4RU9A 1Z00A 4IO8A 4YN4A 4YXMA 1S10A 2A3ZA 3KWGA 3JXUA 4FO6A 8ICHA 2NRXA 1KSPA 4DQ8A 2A1JB 5DB8A 2FMQA 4BC4A 1XWLA 4K4GA 2HHSA 4NO7A 4YD2A 2XY7A 3MN5A 1XS9D 4X5VA 3AGKA 3DJCA 7ICKA 1RYSA 3RR8A 2FLNA 4FVUA 2BCRA 4YOYA 4I2BA 3O9UA 7ICMA 4PKHA 2IHNA 5GIPA 4BWJA 3K9JA 3PX0A 4UB2A 1JCEA 5KFLA 2W9CB 5HHIA 4IRDA 1BPEA 4QZAA 5AZIA 5BPLA 1NGBA 5DG8A 4DO9A 2F1HA 1SKWA 2FXUA 4GNIA 3O9SA 3VGMA 1BPXA 2F1IA 3OSPA 5BPMA 3GIKA 4K41A 8ICPA 2QWQA 3EZ5A 5KFRA 1HKGA 3RJIA 4KLOA 3IHQB 3TAQA 2DPNA 3H4BA 5AQYA 1JIHA 3ZETA 4BRIA 1HUOA 4NLCA 4DSLA 5DGAA 2BCUA 4XH4A 3G4SN 4CZMA 5HMMA 4PKIA 5F9LA 3OA9A 4MO4A 2HF3A 4CZGA 2FMSA 8ICOA 1ZQAA 5KT4A 4EEYA 3RAXA 2P9LB 3VGLA 5CR0A 3B0YA 2HHUA 5AQKA 2IVOA 8ICFA 4WCEL 4GVEA 1KC8O 1DKGD 4H0OA 2HW3A 3K75D 5DBAA 4KLFA 4JV0A 4FL9A 2JEIA 4EYIB 2Q0ZX 5EOZA 3W0LA 3QB0A 3T5KA 2UVWA 4G9ZA 5C2FA 3HOTA 4BXOB 4I2GA 1T8EA 3H8SA 2F7TA 5MLCQ 4KTQA 2P9SB 2BPCA 3ENOA 4B9QA 1G99A 1NK5A 4DLGA 5AQNA 4Z6CA 4QZDA 3D2EA 1U2VB 3WQUA 2RDJA 2ALZA 1D9DA 2IIRA 2ZUCA 4P4MA 1VQ8N 3C2LA 4YOUA 3M1FA 4O3PA 4BGDA 4ILHA 1VAZA 4KN4A 2C2RA 1S77D 1ZQOA 2OTJN 2M9NA 5GAGP 5HHHA 4QZCA 2HHWA 2RE2A 3VMFB 1T3VA 1W97L 3EW9A 4BREA 5F9NA 5JLFA 4R79A 4CI6A 2HBKA 2BCVA 3QICA 1S76D 4U67L 3BJYA 4QWBA 5IILA 4IO9L 2FPKA 4YMOA 3ATVA 4A2BA 5EWGA 5AQHA 5KFNA 2XCPA 4C8MA 2F1JA 2BHNA 5KG0A 5AR0A 2D0PA 5HNKA 1ZQGA 5TZVA 2F9TA 4RQ1A 4QZFA 3UQ0A 9ICGA 3G25A 5DKWA 3JPSA 4R63A 2W8LA 4JKAA 4CZEA 4XH1A 2P9IA 5L1IA 4KH4A 5JLHA 4DFMA 3ORYA 3R1XA 2W40A 1M90O 4ED0A 3AUOA 4UBCA 3MFHA 5KFZA 4BRQA 3ZETB 4ED2A 5DBCA 3QBXA 4O5FA 4F91B 3SV4A 4O3SA 4M9HA 3CPWM 1Q18A 2IVNA 4QZEA 3T3FA 5E26A 3CQYA 4F5OA 3I56N 4QS9A 2BUPA 5KFJA 2P9UB 3EE8A 3MX2A 3VPZA 1TK0A 4MDAA 3C7NA 3RJGA 2QWOA 4BY9C 3V72A 1NJXA 4FWQA 2FLOA 1EXNA 8ICTA 5L1LA 4M9JA 1S0NA 4AM7A 1ZQRA 1HKCA 8ICSA 4NM2A 3EWAA 7ICFA 3QE9Y 4RT2A 4BR2A 5KFFA 1L3SA 4B1WB 4DQIA 1RZTA 4KLTA 7ICLA 2E8AA 2EWSA 3MR5A 5J2GA 1ESVA 1V9PA 2BR0A 1ATRA 4HYKA 1E4GT 1ZQLA 3UKUB 3RB0A 4KLDA 4YG2A 1O13A 7ICNA 2AGOA 4BGAA 1SZ2A 1HUZA 3CCLN 4IRCA 5J2AA 8ICGA 5J29A 3M9MB 3N4QA 2GX9A 3NVKA 5J0QA 1ZJMA 3FZLA 4ELVA 4FWOA 5DM6L 1BWFO 4XH5A 4A2AA 3B0XA 1NGFA 2V9WA 9ICIA 2W41A 2Q31A 4K42A 2E88A 1UT8A 5AZJB 5LJWA 1SAZA 2J6SA 4B9VA 3JPNA 3THVA 4O5EA 2AA4A 1YAGA 1GLLO 4OPHA 5BRHA 4FBTA 4KLGA 3GIJA<