2NRWA

Crystal structure of the c terminal half of uvrc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
217
structure length
204
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHTVASLVVFEDGFPKKGDYRRYKIEQDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 63
structure length 204
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrwA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrwA01
2C2RA 3OSPA 1ZQNA 1S97A 4XQ8A 1ZQGA 2BPGA 7ICSA 3ZDCA 4O5CA 5KFVA 4NLZA 4G3IA 5D46A 1V9PA 2MUTA 4DEZA 3TANA 3Q8KA 4B9NA 4EZ9A 7ICTA 2XY7A 1ZQLA 4RQ4A 2ZTCA 1IXRA 3RRHA 5J0YA 1S9FA 3GV5B 1S10A 5J2JA 4IQVA 4PH5A 3GFKB 4J9SA 5L1LA 1NK8A 3RJFA 8ICOA 2F1JA 4ECYA 3PY8A 2AJQA 7ICJA 5EWEA 5IINA 4ECSA 8ICLA 2KN7A 1NK6A 4TUSA 4ECWA 1X9WA 5J2BA 1U48A 3RAXA 4RU9A 3M9OB 3PX0A 5KFAA 2BKEA 5HNKA 4YXJA 4J9RA 3TQ1A 2C28A 3SV3A 1NJYA 1S77D 2AQ4A 4I2HA 4EZ6A 1T7PA 1NKEA 2BCQA 4UB2A 3V6HA 5DBBA 4NXZA 4RQ1A 4DSEA 1ZJMA 3RRGA 4YG2A 2KZMA 5IIKA 3H4BA 4EYHB 3Q8LA 9ICCA 2FPLA 1T3NA 2AGQA 4M9NA 4RT3A 7ICLA 5KG4A 1ZQDA 5KFJA 4YMMA 3PNCA 4ED7A 3T5HA 4NM1A 4EEYA 2HHUA 4QW8A 5D4BA 4QZDA 2ALZA 4IRCA 1SKWA 2HVHA 2F1HA 4F4WA 2NRTA 3HT3A 1S0NA 2HHWA 2C22A 4KLQA 4KLIA 5KT5A 1DGSA 1SKSA 3T5JA 1B43A 5KT7A 2XO7A 7ICHA 1ZQWA 4J9OA 5CR0A 1ZQVA 2UVRA 4JV1A 4F92B 5J2IA 5DQIA 2AU0A 2AGOA 4O5KA 5J2GA 4Q44A 5KFSA 3ZDEA 3HX0A 4RQ5A 4RQ6A 2RDJA 4UB4A 4F5RA 3PW7A 3Q8SB 2DPIA 4ECTA 2WTFA 1SL0A 1QTMA 4LZDA 1TK0A 4KLEA 1BPEA 4F91B 5J0PA 1ZQHA 1XSNA 5J2FA 4R63A 3MDAA 3ISBA 5KFIA 4NLGA 3G6VA 2JEIA 4RPXA 8ICUA 4NY8A 5J0UA 4MF8A 3M8RA 3OHAA 1AROP 5CB1A 3SZ2A 3LWLA 2A1JA 4YR2A 1HUZA 2FLNA 1RPLA 1U4BA 4NLNA 4DS4A 4DQQA 4DL3A 1D9FA 4YVZA 5KFZA 5KFXA 3V7KA 4X5VA 4BWMA 2ISPA 7ICOA 8ICSA 3QZ7A 1QLNA 4QWAA 3BQ1A 4TUPA 5J0QA 3RJKA 3C5GA 3BQTA 4DL6A 3EZ5A 4RPZA 1JN3A 2C2DA 2BCSA 5KFEA 3M9MB 1N56A 4M9HA 2NRRA 1X2IA 1XO1A 5JUMA 3ZD9A 3HWTA 2IBKA 3TARA 2P66A 3SI8A 8ICBA 4MEXA 5DGBA 1ZQCA 5HMLA 5DB8A 3RBEA 1ZQKA 3PO5A 7ICGA 5DQGA 3JPTA 4DOCA 1BGXT 1A77A 3MGIA 1RXWA 1NJZA 4ELTA 1X9SA 1TK5A 3EPGA 3QE9Y 1ZQAA 3ZDBA 4FBTA 3UXPA 5J0OA 4RT2A 1T8EA 5DLFA 4TQRA 4TQSA 1KLNA 4BWJA 5KFMA 4XA5A 4DFJA 4O3RA 1N48A 3T5LA 4C8LA 2ZUDA 4C8NA 5KG3A 5CWRA 2J6UA 4BDPA 2R8GA 5KT6A 5KFQA 1BPDA 3Q8PB 4KLUA 1L3SA 5BOMA 2UVVA 2ZJ5A 4KLDA 1ZQPA 1NOMA 5KFUA 3MR3A 1TK8A 3H40A 4I27A 4QZFA 5IIMA 4DL7A 4P4MA 1ZQZA 9ICSA 3UQ2A 4I2BA 7ICQA 4YP3A 8ICCA 3M8SA 1ZQEA 4NLKA 1PZNA 4O0IA 4YCXA 4RUAA 2XGQA 7ICEA 2JEFA 1A76A 4YMNA 1DOQA 3UQ0A 3KTQA 4KN4A 3G6XA 4YQWA 1TAUA 4IR1A 1U49A 2Q0ZX 4GC6A 2HHVA 9ICUA 5DQHA 4O5EA 3RJIA 5DB9A 4RUCA 3B0XA 2XGPA 1QSLA 3AU2A 4UBBA 4UQGA 3PX4A 4DFKA 5HMMA 5CJ7A 2A1JB 5KFTA 2W8KA 3C2LA 3C2MA 1BPBA 4ED3A 5J2DA 1SL1A 1JX4A 1CUKA 3PW0A 2BCVA 4O3SA 8ICRA 1QSYA 4UBCA 4F3OA 1IM4A 3C23A 3RH5A 8ICZA 3T3FA 2ISOA 1JMSA 2XCAA 4I2FA 2PFQA 5L1IA 5HHHA 4JK1A 5DKWA 1NKCA 4PGXA 1NJWA 5KFRA 3RB0A 4IQWA 2XY5A 9ICWA 3V6JA 3RJEA 5KT2A 9ICEA 2P6RA 5KFHA 4DSLA 9ICHA 1HJPA 3Q8MA 1BVSA 5IIJA 4IR9A 1ZQYA 4DF8A 5KFGA 4LVSA 2JZBB 2DPJA 2HHSA 1KTQA 3RH6A 2IHMA 3HPOA 2ASJA 1L3UA 1XWLA 2IMWP 2HVIA 9ICIA 4F5PA 4QZHA 3ISCA 4EBEA 5J2AA 3Q8RB 4DSKA 3RB4A 1U47A 4I2DA 3N97B 3KHLA 3RB6A 2FLPA 5DB6A 4KLMA 4RQ0A 3MBYA 1UA0A 8ICNA 4UB1A 1U45A 2UVWA 5F9LA 3IM1A 4Z6FA 1JXLA 1ZQFA 2FMSA 1K1QA 8ICKA 1RXVA 2PFOA 8ICTA 4QW9A 4RPYA 2PI4A 4F2RA 9ICTA 4PHAA 1H38A 2ZUCA 1S76D 4ECQA 4J9NA 3C21A 1S0VA 4QWEA 4B9LA 3B0YA 8ICYA 5KFCA 4DS5A 1NK5A 4QWBA 2VA8A 5TZVA 2BHNA 2W9BA 1TFRA 1MQ3A 5CHGA 2LYHA 3PR5B 4RNOA 1RZTA 2FPMA 5IIIA 4KMUA 2BR0A 1C7YA 3JPRA 4P4PA 1XU4A 3K75D 3BJYA 4KN7A 5IIOA 4J9LA 2J6TA 1D8YA 1ZETA 7ICFA 4JWMA 2MUTB 2R8KA 4Q43A 4UB5A 2W8LA 4BXOA 9ICGA 5EWGA 8ICEA 1CEZA 4MFFA 3PR4A 2ASDA 5DG8A 2Y1IA 4JUZA 1MC8A 5J0XA 3FYHA 4I2AA 4RZRA 1ZQBA 2R8JA 5F9NA 1SZPA 5KG7A 3EPIA 4B9VA 2P6UA 5DG9A 3GIIA 3PVXA 4MFAA 2W9AA 2KZ3A 5KFKA 2OWOA 3V7JA 5DG7A 2IHNA 8ICIA 2BPCA 5D49A 3KHRA 5L1KA 3GIJA 3AU6A 3GIKA 3V6KA 3UPQA 1TAQA 7ICVA 2MAXA 2J6SA 3RB3A 2GWSA 4FBUA 2HHQA 2BGWA 3H8WA 5DBAA 4IQUA 4F4ZA 3RJHA 1L3VA 3UXNA 3MR6A 3KHGA 3RTVA 4ECXA 2FLLA 4XUSA 1X9MA 4DF4A 5KFFA 5KT4A 3RAQA 4DFMA 7ICPA 5L9XA 4DL5A 1KFDA 4I2EA 4M9GA 1EXNA 2BQRA 8ICXA 3BQ2A 4RQ3A 2XY6A 9ICJA 5DB7A 4JV2A 5KTQA 4UAYA 2BPFA 2NRVA 3EW9A 4ZH4A 4YR0A 5J2HA 3PW5A 2C2EA 1ZQOA 4DSJA 1BPZA 4O3NA 5CP2A 2BDPA 3THVA 3JPNA 3V7LA 3T5KA 1UA1A 2VA3A 3BDPA 4DQPA 8ICPA 4B9SA 4Z6DA 1S0OA 2FPKA 4EBCA 5KT3A 4QWCA 3MR2A 3NTUA 2W9BB 9ICOA 4B9MA 3HP6A 3C1ZA 1D8LA 5KFDA 1U9LA 3PMLA 1MSWD 7ICNA 9ICBA 3PW2A 4MEYA 4J9MA 4KLTA 7ICRA 4RNMA 7ICUA 4CCHA 5J29A 1BPXA 3V72A 1QSSA 4F4KA 2B21A 4BXOB 4DL2A 4GXKA 1ZQMA 5C5JA 4B9UA 4K4HA 5IILA 2ZTEA 4FS1A 1L5UA 3QEAZ 4I2IA 4KLGA 7ICKA 4C8MA 5KG1A 4FS2A 3HW8A 4RQ7A 4GXIA 3RJJA 3LK9A 4DSIA 4O3PA 4JV0A 1ZQRA 4QZGA 1SL2A 1NK0A 3QZ8A 4HYKA 3QEBZ 4F5NA 4DLGA 4M6WA 3SYZA 3TI0A 4DLEA 3OJUA 4NM2A 3PMNA 4LZGA 1Y88A 5L1JA 4KITB 3PO4A 4ED6A 4QZ9A 8ICMA 4XRHA 2VA2A 4KLFA 4ECZA 1KEJA 4PHEA 1TVAA 4E0DA 4F4YA 1Z00A 4M9JA 9ICVA 1SKRA 4RNNA 3GIMA 4C8OA 4C8KA 4JWNA 2XC9A 4J9KA 2BCRA 1Z3EB 1RYRA 3RR7A 4Q8FA 3G6YA 4GC7A 4PGQA 3UXOA 2F1IA 3TAQA 4I28A 2FMQA 5KFWA 1NJXA 2UVUA 2IA6A 5J0TA 4DQIA 2BQ3A 3NGDA 4DFPA 2AGPA 2BCUA 1KFSA 4UB3A 1JXEA 5KG0A 3M9NB 3LWMA 3EYZA 4PPXA 3JPQA 4KLOA 5DBCA 5J2EA 5CA7A 2ZJAA 4KLHA 5J0SA 4PHPA 5BOLA 3GV8B 3RR8A 2NRWA 3OJSA 2PXIA 1NK4A 1LV5A 9ICQA 2ZUBA 4KLLA 4Q8EA 3GV7B 3K4GA 4QWDA 3MFHA 3LDAA 3JPSA 1WCNA 1KSPA 4M04A 2HHTA 4PHDA 3AUOA 3E2EA 4YXMA 9ICKA 4QZIA 1ZQXA 5EOZA 2W9CA 2R8IA 4GLXA 2BQUA 4R65A 3PV8A 4K4GA 2KFZA 9ICLA 8ICVA 3MABA 3ETLA 4KLSA 5J0WA 3N4MB 4UAWA 4QZAA 2XCPA 1XSLA 8ICWA 4FO6A 4IRKA 2HHXA 5DLGA 4MFCA 4ED0A 5BPCA 3JPOA 1NK9A 5KFPA 3C65A 3RH4A 4YD1A 2V4RA 3MGHA 3BQ0A 3PW4A 4J9QA 1COOA 1TKDA 4IRDA 3MDCA 4DSFA 3C5FA 3OSNA 3PX6A 1XSPA 2V9WA 4O9MA 1TV9A 1KDHA 3OGUA 9ICPA 1NK7A 4EBDA 4ED2A 1ZQJA 1BPYA 4M6WB 1KRPA 1NKBA 4QZCA 4QZBA 2I1QA 3EWAA 4DL4A 4Q45A 1JIHA 2PI5A 4I2CA 1ZQSA 3KHHA 1ZYQA 4Z6CA 4DO9A 2PFPA 4R8UA 2JEJA 2M9NA 4I29A 2R8HA 4ELVA 4GXJA 4F8RA 4M47A 2KTQA 1Z00B 9ICFA 3RBDA 3OHBA 5KFOA 3H7IA 2ATLA 4M9LA 2NRXA 3Q8QB 5KFYA 3TFRA 4O3OA 1K1SA 2DFLA 5DDMA 7ICMA 5EWFA 4R66A 3SV4A 1KFTA 8ICJA 3ORYA 4KTQA 1HUOA 4DWIA 9ICNA 3H8SA 2AQ0A 4F5QA 3ZDDA 4TUQA 2FMPA 3H4DA 3JPPA 4DOBA 2NRZA 1XS9D 4P2HA 8ICHA 4ECUA 4KLJA 4M2YA 3FDSA 1LB2B 9ICAA 7ICIA 4YN4A 8ICFA 4F2SA 9ICMA 8ICAA 1RYSA 4YD2A 8ICQA 8ICGA 5DGAA 5KFLA 9ICXA 4ECVA 2ZJ8A 1T4GA 4F50A 1B22A 4ECRA 2H5XA 4R64A 3C1YA 5J2KA 4EYIB 2ZTDA 4J9PA 2JZBA 5J0RA 4M0AA 4RQ8A 3ISDA 3GQCA 1L3TA 4ELUA 2W9CB 5DDYA 4PGYA 2Y1JA 1ZQQA 4YFKA 4Z6EA 1UT8A 4P4OA 4F5OA 2PFNA 4DOAA 5KG2A 5KFBA 1WCLA 5KG5A 4YR3A 4ED8A 5HP4A 1ZJNA 4DQSA 3RJGA 2KFNA 2RDIA 3ZD8A 2W9MA 5KFNA 3C2KA 4BGDA 2KZZA 2V4QA 4TURA 3TFSA 4IQTA 4F93B 1D9DA 1S0MA 4B9TA 3GDXA 4QZ8A 4K4IA 3MR5A 1XC9A 1ZQIA 4O3QA 1ZQTA 4UAZA 3GILA 4MF2A 3IHQB 4QZEA 2HW3A 3H8JA 4DQRA 2ASLA 2JEGA 9ICRA 3MFIA 2I9GA 1MQ2A 1UT5A 4RQ2A 4I2GA 4R8UB 5HHIA 4ED1A 3TAPA 3ZDAA 2VANA 4I2JA 4YMOA 5J2CA 1ZQUA 4F4XA 5KG6A
chains in the Genus database with same CATH superfamily
2C2RA 3OSPA 1S97A 3CC4N 4O5CA 4KHSA 1FIQA 1PK3A 1U6ZA 4J03A 1T6DA 5FPMA 3ASMA 1RDDA 3Q8KA 7ICTA 4DMNA 3E9OA 2KJ9A 4CF4A 2HNZA 4AHVA 4A5BA 4U7BA 2V52B 4IBNA 3EKSA 5J0YA 1S9FA 5J2JA 2DKXA 1NZPA 1HMVA 1NK8A 4BR5A 2F1JA 5AM0A 3VGMA 5IINA 2N1RA 8ICLA 2OZMA 1NK6A 3H8MA 1HX1A 4ECWA 2K4HA 1BQMA 4PL1A 2IOFA 5EE9A 1HRHA 2A3ZA 5BPNA 1YJNN 1ZD5A 4IDKA 2YY6A 2BUPA 4RQMA 3EO3A 2NRHA 5HROA 1Z26A 1S5JA 3SV3A 3NAEA 4EZ6A 3MN9A 1NKEA 4NCAA 4UB2A 3V6HA 4NXZA 4RQ1A 1N5WA 4E3SA 5EE3A 4IFEA 2YHBA 4DUZK 9ICCA 4I6MB 4EYHB 3Q8LA 2E4LA 1T3NA 2AGQA 4M9NA 4RT3A 4KMOB 3AGKA 1ZQDA 4CFBA 1N63A 1HNVA 2KSOB 3QETA 4Y2XA 5KFJA 4B3OA 3OYBA 3GL1A 5GTHU 4QW8A 3H3NO 3V4IA 5AKLA 5I42A 4IRCA 3K5OA 3J7AP 2LM1A 4FW1A 1YXQA 5CZ1A 4F71A 3E9PA 4IEEA 4KLIA 3KZIU 3VQ6A 1GLDG 4JK7A 1B43A 7ICHA 4FWLA 1ZQWA 2YX6A 2ZIUB 5AQUA 1ZQVA 4JV1A 5AZJB 2BGGA 5DQIA 2AU0A 4O5KA 2HMPA 4KO0A 5J2GA 2HMIA 1X9XA 5LMUK 2RDJA 4F5RA 4BY9C 3Q8SB 5JICA 1JLQA 4CI6A 2G06A 4FLXA 4OD0A 5M1PA 1IBLK 4F91B 3LZJA 4FLYA 4CGDA 4M42A 4DR2K 5AI5A 4OJOA 5KFIA 2QK9A 3G6VA 4XH4A 1ZXOA 1YJWN 4FJMA 3ZEUA 2FE9A 2W7OA 3C28A 4EELA 3OHAA 3S3OA 1Q9YA 3G0ZA 3SZ2A 2ASPA 3V9SA 1WSGA 4DQQA 1D9FA 5EX5A 5ALUA 3FM9A 5GAEP 1I39A 1H1VA 3GBTA 1YZ6A 5AK6A 4TUPA 1KL9A 3KD3A 3HM9A 4H0XB 4HVJA 4WFBL 2WUSA 2UXBK 4CEEA 1NGIA 3M9MB 1N56A 1NGFA 3MECA 4FVMA 3VN5A 4M3RA 1NOZA 2HBMA 1NGAA 2OPSA 3JXUA 1ZC6A 2K60A 1ZQCA 5HMLA 4AQYK 4LF8K 7ICGA 4KHQA 1C0FA 1BGXT 5HRSA 1A77A 3ZYYX 3MGIA 1RXWA 4DV7K 4CZFA 3SQ1A 3QUQA 4OJ5A 3EPGA 3QE9Y 4CHQA 4EIAA 4FLUA 5J0OA 2PY5A 5BR8K 4O3RA 5BRHA 1JXBA 1M1KO 1N48A 3AN1A 3DAWA 1JUDA 3P5JA 2EHGA 5KT6A 1TUYA 1BHLA 3D2FB 3MWTA 5KFUA 4N5SA 2DPNA 5ALOA 3UQ2A 4I2BA 4U67L 3HRDD 2A6AA 4GVEA 3M8SA 2G5HB 2KHOA 1ZQEA 4YCXA 3NGZA 2YX8A 3QU9A 4YMNA 5AM5A 4DTSA 2JHDA 3C94A 4DG1A 3HK2A 5I3UA 1S1WA 1SV0C 9ICUA 1A0PA 2CPRA 5DQHA 3T1YK 4USAA 3RJIA 4CHZA 3AQFA 3MX5A 1Q86O 1B9FA 4RUCA 1QSLA 4QS7A 1JROA 5AQVA 3SQ4A 1JALA 4Z4CA 5AKXA 5CJ7A 3K5LA 1TKXA 3QEWA 2BCVA 2Z7JA 5J2DA 2QWMA 4E1NA 1K9MO 4R79A 1C0MA 2XCAA 2XI9A 4I2FA 3ONNA 5HHHA 5L1IA 4OKEA 4DV6K 3VERA 3LL3A 2Y9TA 3RB0A 5KQDA 3E9LA 2O8EA 5KT2A 4G9ZA 1BG3A 1HJPA 4FM2A 1VSLA 1BVSA 4IR9A 2ETJA 2HHSA 2RHKA 1KTQA 2IHMA 4PQUA 4MLHA 3HPOA 1D8BA 2VWBA 4H4OA 3ZT0A 4Y2TA 3LVWA 4Z94A 1L3UA 3AL0B 1RT4A 3NGYA 4ZTJA 2IMWP 1WSIA 1N34K 1HYSA 3FLCO 3E66A 1EX4A 4FOEA 4QZHA 4EBEA 2GWKA 4KHPK 2WHEA 3CCRN 4DSKA 3RB4A 3CJ9A 3DEEA 3I0RA 2CH5A 4MLEA 4MO4A 5ELZA 1BCMA 3RB6A 4KLMA 2UVWA 2Q2RA 2B4JA 3NVVA 4FW2A 1IV0A 2B0CA 1K1QA 3AVMA 1RXVA 5AKHA 2ES6A 1YAGA 3VGLA 5ALJA 1FFVA 3MCPA 3L2WA 2QB0B 2ZUCA 5C42A 1QHAA 4JHDA 4Y1DA 3WKBA 4HUGA 3IV6A 1JLGA 1HJRA 4QWEA 4B9LA 1N6QA 4J2EA 2VG5A 2W9BA 1TFRA 2LYHA 3AVJA 3DI6A 4CZHA 2KIWA 5ALWA 2AHOB 3JPRA 2ITGA 2P9SB 4P4PA 5GTIU 4FLZA 2E6LA 1ZETA 7ICFA 1IO2A 3D2EA 3R9PA 3WXLA 1BO5O 4WQ5C 4E89A 1SXEA 2WBNA 8ICEA 5DG8A 2K8CB 1MC8A 4JUZA 3AVGA 2VG7A 3BQ7A 4KX5A 2R8JA 3EKUA 2JH7A 5F9NA 1SZPA 5JVGL 2XRIA 4K8XA 4B9VA 2P6UA 5HRRA 3ZT2A 4FFDA 2EWSA 5KFKA 2QTDA 3VGKA 4US8A 3V7JA 4P0PA 5EE1A 4QAGA 2BPCA 5D49A 4A8EA 3ENHA 2XHBA 3AU6A 3GIKA 3V6KA 7ICVA 2MAXA 1S5LU 2J6SA 1VK0A 4B1YB 2HHQA 5DBAA 4JI5K 4MDBA 1LKYB 2F77X 2E2NA 3TABA 5EU7A 5IWAK 4DV1K 1JRPA 2P9UA 1WWUA 5FDLA 5G5GA 4CHPA 1NGJA 4FJLA 7ICPA 5L9XA 3M1YA 3DV9A 4M9GA 2PYLA 4DR4K 2PZSA 2ZXHA 4A5AA 3BQ2A 4RQ3A 9ICJA 5DB7A 3QDKA 4JV2A 3WEEB 4UAYA 3LDQA 3V9UA 3QEIA 2QA4N 1N32K 4O3NA 2BDPA 3BDPA 5M1OA 5FPDA 3V7LA 1EETA 4DQPA 3CIPA 2YQEA 5BREA 3VEOA 1DK3A 2WB1C 4KH5A 4IEIA 3MR2A 2KKPA 2H3IA 1SB3C 3O3GA 1AQ6A 1HQEA 3DRRA 3C1ZA 1D8LA 5KFDA 4OPHA 4CBUA 4I6MA 1OUQA 2DBYA 1K73O 4MEYA 2CGLA 3WT0A 3K5NA 1S9EA 2RQ5A 4FLTA 3IG8A 2A1SA 3O3FA 4BG9A 1QSSA 2B21A 4BXOB 5C10A 3H45C 3BEXA 2H3VA 3O4WA 3I56N 3QEAZ 4C8MA 5KG1A 4FS2A 3L0QA 3HW8A 3QINA 4GFJA 4X66K 3LK9A 1OH5A 4ZTFA 3PSPA 1ZQRA 2RPIA 1RBRA 2JR5A 5AZJA 5BR9A 4B1XB 2VCPA 1D5AA 1FJGK 4NM2A 4LZGA 3SMPA 4O0JA 3WKDA 5GINA 5B66U 5AZIA 4O5FA 2H3QA 1PVPA 4YY3K 4BRIA 1V97A 4F4YA 1Z00A 5AICA 4KB0A 2ZXIA 3VEXA 4C8KA 3F2DA 2NYVA 1RT2A 1Z3EB 3M8PA 1J2MA 3M8QA 2FI1A 4KHNA 4UARA 3TAQA 4XH1A 4CEAA 5AM2A 3BY5A 4JI8K 3C0BA 1EWQA 3QIPA 4EFHA 4DFPA 2QWOA 1NMDA 3FR0A 3ZCMA 1OH7A 5KG0A 1Q8IA 2CGKA 3MAQA 4Y2QA 2KIVA 2CRXA 3LWMA 1KQSM 1KQQA 3CFOA 4BC3A 5J0SA 4PHPA 5BOLA 4GNIA 5DM6L 1NK4A 4WJ3B 3SUQA 2PKEA 3SQIA 1QHTA 4KLLA 4NYNA 1TL3A 4Q8EA 5HR7A 5AKZA 4AP9A 4DCCA 4QWDA 2QWPA 3JPSA 3ALYA 1QQOA 4C4RA 4YXMA 3O4NA 4BG8A 4LFAK 2HMXA 2O8CA 5AKIA 4R65A 3PV8A 3AO4A 4AM6A 1QVGM 3SUOA 3I33A 4IZ9A 4KLSA 3CJCA 4QZAA 3IRUA 1XSLA 4M3UA 1BWFO 2E8PA 4E7IA 2DFEA 3VTHA 2FXUA 3THXB 4PZNA 3NRZA 2L5YA 3SUPA 2F8KA 3NH0A 2WB1F 3MDCA 4Z4FA 4FJ7A 2YHAA 3VEVA 3C5FA 2V9WA 3W3DA 3K9JA 1KDHA 9ICPA 4ICAA 1NK7A 1DTTA 1KRPA 3CCVN 2AP1A 3AVKA 4QZBA 2EANA 2ZIXA 3EWAA 5AQLA 3OW2M 4Q45A 4OPJA 4I2CA 1K6YA 3NGIA 1VJ5A 4DO9A 2VWKA 4MO5A 3Q7BA 4R8UA 4M47A 3FZMA 3GDQA 3BZCA 4F8RA 3HXMA 3TACB 2X78A 2Z1HA 1WBBA 3VMFB 2VGMA 1XNRK 3KLGA 1X6JA 2ATLA 4M9LA 2ZJRL 2G5IB 1XMQK 3Q8QB 1EXQA 5KFYA 3A5LC 3TFRA 4O3OA 3KWGA 4C80A 5EWFA 4R66A 1ZBUA 3TAMA 2E8OA 2R18A 8ICJA 1FK9A 3EE9A 4DWIA 3NASA 3KFUF 3H8SA 1NBWA 4QJFB 4K41A 3QBXA 4OGCA 3JPPA 2XIDA 4DOBA 1VSDA 2OYQA 1WSHA 4W5QA 9ICAA 2EH9A 7ICIA 3ATVA 4O55A 4BRLA 5AHXA 4E7HA 3MC1A 8ICAA 2I7NA 2ATQA 1WUAA 1RYSA 4ILHA 1BUPA 5KFLA 1EP4A 1BOTO 3O6WA 4ECVA 2ZJ8A 1B4FA 2E2PA 3PIOL 2W6KA 4LJXA 3OVNA 4PL7A 3C1YA 1N36K 3V1RA 1CLQA 2QLTA 1HEKA 5F1XA 4DV2K 3V9WA 3OTOK 1L3TA 3TSUA 4ELUA 1LAVA 1VQNN 3HILA 2FBYA 2Q0RA 5KL1B 1REVA 3G6EN 4YFKA 1IKXA 1C0GA 1UT8A 3T1HK 4P4OA 4NWIA 5KFBA 3H08A 4YR3A 4ED8A 2JGAA 2FBVA 1L7PA 1W0HA 3ZD8A 2W9MA 2F7TA 2P9PA 4HTUA 5JTIA 3OYEA 3KKSA 4TURA 3PSIA 3MEGA 3R1XA 4TSXA 1BI4A 3GDXA 4QZ8A 5LJVA 3MR5A 3VQQA 1X3NA 1SS6A 3KHYA 3BUZB 2HW3A 4DQRA 3LANA 5D3GA 1N60A 2IVPA 3FGUA 2PBDA 4CGGA 4I9QA 3MFIA 4B8CA 5ALEA 4RQ2A 1KN5A 1KW4A 3KVGA 4FJXA 3A5MC 1S3XA 3CCQN 5KG6A 1RBVA 2HSTA 3QUCA 3DYAA 2BPGA 5ADXH 3ZDCA 3NF9A 1SZ2A 2HBJA 3AARA 1V9PA 4DEZA 3TANA 4B9NA 4CHOA 3JSMA 4OLAA 1W9HA 5HOOA 3C95A 3I76A 1VAZA 1IXRA 3RRHA 4FJKA 3AQEA 2XY8A 1S10A 3A5NC 4BC4A 3CP8A 4PH5A 1HYZA 3GFKB 4J9SA 4ECYA 4Z4GA 2G08A 2F44A 3SBTA 4DR5K 4LFBK 3SQ0A 4PL8A 1BU6O 4UATA 1RQLA 1U48A 2RF2A 2FSKA 1R0AA 3PX0A 1QZ6A 2GEMA 1X66A 2KJ8A 3M6KA 2AQ4A 1NJYA 4I2HA 1T7PA 4LC9B 4P0QA 3HBTA 4DSEA 1VDVA 4O8KA 4EHUA 3KKAA 4WFNL 5FPNA 5IIKA 3H4BA 1J9AA 5GAHP 3LPTA 3DLRA 4NCBA 2Q36A 3TADC 1O1WA 3QFPA 3JAMO 2QB1A 5FPEA 1P7DA 4IOXA 4LF9K 4H0YB 2ALZA 2HVHA 5KQ8A 2F1HA 4UAUA 4F4WA 2HHWA 3A2FA 1ZD4A 3DOLA 1DGSA 3T5JA 4FWMA 4JD2A 2D0OA 1OH6A 5EOYA 5ALVA 4W5OA 3UKRB 4M3YA 1VLBA 4O3MA 1LAWA 1URJA 4Q44A 3ZDEA 5JRTA 3HX0A 1EQYA 3ID8A 3PW7A 4MQ3A 3HSTB 3VQDA 3HOSA 3HOTA 3QESA 3K58A 2WTFA 4FJNA 1JCEA 4M7YA 1TK0A 3VQBA 4FWSA 3ULEA 1ZQHA 3NVZA 4R63A 5J8YA 1Q81O 4RPXA 5MLCQ 2FC0A 3LVVA 5AM3A 5ALXA 1VSKA 1DTQA 5C0YA 5CB1A 3OYAA 3G10A 2HDOA 1HUZA 2FLNA 4NLNA 2BDUA 3GZFA 1WUDA 4DS4A 1PVQA 3H3OB 4WQ5A 5E26A 4BRGA 4YVZA 5KFZA 4BDYA 4X5VA 3HL8A 2ISPA 3AA5X 3I55N 3LP0A 1ZRMA 4U6PA 3KK3A 1QLNA 3MN5A 3RSEB 1VQLN 1NI3A 1EKEA 3RJKA 4DL6A 3BQTA 3QU4A 2V7YA 3AGRA 5CR4A 2FLOA 4JEPA 4CJ7A 1QH9A 2Z1GA 3EUB2 4RW4A 4M9HA 4BRNA 2QWRA 1X2IA 1XO1A 1PVRA 3F53A 3HWTA 2GV9A 3J7ZO 3TARA 3VEZA 8ICBA 3U4LA 2K4EA 4MEXA 1S1TA 4CZIA 5DGBA 1ZQKA 3RBEA 3PO5A 3OA9A 1VRTA 3CCJN 5DQGA 2E20A 4FM1A 4FWKA 1X9SA 4FBTA 3UMCA 4BRDA 2DF4B 4CEQA 5CE3A 2PMZC 2OTLN 1E4GT 3T5LA 3T79A 2ZUDA 2E88A 2J6UA 3SJJA 3M1FA 2QM1A 5I9EB 4ACOA 2O4IA 1N62A 4PL2A 4KLUA 1L3SA 3KWIA 4KH4A 4EX7A 1TK8A 2P9LB 3LYSA 4O44A 1B0XA 4QZFA 3CMAN 2ZIWB 1WG8A 5CEHA 4P4MA 2BE2A 3UB5A 4DTOA 1XQSC 1CXUA 1I3AA 8ICCA 4FO0A 5T14A 3E0FA 1YZ7A 3NF6A 4CJRA 4LF6K 3CMEN 1PZNA 4O0IA 1Z05A 3J81O 2XGQA 4OGEA 2JEFA 1OVYA 1X1PA 2OANA 3TWHA 4CJKA 4IO9L 4FJIA 3KTQA 4YOYA 4KN4A 2YB1A 1GLEG 1LW2A 4H0OA 4YQWA 3ULDA 4M3TA 2E3TA 2Q0ZX 2HHVA 2QWNA 3AVFA 2OCEA 1RQNA 4JKFA 2A42A 4KKOA 4FK2A 2YNFA 4YOWA 4UBBA 3H6EA 5KPTA 5HMMA 2A1JB 1JX4A 3C2LA 3C2MA 2CH6A 4IOCL 2P5GA 8ICRA 4O3SA 2O8DA 4UBCA 4NCGA 2OH2A 3C23A 2UU9K 2ISOA 1GLFO 1NJIO 3CCUN 1SWVA 4JK1A 2K4IA 3U26A 4PGXA 4BROA 3V6DA 2XY5A 3ZT4A 4ZHRA 5M1FA 2OTJN 2PAVA 3Q8MA 3I8DA 4KH6A 4JK9A 4DF8A 4LVSA 2NO5A 2OM6A 3L3VA 2E2QA 4OVLA 3P38A 1J5OA 4CF8A 3NMUA 1SZHA 3VA3A 1ZBIA 3HVRA 2E5LK 4J8FA 4DCHA 2XICA 3W0LA 4K8ZA 3ISCA 2UXDK 2BTFA 5J2AA 1Q7YO 1Q3UA 1N33K 2Y0SC 4FWOA 5LL6Z 5DB6A 3SAGA 3QLHA 1U45A 4H03B 3WKCA 1JCGA 4K43A 4Z6FA 4EENA 5AQFA 2WTUA 2IOFK 1X40A 4QW9A 5AQTA 2PI4A 9ICTA 3QUBA 4PHAA 1C1BA 1H38A 3VETA 4KBOA 1S76D 4GKKK 2HSZA 3CI5A 4YOXA 4ECQA 4CJ3A 3C21A 4FLWA 4OJPA 3D45A 3G4SN 2E2OA 5DMRA 2BHNA 1CZAN 2VYPA 5CHGA 1DLOA 2QXFA 4BREA 4EP5A 2KOBA 4KMUA 1C7YA 2P9NA 4CF9A 1R59O 4CJFA 3NHGA 4KN7A 2J6TA 2GX9A 2IVNA 4PUOA 5AQGA 3KLEA 3QERA 5JLFA 2LKYA 4UB5A 3LDNA 5SWMA 3KD1E 1ZBSA 2O8FA 5H1SQ 1CEZA 2CXYA 4YFUA 3PR4A 2ASDA 2Y1IA 3C29A 3LDPA 5J0XA 5AQYA 2OPPA 3FFIA 5HR6A 4I2AA 4GIBA 1U2VB 3AMZA 1SUQA 4OJRA 3VESA 1QCKA 3PVXA 4MFAA 1GLLO 2KZ3A 1MA7A 2WOMA 1N5YA 3BS5A 3DRPA 2MU2A 1WYGA 3KHRA 1K8KB 3MN7A 4WQ4C 4B3MK 4KTWA 3WXJA 2W43A 5AM4A 3IFRA 4JS5A 1S8OA 3NF8A 3THWB 1TAQA 3WK4A 2VG6A 4DUYK 4H5NA 4FBUA 3ITHA 3IAYA 4F4ZA 1HJOA 3RJHA 3WXKA 1FW6A 3WK7A 4Y2SA 2FLLA 1KKXA 3CCEN 5KRSA 4G9BA 3VEWA 3V9ZA 3S9HA 4XUSA 4CHYA 5KT4A 3MEDA 4U7CA 2G8KA 3WK9A 3IN5A 3HJFA 4BE2A 2W54A 4DL5A 4FWPA 4JMUA 4I2EA 3ZSXA 1EXNA 2ESEA 2FF3B 4NLCA 5ALKA 5KTQA 3EN9A 2YNHA 2WF6A 3KK7A 5AQQA 3WQUA 2E5SA 1BPZA 3SPZA 3VQ5A 1UA1A 2A1AA 2P51A 1L8OA 1RTJA 1SIJA 2IIRA 1VQMN 4EBCA 1XNQK 2H3GX 2JLEA 3CJBA 2UUCK 4M3WA 1SV4A 1COKA 5KT3A 4FWRA 3VEYA 3NTUA 4IS7A 2O8BB 3HP6A 2DGZA 5JLHA 1U9LA 3VCBA 1NGBA 7ICNA 3TKAA 2GH1A 9ICBA 1XC3A 3F9KA 3HI0A 5IT9O 2WF9A 1SQKA 7ICRA 4RNMA 4ID1A 3R6MA 4H8KA 3FAHA 3DOKA 2BH1A 1TGOA 5C5JA 2YMQA 3RWUA 4FS1A 1L5UA 3M6ZA 4B6JA 1NGCA 1ZRNA 2Q0UA 7ICKA 2KJ5A 3F2CA 2CGJA 3PIPL 3TSPA 4PWDA 4RQ7A 2P9KA 1WLJA 1JL1A 3RJJA 4DSIA 4O3PA 4JV0A 3CYMA 5AM1A 1NK0A 1LWCA 3QZ8A 4HYKA 3QEBZ 4DLGA 3T19A 3HKZC 4M6WA 1SWWA 3TI0A 3TSQA 4FJJA 1Y88A 5L1JA 4UASA 4KITB 3PO4A 1LCUA 3P83D 4FXDA 4KLFA 2LI6A 3VF6A 4IWVA 3T7ZA 5AFUA 3F5EA 5CY4A 4M9JA 4DQ8A 1SKRA 1V4TA 4JKDA 3T1AA 4J9KA 2F8LA 2BCRA 2GBZA 4GC7A 4PGQA 2ITMA 3UXOA 4I28A 2FMQA 3C6UA 2IA6A 1YHQN 3NRWA 5M1KA 3NE6A 1KCFA 1L7NA 4DQIA 4GW6A 4JKGA 2BCUA 1O08A 1KFSA 3AEVA 1RDFA 3ZSRA 3M9NB 4DHYA 5BN9A 3JPQA 2A40A 2ZJAA 3MXIA 4KLHA 3BF1A 3QXGA 3L5KA 3RR8A 2PXIA 2P5OA 4KRFA 3HZ6A 1F5SA 1IH7A 5EY4A 3WUHA 1KSPA 1WCNA 2LM4A 1SXDA 4M04A 4JI0K 2KG5A 9ICKA 2WONA 2LYAA 3ZI4A 1N2XA 4K4GA 2W9CA 3D2QA 4HHTA 8ICVA 4EAHD 3MABA 2EAOA 3ETLA 3DJCA 4LF5K 4JKBA 2XCPA 3MEEA 4Y2JA 1S22A 4FO6A 2HOFA 1LVHA 3UMGA 4H0TB 3TADA 5KFPA 4CZGA 3DLHA 5F3XB 4BX9C 3F2KA 3THYB 1K8AO 2A1RA 3MGHA 3WK8A 5C2FA 4IRDA 2VGNA 1COOA 1UPHA 1TKDA 3AO5A 3B6PA 4DSFA 2UXCK 3AA4A 2WFBA 2A3VA 3OSNA 4FWQA 4IG0A 4DTJA 4O9MA 1P90A 4M63C 4CE9A 3UKUA 4Z0UA 4QIWC 1BPYA 1RT1A 2HBLA 3LPUA 2GWJA 1JIHA 3DXKA 1C0TA 1ZYQA 1ZXIA 4Z6CA 1ZD2P 3CJAA 2JEJA 3HPGA 2M9NA 3Q7CA 2R8HA 4ELVA 4PHTX 3RMAA 3NVWA 1ECWA 4FZMA 2P9IB 1GOBA 3CETA 4E19A 2PFUA 2G09A 2A41A 3KJVA 4GKJK 5JS2A 4A62A 5DDMA 1K1SA 2DFLA 7ICMA 4N76A 2Y9UA 4OKJA 3OS0A 1UAXA 1JI7A 2AQ0A 5CRXA 5JVHL 1X9JA 1XS9D 3HKZF 3AM9A 3SJHA 1IKYA 1LWEA 1VSMA 3SEIA 1LB2B 4MHVA 4O5BA 2ZWHA 3ZSYA 2RLTA 8ICFA 4B9QA 4YD2A 1GO3F 4Q5VA 2DKZA 1TKTA 3R3LA 5CHIA 4KI6A 4AILC 1FKOA 2AXTU 1MU2A 4ICLA 4MFBA 4EYIB 4PKIA 2ZTDA 4J9PA 2QWLA 4C23A 2LHTA 3F73A 2VJ5A 3GQCA 3A0IX 4FE3A 5AQNA 2IAJA 5DDYA 4PGYA 3MGVA 1X42A 3QO9A 4CF0A 1K5OA 4NL9A 5ALFA 5KG2A 5KG5A 3U3YA 2JWLA 4BC5A 1OVQA 3RJGA 3HO1A 2KSOA 2KHQA 5BN8A 4FJ9A 5EVZA 3CJ1A 3ISNC 1WWVA 2V4QA 1J54A 4JN4A 4A59A 1YITN 3EE8A 3SLCA 1TUUA 3QB0A 1YI2N 4IQTA 1JKHA 1KAXA 4CNQA 2ZJPL 3AVLA 1HNWK 1QVFM 2IOHA 1XC9A 1ZQIA 5AK4A 3U6FA 5E79U 1YIJN 2EQYA 3GILA 4CZEA 5KI6A 3F9MA 3KLHA 2ZIUA 4BQLA 1DKGD 9ICRA 1RILA 4DR7K 2KEYA 4FJHA 4X62K 4YNQA 1YJ9N 5HHIA 4ED1A 4CHNA 2LSNA 1ZQUA 2YNIA 3WXIA 3AAPA 8ICMA 3AO1A 4C1NK 2YHWA 1ZQGA 4IC9A 4XQ8A 1IG9A 5KFVA 2I5JA 1Y64A 5D46A 4RG8A 3VENA 4EZ9A 1XHZA 3AO3A 1ZQLA 1RBTA 3CF5L 5E84A 2ZTCA 1T44A 4QIWF 3GV5B 3IDHA 5ALSA 3CFRA 1TL1A 2HNYA 3RJFA 4QNLA 8ICOA 1GLCG 3T69A 3TAGA 3PY8A 4BRQA 5EWEA 4Y1CA 4CK1A 2GLEA 1U2VA 4BE0A 2KN7A 2ZIVB 3BS7A 5KPRA 5J2BA 4CRXA 4FWNA 3CPEA 3ZX2A 4KX3A 4RU9A 1TYQB 5KFAA 2BKEA 2B5JA 5HNKA 2C28A 1S77D 5AKGA 3M7DA 5DBBA 1ZJMA 3RRGA 1VSFA 2F96A 1IIPA 4NJ8A 4K42A 4FK4A 1S9GA 2FPLA 1JL2A 4C0ZA 7ICLA 1XMOK 3HPHA 2B6GA 1CXQA 3KZBA 1FFUA 2H3ZA 3PNCA 4ED7A 4NM1A 2HHUA 4EEYA 4QZDA 3E1YA 4I2QA 1T3QA 3RVCA 1RT7A 2NV3A 2NRTA 4CFCA 3MXMA 1ASWA 1Q3VA 3U8XA 5KT5A 3D2FA 2WFAA 1SKSA 3CERA 4GY2B 4UB8U 4YOTA 4CBXA 5KT7A 3WK5A 1KD1O 2ZG6A 4GV6A 5CR0A 3KD5E 4B1VA 3LAMA 1PK1B 2GELA 3NF7A 2UYTA 4RQ6A 4UB4A 1KAZA 3N4QA 4NYFA 4IJAA 5AQIA 4A2BA 1SL0A 2G8HA 4LZDA 1A5VA 4KLEA 3OYCA 1BPEA 3MXJA 1JLCA 2H3FA 1XSNA 2D0CA 5J2FA 3MDAA 5JMVA 3BGRA 2YN4A 4DB3A 5AQKA 2G8UA 1B9DA 5AK5A 4MF8A 4FSVA 4QS9A 3M8RA 1RYUA 3CPWM 3LWLA 4KHWA 2BANA 1FEZA 4CIFA 1N5XA 1YTUA 4YORA 4H0PA 5GADP 2G8WA 2YTUA 3V7KA 4CDGA 1ESVA 4H5RA 5H2FU 4QWAA 1QZ5A 1VSJA 4CEOA 4CJWA 5J0QA 2EAPA 3S3NA 4N41A 4RTFD 1IKVA 2JGUA 4RPZA 5J2NA 1JN3A 2C2DA 5KFEA 2NRRA 5JUMA 4JKAA 4W5RA 3QEPA 2E1FA 2IBKA 1T94A 3B9JA 5AQOA 4M7XA 1VQ8N 1DXSA 5DB8A 2K89A 2B6AA 4DU4A 4JYAK 2PYJA 4ID5A 3HM8A 5LMNK 1OH8A 3ZDBA 1ZQAA 2GOLA 3CQYA 2YMPA 3UXPA 4RT2A 4TQRA 4TQSA 1KLNA 4GMJB 3GE1A 4CFDA 4DFJA 3RMBA 4XA5A 4KB1A 5AI4A 1VQON 3OTQA 4NV0A 2YMLA 4C8LA 2X6NA 5KG3A 5CWRA 2XVTA 4OJ6A 4CEFA 2KE7A 1BPDA 5KFQA 3Q8PB 5FP0A 4BR7A 1J2NA 2UVVA 1QQMA 3MDQA 1NOMA 4ILGB 3KK1A 2HF4A 4BR2A 1ATNA 5IIMA 1MWMA 1ZBHA 1ZQZA 9ICSA 7ICQA 5ALLA 1BISA 4NXMK 2QB0A 1MDUB 2KW4A 7ICEA 2F9WA 3O1WA 1A76A 1DOQA 1SAZA 3G6XA 1KXPA 4BDZA 3H46O 2EDUA 1U49A 2Q97A 1W2BM 3SD7A 4O5EA 1UOCA 2P9SA 3H1QA 3ZEUB 5DB9A 1QQ7A 3M3ZA 3B0XA 5M1QA 3AU2A 3S3MA 1SV0A 2W8KA 3PLAA 1BPBA 1CUKA 4X65K 4O8UA 4F3OA 1Z6RA 5ALGA 3JS6A 5J2QA 3ZSQA 3OBYA 1IM4A 8ICZA 2E1EA 4WYBA 3K59A 4HTLA 1JMSA 1NGGA 2DY4A 1RT5A 2PFQA 1YVUA 1RGIA 5KFRA 1ITGA 3D6JA 3VQ4A 3QU7A 3V81A 3OYFA 5AKEA 3QU5A 2P6RA 4DSLA 1VQ4N 2QKBA 5IIJA 1IV8A 4EX6A 4OO1J 3J8AA 2JZBB 2DPJA 5GIOA 2YHXA 2F8SA 1WSEA 4KTZA 3MMVA 4B1UB 3A0BU 3B6OA 1LKYA 2HVIA 4F5PA 1NWKA 4UW9A 3LDOA 3OYJA 2ZM6K 3F5AA 4OJLA 3I28A 4WF9L 1RCHA 3Q8RB 1Z1VA 4DTMA 3ENOA 4RQ0A 3MBYA 1UA0A 5TKWA 2YI1A 1CRXA 5F9LA 4J2BA 1ZQFA 2FMSA 3WEEA 4AHCA 1CZ9A 1ZBLA 4CZKA 3QMLA 3EL2A 4ISGA 3KK2A 4LD0A 5C12A 2Q31A 3J7YP 2MSNA 2OZSA 2F76X 3ALRA 1KVBA 2QW9A 4KREA 5ALIA 4Y2VA 2NLXA 3LP3A 3U3GA 5CZ2A 4Z4EA 5AQHA 4NXNK 4QWBA 3NFAA 4N56A 2KMDA 2F8TA 3QNMA 1MQ3A 2QWQA 3PR5B 3OPXA 1RZTA 2FPMA 2BR0A 2V51B 4QOZB 1VQPN 5AR0A 3BJYA 3K75D 4RW6A 4J9LA 5ALZA 2HB5A 1D8YA 4M41A 2MUTB 2R8KA 1B92A 2NNWA 2HOIA 5HL7L 2G8IA 2W8LA 3N28A 4BXOA 1FKPA 4H5VA 3OYIA 1P8ZA 4B3TK 1S72N 2OEHA 3FYHA 4ISFA 1ZQ1C 4XEIA 2KD1A 1ZQBA 3GIIA 2O8EB 3D7EO 5ALNA 1GLBG 2OWOA 5C15A 5DG7A 3DDHA 4CJEA 3SAFA 3IKMA 4J2AA 5L1KA 1A6SA 3CXCM 1RDBA 3LM9A 3VOVA 4DFDA 4OCZA 1VSHA 1XUPO 3OS2A 4RQNA 3RB3A 5K14A 2GWSA 1N61A 1BL3A 2BGWA 1C20A 4IJNA 4IQUA 4BRCA 4BRKA 5HLFA 4WCEL 3KHGA 3RTVA 4ECXA 2YV0X 3NVMA 4AYBC 4LSLA 4DF4A 4GVMA 3O1BA 2I5HA 4UAVA 1Z4OA 1KFDA 3N7SC 5J1EA 3IDWA 4B3RK 2BQRA 3K9KA 4UB6U 3K57A 3CQXA 4K0KK 4YHHK 2D6FC 2V7ZA 1Z19A 2BPFA 2NRVA 3EW9A 4YR0A 5J2HA 2C2EA 1A5XA 5DK5A 2G8VA 4DSJA 4DTNA 4AHRA 3THVA 3T5KA 2VA3A 8ICPA 4B9SA 4CGZA 1S0OA 2FPKA 2JV3A 5FROA 3PSTA 4HCBA 4FVUA 2LMRA 2J4RA 2W9BB 4JB3A 1GOCA 3AVHA 2YKNA 3O8MA 3OYKA 3AY9A 3PMLA 2NUBA 3PW2A 4CGJA 4J9MA 2RHFA 2VKQA 4KLTA 4MDAA 4CEBA 2D0PA 3ZX3A 1L7MA 4O4GA 4WFAL 3D2EB 1BPXA 3V72A 4F4KA 3O5BA 1N8RO 4GXKA 4CF2A 2VWJA 1ZQMA 3THXA 4CEDA 3ZX0A 2K4PA 2KNJA 4K4HA 2YJFA 1X3MA 3UE5A 4Y0WA 2BZFA 4I2IA 5ALRA 4C1NI 1PUZA 4KV8A 4GXIA 1S1XA 3MN6A 2IS3A 1WSJA 1HLUA 2LPEA 3SENA 2JMGA 5AIBA 5HBMA 2OXOA 3O08A 3VQPA 4P0PB 1IKWA 4M45A 2LBOA 4ILJA 4BRAA 4R5PA 3FC4A 1UQVA 3KZXA 3PMNA 1YUWA 4G1QA 4N47A 4ED6A 3AV9A 2VA2A 4ECZA 3AVCA 2E8AA 4PHEA 5AKKA 1TVAA 4E0DA 4I9LA 4IL6U 2JXJA 4NO7A 3GIMA 4C8OA 1HKBA 4BGBA 4JWNA 2XC9A 2P9UB 3G6YA 2YJEA 1TE2A 1KLMA 2F1IA 4JRPA 1JJ2M 2KHVA 1XNSA 5KFWA 4FZZA 3D6RA 4AHSA 5J2MA 3R9KA 3C7NB 2BQ3A 2GO7A 1DRGA 3K2PA 1Z4NA 1HNIA 1V4SA 5EE0A 1JXEA 4UB3A 5T7BA 1NOYA 3DLBA 3FE1A 3EYZA 3CG7A 2W04A 4PPXA 3TR8A 4JS4A 4KLOA 5DBCA 5J2EA 1ZD3A 5ALQA 5CA7A 4AHTA 4CGFA 3FZKA 3PUFA 5CYQA 3TAEA 1LV5A 1WB9A 9ICQA 3A8YA 1HQUA 2M0NA 4AYBF 1RDWX 3LDAA 5EXWA 1HR0K 3HSCA 2MRLA 1NG9A 3E2EA 4OPKA 3IS9A 4QZIA 1ZQXA 5EOZA 2BQUA 2KFZA 9ICLA 4CERA 2PMZF 4FL9A 1Q8KA 5J0WA 1UCVA 3V1OA 8ICWA 1J5EK 4IRKA 4MFCA 3AVNA 4BRPA 4LSNA 5BPCA 4C4TA 1NK9A 4H0VB 3C65A 3HP9A 4F3TA 2OA8A 3RH4A 4FYDA 4YD1A 2V4RA 3CQ8A 3QEXA 3PW4A 5K4LA 4CD1A 2ODGA 1BA1A 3V1QA 1HPMA 1BA0A 3K1RB 2W55A 3AO2A 2YNGA 1NNLA 1ASVA 1G99A 3C6HA 1ED1A 1Y97A 3OGUA 4RW8A 3K1ZA 3JYTA 4ED2A 3QBWA 5AI9A 4QZCA 2I1QA 1BNPA 4DL4A 1LOTB 3UIQA 1VQ6N 1XHXA 3KHHA 5AZIB 2PFPA 3DM2A 4CJPA 4I29A 4DV4K 4IO8A 2FBTA 2YKMA 1Z00B 3RBDA 1J53A 3S41A 2LYBA 3QX7A 3OHBA 5BPLA 3TU5A 3H7IA 1L7OA 2EAMA 2NRXA 4PJ0U 1NLVA 2HNDA 4BGAA 1KFTA 3SV4A 4C7YA 3SCXA 5F2RA 3IG1A 3ORYA 1HUOA 4A61A 4BR9A 2IDOA 4GV3A 4FZXC 4F5QA 4CZMA 3ZDDA 4TUQA 2KKZA 4KHYA 1S1VA 2NRZA 4P2HA 4CJSA 2D3DA 4JI3K 1F44A 1MA9B 3OHRA 5F0XA 1HUXA 3FDSA 2W6LA 4Y2UA 4YN4A 4F2SA 1I94K 1A5WA 3LP1A 1D4XA 4E7KA 5DGAA 2NZTA 3WNFA 2W3SA 3FZLA 1T4GA 4F50A 4JNEA 2G8FA 2H5XA 1ATRA 3VQ7A 4Y2YA 5J2KA 4DTRA 3ZT1A 4FCYA 4GV9A 5B5EU 1CI4A 2JZBA 3D2NA 1J97A 3IP4B 4HAIA 4RQ8A 4FOIA 5AQXA 2F3NA 3ISDA 3OYLA 4FPAA 2O8CB 4Z6EA 2PFNA 4F5OA 4L8RB 2MA1A 3KBBA 2YCHA 2Y0SF 5ALYA 1M6YA 3NVYA 1ZJNA 4WE1A 2UUAK 2FF6A 3S6JA 2RDIA 1M90O 1XO0A 3DWLA 2KZZA 2IC3A 3E58A 2I6XA 3TFSA 3WKAA 4DV5K 3TAFA 3QICA 3AA2A 4F93B 1S0MA 3HRGA 4JI6K 3WKEA 1ZQTA 4NB4A 3DRSA 4UAZA 2ZJQL 4KHUA 4JV5K 3O9TA 3IHQB 4QZEA 5L1MA 2ASOA 3F5TA 3M5RA 3AA3A 2ASLA 2JEGA 2ZIXB 3UKRA 3ZETB 1MQ2A 1UT5A 2FSNA 4HUFA 4I2GA 4R8UB 3TAPA 3ZDAA 3SMVA 2VANA 5J2CA 4YMOA 3VC8A 1C1AA 1ZQNA 7ICSA 4NLZA 4G3IA 1C6VA 3DXMB 3O80A 2MUTA 3O0FA 4CF1A 2AA4A 3K0SA 3UMBA 4BRHA 2XY7A 3FZFA 4RQ4A 4EEKA 4CW7B 3KLFA 4IQVA 3LAKA 3CD6N 5L1LA 1UWBA 4JI7K 2KV2A 2AJQA 7ICJA 2ZGZA 2DWQA 3TTCA 3U9DA 4ECSA 1NGDA 3OS1A 4Z4IA 4TUSA 3RSEA 1RTIA 3I1YA 1X9WA 4Y2RA 1RBUA 1HIWA 2O4GA 3BP8A 3HTVA 2UUBK 2W40A 3RAXA 1MWKA 3M9OB 3DLKA 2DFFA 4JKHA 1W7AA 5AFUH 3KKAC 3KOOA 4YXJA 1TVRA 4J9RA 3TQ1A 3WQTA 3HJEA 4CGIA 4CK2A 2BCQA 4CJVA 4FZLA 1NZBA 4BJQA 4YG2A 4FZNA 1GLJO 4NLBA 2KZMA 3E01A 4CEZA 2YB4A 2Q1NA 4LF4K 5KG4A 5A2QO 4YMMA 2P9PB 1F21A 3T5HA 1LWFA 5D4BA 1RT3A 1SKWA 3FZHA 3ZSOA 2KVSA 1BI4B 3HT3A 1S0NA 2RKIA 2C22A 4OKKA 1S6PA 4KLQA 3CC7N 2WF5A 3P1GA 2W42A 1RG6A 2OHFA 2P9LA 2D0AA 2XO7A 3RMDA 4LF7K 3C6AA 4J9OA 2ZIWA 2HCFA 5AQMA 2UVRA 2Z1IA 4F92B 5J2IA 2AGOA 4IOAL 4X64K 5KFSA 1ATSA 2RN2A 4RQ5A 4CJ4A 4DKWA 5J8YC 2DPIA 4ECTA 1QTMA 1J6ZA 5J0PA 3G25A 1QS4A 3ISBA 4AM7A 3J80O 4NLGA 2JEIA 4BRFA 8ICUA 3EZWA 4DR6K 5KGXA 4NY8A 5HP1A 4HCCA 5J0UA 1MN8A 3H0LB 4BVOA 1AROP 1W97L 1EO1A 2A1JA 4YR2A 4PA1A 4YDUC 4M3XA 1RPLA 3VQ9A 1U4BA 4DL3A 4Q0BA 3KKRA 4CVNE 5KRTA 2E8NA 5KFXA 8ICSA 7ICOA 4BWMA 1JLAA 4CJLA 4DV3K 5TISU 2VQFK 3QZ7A 1RTHA 3BQ1A 1C0UA 3ED5A 4PKGA 3C5GA 3P4IA 4A2AA 3WNEA 3EZ5A 2WF7A 1WN7A 3DLLL 4DTXA 4CJ5A 2BCSA 4E7LA 3ZD9A 3SNNA 2P66A 4P0QB 3SI8A 2X6SA 2OPRA 2DL0A 4EHTA 4IFYA 1YVNA 5AI0A 4DOCA 3JPTA 3L3UA 2ZF5O 5AQWA 5ALMA 2DUYA 3BZKA 3D2SA 1NJZA 4ELTA 2RE2A 1TK5A 4B08A 4BR0A 2ZQBA 3LP2A 3CC2N 2DQNB 1T8EA 5DLFA 1T3VA 3C7NA 4BWJA 5KFMA 1BIZA 3L2VA 5ALTA 1KVAA 1RDAA 4C4SA 4BACA 4C8NA 3LDLA 3O3HA 4IKFA 4RW9A 4BDPA 1V38A 2R8GA 3H0RB 5AQRA 3QFUA 3H0MB 2FDRA 5BOMA 2ZJ5A 4KLDA 1NM1A 1ZQPA 3O9QA 4JD2B 3MR3A 3H40A 4I27A 2NO4A 4DL7A 3ENBA 1VQKN 5AKJA 1QQCA 1IG8A 4YP3A 2W7PA 3OYMA 4NLKA 4RUAA 3MCAB 1DK2A 3NH2A 3AVIA 3UQ0A 1WBDA 2KP7A 3P39A 3ULEB 2DTUA 4KI4A 4BQZA 4CZJA 1TAUA 4IR1A 5DM7L 4GC6A 1VQ7N 2A5XA 3GOIA 2XGPA 2GTDA 4UQGA 2R7YA 3PX4A 5AQPA 4DFKA 2WF8A 1NU0A 4L3QA 5KFTA 3QEVA 4B3SK 4ED3A 4XH5A 1SL1A 3PW0A 1QSYA 1VSEA 1S6QA 2HOQA 3RH5A 3T3FA 5BRFA 1RT6A 2GUPA 1S1UA 3L2UA 4JK8A 4YOUA 5DKWA 1NKCA 5AKYA 1NJWA 4IQWA 4F9OA 4RCHA 3FFKB 9ICWA 4H4MA 3V6JA 1TV6A 3RJEA 1O03A 4FPBA 1HPZA 9ICEA 4FZYA 5KFHA 9ICHA 4BC2A 5J2PA 3L6QA 3HYFA 1ZQYA 1K8KA 5KFGA 2WC9A 3G71N 3RH6A 2F9TA 5GAGP 3VQCA 3THWA 3PZPA 2DFHA 3IRXA 2ASJA 3ZSWA 1XWLA 4E1JA 9ICIA 1DGKN 5FRNA 4W5TA 3CM6A 3L8BA 2EX3A 2F4VK 1BIUA 1Q9XA 3KIOA 5AI6A 1U47A 4I2DA 3N97B 3CFPA 2D5RA 3KHLA 1HNZK 5C2DA 2FLPA 1VSIA 5KAIU 4HWIA 3U9ZA 8ICNA 3QUTA 4UB1A 4PKHA 3IM1A 2QARB 1JXLA 2D1KA 8ICKA 3D0PA 2PFOA 3UM9A 8ICTA 1RBSA 2K8BB 4RPYA 4F2RA 4CBWA 2EZXA 4CGHA 4PZOA 4J9NA 4FLVA 1V85A 1NGEA 1S0VA 4B8AB 3L4QA 3SUNA 1HNXK 3IUCA 3B0YA 8ICYA 3TPQA 5KFCA 4DS5A 1NK5A 4RWTA 1DT9A 4H5WA 5C24A 2VA8A 3WK6A 5TZVA 2QEXN 2O8BA 3WXMB 2VIXA 4RNOA 3P31A 4CJTA 5IIIA 4CJUA 4Z4HA 2KK0A 3SR6A 1XU4A 3SPYA 4OX9K 5IIOA 4US9A 2OYYA 1RDCA 4JWMA 5AIAA 3CCLN 4FJGA 2D4WA 4Q43A 9ICGA 5KPZA 4DR1K 5EWGA 2O8DB 4MFFA 3DLGA 3HVTA 3VF4A 3LALA 1YF5L 3SQ2A 3NBPA 2E6MA 4PY5A 4RZRA 4F72A 4AF1A 5KG7A 3EPIA 3M6GA 5DG9A 3VQAA 3ZETA 2W9AA 2HBKA 2RP5A 2YMMA 2G0AA 5SZTA 5FRMA 2IHNA 2HF3A 4RW7A 1F0MA 8ICIA 3ZSVA 5B8HA 1FO4A 4E1MA 1Z1BA 3GIJA 1NMNA 1WSFA 3EY1A 3UPQA 1IBKK 4Y2PA 5AQJA 2GUIA 3CCMN 3DXMA 3H8WA 4WQ4A 1L3VA 4BRMA 2FSJA 1QQ5A 3ZSZA 3UXNA 3MR6A 5KL8B 4B1WB 1X9MA 4OPAA 5KFFA 1VRUA 3CHWA 3CM5A 2CN1A 2RRDA 3MK6A 3RAQA 1GLAG 4DFMA 2I7PA 2A19A 4JAXA 4M3ZA 1Q18A 1SGGA 2Z1JA 8ICXA 4JI2K 2XY6A 1TKZA 3CJ7A 4FM0A 3WNHA 1KC8O 2JWKA 1Z25A 3NVKA 1QE1A 2HI0A 1RFQA 4ZH4A 2W03A 2FBXA 4JKEA 3PW5A 1ZQOA 1G15A 3OY9A 3B8AX 3F2BA 1BQNA 5AQSA 5CP2A 3JPNA 2O6KA 4BUGA 4DTUA 2WAQC 1LW0A 4Z6DA 4IXCA 1L6NA 4I2PA 4K25A 5LJWA 3OYNA 3R8EA 4E7JA 4QWCA 2KLAA 9ICOA 2KICA 1L8LA 4B9MA 1T03A 3OYGA 5CYMA 3OYHA 3RF9A 1HKGA 4DU3A 5GIPA 2P9NB 3RMCA 1MSWD 4DU1A 3NCIA 1BNOA 1KVCA 3AVBA 7ICUA 2ASMA 4CCHA 5J29A 4AHUA 4BE1A 2P35A 3TTFA 5ADXA 1UHUA 4I7FA 2YHYA 4DL2A 2EZYA 4FJ8A 4B9UA 1GOAA 2O8FB 5IILA 2ZTEA 3THYA 2E1ZA 1KAYA 4KLGA 3QNOA 2W11A 2Q4TA 3L2RA 3J81j 4IFVA 1QQNA 4EP4A 2HOEA 5KGWA 3A5OC 3L3FX 4QZGA 1SL2A 4CD3A 1ZBFA 4CE6A 1WNSA 3IG5A 3L4IA 4F5NA 3ZLJA 1E4FT 4B1ZA 5AJ3K 4AH9A 3KLIA 3MWPA 3SBGA 3SYZA 3BS5B 4DLEA 3OJUA 1BCOA 1U04A 4IG3A 1OW5A 1DEJA 4ISEA 4KPYA 3C6TA 4QZ9A 2QKKA 3N7PD 4XRHA 1E3MA 1KEJA 5A0LA 1ZOLA 3WU2U 1JLFA 9ICVA 1WAJA 2E1YA 2IOCA 5AK3A 4CZLA 4RNNA 4JI1K 2P9IA 4KAZA 3CW2C 2EZZA 2QKQA 1QQ6A 1RYRA 4Q8FA 3RR7A 2ZGYA 4JLHA 2VJ4A 4LH5A 1CZBA 3TTDA 1NJXA 2UVUA 1ASUA 5J0TA 2G07A 2QXLA 3NGDA 2AGPA 3VTIA 3BF3A 5HRPA 3O9UA 5E41A 4CIGA 4FJ5A 3VPZA 1Q46A 5ALPA 2ZE2A 3NDKA 4W5NA 2ZD1A 5KNIA 2Q3SA 3GV8B 2NRWA 3OJSA 4CF5A 4KFBA 2AH5A 2ZUBA 1SV5A 3LDSA 2FJ6A 3GV7B 2OPQA 3K4GA 4IDHA 3MFHA 4CF3A 2IVOA 2HHTA 4PHDA 5ALHA 3N7RC 3AUOA 4OLBA 3ID6A 4GLXA 2F2AB 2KKVA 2R8IA 1JCFA 3L4PA 1ILYA 4DR3K 3N4MB 4UAWA 2P1JA 2HHXA 2JH1A 3OBWA 5DLGA 4BR4A 4ED0A 3JPOA 3ETRA 4XIUA 4J2DA 4CESA 3ATUA 3SI6A 2E8MA 3O4QA 5TKYA 2KQ2A 1HYVA 1VQ9N 2WAQF 3BQ0A 3CRXA 4JI4K 1T05A 4J9QA 1RTDA 3QIOA 1YTAA 5KAFU 1BDGA 1RDUA 2P9KB 3SMSA 3A0HU 3WNGA 4A57A 4UY8O 1T6CA 3PX6A 1XSPA 3ZT3A 4CJQA 1TV9A 1IJJA 4EBDA 1ZQJA 1C1CA 3SK3A 4M6WB 2W41A 3OYDA 3QNNA 1JLBA 1NKBA 3VQEA 3SAHA 4HUEA 5AQZA 4LFCK 2IGIA 4BVPA 4QCLA 1WAFA 2PI5A 1JLEA 5LY3A 1XI1A 1ZQSA 3N4PA 4LH4A 2KTQA 4CIEA 9ICFA 4GXJA 3I0SA 2KVCA 5KFOA 1O13A 3EEQA 4ZOHC 2X74A 5JS1A 5AI8A 3QYPA 3PSFA 3ICXA 2D8CA 2QI2A 3AAQA 1NGHA 1KBUA 3GU3A 3QU2A 5G5HA 1RM6C 4KTQA 4JKGB 5M1NA 9ICNA 2K8AA 3NUQA 2FMPA 3H4DA 4DV0K 2D0BA 8ICHA 4ECUA 4YDUA 4KLJA 4M2YA 5FLXO 3VF2A 9ICMA 3RFAA 8ICQA 2ZIVA 8ICGA 5C25A 3VA0A 9ICXA 3GG4A 1B22A 1RNHA 4ECRA 3MX2A 5HRNA 4V19S 4R64A 1TYQA 4JHDB 5ALDA 5J0RA 4M0AA 3H1VX 3V9XA 1NNEA 4NL9C 3DMJA 3IMXA 3NH1A 4CECA 2W9CB 4YOVA 4DTPA 1TAMA 2Y1JA 2JRZA 4JKCA 1ZQQA 5BRDA 4JRQA 3CCSN 1IBMK 3CNHA 4DOAA 1FXXA 4H5TA 1WCLA 2VQEK 4FK0A 5HP4A 1VHXA 4QS8A 4DQSA 2KFNA 3NS1A 5KFNA 1IG6A 3C2KA 1EWRA 4CK3A 4BGDA 3L2QA 2QARA 2HHHK 3VQ8A 1D9DA 1YT3A 4B9TA 4K4IA 3LZIA 1OXJA 4O3QA 1Q82O 4MF2A 4C7ZA 3UKUB 3O9SA 1DGJA 1X6IA 3O9RA 4CFAA 3I8BA 5BPMA 3H8JA 4LY7A 3LM2A 1OKJA 2W3RA 2I9GA 3DLEA 1PK1A 3DXKB 3AVAA 4I2JA 1HKCA 3K5MA 1VQ5N 5JU5A 4F4XA 1WOQA
chains in the Genus database with same CATH topology
2C2RA 3OSPA 1S97A 3CC4N 4O5CA 1U6ZA 1T6DA 5FPMA 3Q8KA 7ICTA 3E9OA 4A5BA 4U7BA 2V52B 3EKSA 5J0YA 1S9FA 5J2JA 1NK8A 4BR5A 2F1JA 3VGMA 5IINA 8ICLA 1NK6A 1HX1A 4ECWA 2A3ZA 5BPNA 1YJNN 2BUPA 3EO3A 2NRHA 3SV3A 4EZ6A 3MN9A 1NKEA 4UB2A 3V6HA 4NXZA 4RQ1A 4IFEA 9ICCA 4I6MB 4EYHB 3Q8LA 1T3NA 2AGQA 4M9NA 4RT3A 3AGKA 1ZQDA 5KFJA 3GL1A 4QW8A 3H3NO 4IRCA 1YXQA 3E9PA 4IEEA 4KLIA 1GLDG 4JK7A 1B43A 7ICHA 4FWLA 1ZQWA 2YX6A 5AQUA 1ZQVA 4JV1A 5AZJB 5DQIA 2AU0A 4O5KA 2HMPA 5J2GA 2RDJA 4F5RA 4BY9C 3Q8SB 5JICA 4CI6A 5M1PA 4F91B 5KFIA 3G6VA 4XH4A 1ZXOA 1YJWN 3ZEUA 3OHAA 3SZ2A 2ASPA 4DQQA 1D9FA 5EX5A 5GAEP 1H1VA 3GBTA 4TUPA 4H0XB 4WFBL 2WUSA 1NGIA 3M9MB 1N56A 1NGFA 1NGAA 2HBMA 3JXUA 1ZC6A 1ZQCA 5HMLA 7ICGA 1C0FA 1BGXT 1A77A 3ZYYX 3MGIA 1RXWA 4CZFA 3EPGA 3QE9Y 4EIAA 5J0OA 4O3RA 5BRHA 1M1KO 1N48A 3DAWA 5KT6A 1TUYA 3D2FB 3MWTA 5KFUA 2DPNA 3UQ2A 4I2BA 4U67L 2A6AA 4GVEA 3M8SA 2KHOA 1ZQEA 4YCXA 4YMNA 9ICUA 5DQHA 3RJIA 3MX5A 1Q86O 4QS7A 4RUCA 1QSLA 5AQVA 5CJ7A 2BCVA 5J2DA 2QWMA 1K9MO 4R79A 2XCAA 4I2FA 5L1IA 5HHHA 3VERA 3LL3A 3RB0A 5KQDA 3E9LA 5KT2A 4G9ZA 1BG3A 1HJPA 1BVSA 4IR9A 2HHSA 2RHKA 1KTQA 2IHMA 4MLHA 3HPOA 2VWBA 4Z94A 1L3UA 2IMWP 3FLCO 3E66A 4FOEA 4QZHA 4EBEA 2GWKA 3CCRN 4DSKA 3RB4A 3CJ9A 2CH5A 4MLEA 4MO4A 5ELZA 3RB6A 4KLMA 2UVWA 2Q2RA 1K1QA 1RXVA 1YAGA 3VGLA 3MCPA 2ZUCA 1QHAA 4JHDA 4QWEA 4B9LA 2W9BA 1TFRA 2LYHA 4CZHA 3JPRA 2P9SB 4P4PA 1ZETA 7ICFA 3D2EA 3WXLA 3R9PA 1BO5O 4WQ5C 2WBNA 8ICEA 5DG8A 4JUZA 1MC8A 2R8JA 3EKUA 5JVGL 5F9NA 1SZPA 4B9VA 2P6UA 2EWSA 5KFKA 2QTDA 3VGKA 3V7JA 2BPCA 5D49A 3ENHA 3AU6A 3GIKA 3V6KA 7ICVA 2MAXA 2J6SA 4B1YB 2HHQA 5DBAA 4MDBA 2E2NA 2P9UA 1NGJA 7ICPA 5L9XA 4M9GA 4A5AA 3BQ2A 4RQ3A 9ICJA 5DB7A 3QDKA 4JV2A 3WEEB 4UAYA 3LDQA 2QA4N 4O3NA 2BDPA 3BDPA 5M1OA 5FPDA 3V7LA 4DQPA 3CIPA 5BREA 3VEOA 4KH5A 4IEIA 3MR2A 3C1ZA 1D8LA 5KFDA 4OPHA 4CBUA 4I6MA 1K73O 4MEYA 2CGLA 3WT0A 4BG9A 1QSSA 2B21A 4BXOB 5C10A 3H45C 3BEXA 3O4WA 3I56N 3QEAZ 4C8MA 5KG1A 4FS2A 3L0QA 3HW8A 3LK9A 1ZQRA 5AZJA 5BR9A 4B1XB 2VCPA 4NM2A 4LZGA 3SMPA 5GINA 5AZIA 4O5FA 4BRIA 4F4YA 1Z00A 3VEXA 4C8KA 1Z3EB 4XH1A 3TAQA 3C0BA 4EFHA 4DFPA 2QWOA 1NMDA 3FR0A 5KG0A 2CGKA 3LWMA 1KQSM 4BC3A 5J0SA 4PHPA 5BOLA 4GNIA 5DM6L 1NK4A 4KLLA 4Q8EA 4QWDA 2QWPA 3JPSA 1QQOA 4YXMA 4BG8A 1QVGM 4R65A 3PV8A 4AM6A 3I33A 4IZ9A 4KLSA 3CJCA 4QZAA 1XSLA 1BWFO 3VTHA 2FXUA 3MDCA 3VEVA 3C5FA 2V9WA 3W3DA 3K9JA 1KDHA 9ICPA 1NK7A 1KRPA 3CCVN 2AP1A 3OW2M 4QZBA 3EWAA 5AQLA 4Q45A 4I2CA 4DO9A 4MO5A 3Q7BA 4R8UA 4M47A 3FZMA 3GDQA 4F8RA 3VMFB 2VGMA 2ATLA 4M9LA 2ZJRL 3Q8QB 3A5LC 5KFYA 3TFRA 4O3OA 3KWGA 5EWFA 4R66A 8ICJA 3EE9A 4DWIA 3H8SA 1NBWA 4K41A 3QBXA 3JPPA 4DOBA 9ICAA 4BRLA 7ICIA 3ATVA 8ICAA 2I7NA 1WUAA 1RYSA 4ILHA 1BUPA 5KFLA 1BOTO 3O6WA 4ECVA 2ZJ8A 3PIOL 2E2PA 4PL7A 3C1YA 5F1XA 1L3TA 3TSUA 4ELUA 1VQNN 2Q0RA 3G6EN 4YFKA 1C0GA 1UT8A 4P4OA 5KFBA 4YR3A 4ED8A 3ZD8A 2W9MA 2F7TA 2P9PA 4TURA 3R1XA 3GDXA 4QZ8A 5LJVA 3MR5A 1X3NA 1SS6A 3KHYA 3BUZB 2HW3A 4DQRA 2IVPA 3FGUA 2PBDA 3MFIA 4RQ2A 3KVGA 3A5MC 1S3XA 3CCQN 5KG6A 2HSTA 2BPGA 5ADXH 3ZDCA 1SZ2A 2HBJA 3AARA 1V9PA 4DEZA 3TANA 4B9NA 5HOOA 1VAZA 1IXRA 3RRHA 1S10A 3A5NC 4BC4A 4PH5A 3GFKB 4J9SA 4ECYA 3SBTA 4PL8A 1BU6O 1U48A 2FSKA 3PX0A 1QZ6A 2GEMA 1NJYA 4LC9B 2AQ4A 4I2HA 1T7PA 3HBTA 4DSEA 4O8KA 4EHUA 4WFNL 5FPNA 5IIKA 3H4BA 5GAHP 2Q36A 3QFPA 5FPEA 4IOXA 4H0YB 2ALZA 2HVHA 5KQ8A 2F1HA 4F4WA 2HHWA 1DGSA 3T5JA 4FWMA 4JD2A 2D0OA 5EOYA 3UKRB 4Q44A 3ZDEA 3HX0A 1EQYA 3ID8A 3HOSA 3PW7A 3HOTA 2WTFA 1JCEA 4M7YA 1TK0A 4FWSA 3ULEA 1ZQHA 4R63A 1Q81O 4RPXA 5MLCQ 5C0YA 5CB1A 1HUZA 2FLNA 4NLNA 4WQ5A 4DS4A 3H3OB 5E26A 4BRGA 4YVZA 5KFZA 4X5VA 2ISPA 3I55N 1QLNA 3MN5A 3RSEB 1VQLN 3RJKA 4DL6A 3BQTA 2V7YA 3AGRA 5CR4A 2FLOA 4JEPA 4CJ7A 4M9HA 4BRNA 2QWRA 1X2IA 1XO1A 3HWTA 3J7ZO 3TARA 3VEZA 8ICBA 3U4LA 4MEXA 4CZIA 5DGBA 1ZQKA 3RBEA 3PO5A 3OA9A 3CCJN 5DQGA 2E20A 4FWKA 1X9SA 4FBTA 4BRDA 5CE3A 2OTLN 1E4GT 3T5LA 2ZUDA 2E88A 2J6UA 3M1FA 2QM1A 5I9EB 4KLUA 4KH4A 1L3SA 3KWIA 1TK8A 2P9LB 4QZFA 3CMAN 4P4MA 3UB5A 1XQSC 4FO0A 8ICCA 3CMEN 1PZNA 4O0IA 1Z05A 2XGQA 2JEFA 1OVYA 2OANA 4IO9L 3KTQA 4YOYA 4KN4A 1GLEG 4H0OA 4YQWA 2Q0ZX 2HHVA 2QWNA 4JKFA 2A42A 4YOWA 4UBBA 3H6EA 5KPTA 5HMMA 2A1JB 1JX4A 3C2LA 3C2MA 2CH6A 4IOCL 8ICRA 4O3SA 4UBCA 3C23A 2ISOA 1GLFO 1NJIO 3CCUN 4JK1A 4PGXA 4BROA 2XY5A 5M1FA 2OTJN 2PAVA 3Q8MA 4KH6A 4JK9A 4DF8A 4LVSA 2E2QA 3P38A 3NMUA 4J8FA 4DCHA 3W0LA 3ISCA 2BTFA 5J2AA 1Q7YO 4FWOA 5DB6A 3SAGA 1U45A 4H03B 1JCGA 4K43A 4Z6FA 5AQFA 4QW9A 5AQTA 2PI4A 9ICTA 4PHAA 3VETA 1H38A 4KBOA 1S76D 3CI5A 4YOXA 4ECQA 3C21A 3G4SN 2E2OA 2BHNA 1CZAN 2VYPA 5CHGA 4BREA 4KMUA 1C7YA 2P9NA 1R59O 4KN7A 2J6TA 2GX9A 2IVNA 5AQGA 5JLFA 4UB5A 3LDNA 1ZBSA 5H1SQ 1CEZA 3PR4A 2ASDA 2Y1IA 3LDPA 5J0XA 5AQYA 4I2AA 1U2VB 3VESA 3PVXA 4MFAA 1GLLO 2KZ3A 4WQ4C 3KHRA 1K8KB 3MN7A 3WXJA 3IFRA 1TAQA 4H5NA 4FBUA 4F4ZA 1HJOA 3RJHA 3WXKA 2FLLA 3CCEN 3VEWA 4XUSA 5KT4A 4DL5A 4FWPA 4I2EA 1EXNA 2FF3B 4NLCA 5KTQA 3EN9A 3KK7A 5AQQA 3WQUA 1BPZA 1UA1A 2IIRA 1VQMN 4EBCA 2H3GX 3CJBA 5KT3A 4FWRA 3VEYA 3NTUA 3HP6A 5JLHA 1U9LA 1NGBA 7ICNA 9ICBA 1XC3A 3HI0A 1SQKA 7ICRA 4RNMA 3R6MA 2BH1A 5C5JA 4FS1A 1L5UA 1NGCA 2Q0UA 7ICKA 2CGJA 3PIPL 3TSPA 4RQ7A 2P9KA 3RJJA 4DSIA 4O3PA 4JV0A 1NK0A 3QZ8A 4HYKA 3QEBZ 4DLGA 4M6WA 3TI0A 3TSQA 1Y88A 5L1JA 4KITB 3PO4A 1LCUA 4KLFA 3VF6A 4IWVA 3T7ZA 5AFUA 4DQ8A 4M9JA 1SKRA 1V4TA 4JKDA 4J9KA 2BCRA 4GC7A 4PGQA 2ITMA 3UXOA 4I28A 2FMQA 2IA6A 1YHQN 5M1KA 4JKGA 4DQIA 2BCUA 1KFSA 3M9NB 4DHYA 5BN9A 3JPQA 2A40A 2ZJAA 4KLHA 3BF1A 3RR8A 2PXIA 3HZ6A 5EY4A 3WUHA 1KSPA 1WCNA 4M04A 9ICKA 4K4GA 2W9CA 8ICVA 4EAHD 3MABA 3DJCA 3ETLA 4JKBA 2XCPA 1S22A 4FO6A 4H0TB 5KFPA 4CZGA 3F2KA 1K8AO 3MGHA 5C2FA 4IRDA 2VGNA 1COOA 1TKDA 4DSFA 2WFBA 3OSNA 4FWQA 4O9MA 1P90A 4M63C 3UKUA 1BPYA 2HBLA 2GWJA 1JIHA 3DXKA 1ZYQA 4Z6CA 3CJAA 3Q7CA 2JEJA 2M9NA 2R8HA 4ELVA 4PHTX 2P9IB 3CETA 2PFUA 2A41A 4A62A 1K1SA 2DFLA 5DDMA 7ICMA 2AQ0A 5JVHL 1X9JA 1XS9D 3SJHA 1LB2B 2ZWHA 8ICFA 4B9QA 4YD2A 3R3LA 5CHIA 4EYIB 4PKIA 2ZTDA 4J9PA 2QWLA 4C23A 3GQCA 3A0IX 5AQNA 5DDYA 4PGYA 5KG2A 5KG5A 2JWLA 4BC5A 3RJGA 5BN8A 5EVZA 3CJ1A 4A59A 2V4QA 1YITN 4JN4A 3EE8A 3SLCA 1TUUA 3QB0A 1YI2N 4IQTA 1KAXA 2ZJPL 1QVFM 1XC9A 1ZQIA 1YIJN 3GILA 4CZEA 3F9MA 4BQLA 1DKGD 9ICRA 1YJ9N 5HHIA 4ED1A 1ZQUA 3WXIA 3AAPA 8ICMA 4C1NK 2YHWA 1ZQGA 4XQ8A 5KFVA 1Y64A 5D46A 3VENA 4EZ9A 1ZQLA 3CF5L 5E84A 2ZTCA 1T44A 3GV5B 3IDHA 3RJFA 8ICOA 1GLCG 3T69A 3PY8A 4BRQA 5EWEA 1U2VA 2KN7A 5KPRA 5J2BA 4FWNA 3CPEA 3ZX2A 4RU9A 1TYQB 5KFAA 2BKEA 5HNKA 2C28A 1S77D 5DBBA 1ZJMA 3RRGA 4K42A 2FPLA 7ICLA 3KZBA 3PNCA 4ED7A 4NM1A 2HHUA 4EEYA 4QZDA 3E1YA 3RVCA 2NRTA 3U8XA 5KT5A 3D2FA 1SKSA 3CERA 4GY2B 4YOTA 4CBXA 5KT7A 1KD1O 4GV6A 5CR0A 4B1VA 2GELA 2UYTA 4RQ6A 4UB4A 1KAZA 3N4QA 4IJAA 5AQIA 4A2BA 1SL0A 4LZDA 4KLEA 1BPEA 1XSNA 5JMVA 5J2FA 3MDAA 4DB3A 5AQKA 4FSVA 4MF8A 4QS9A 3M8RA 3CPWM 3LWLA 4YORA 4H0PA 5GADP 3V7KA 1ESVA 4H5RA 4QWAA 1QZ5A 5J0QA 4RTFD 4RPZA 1JN3A 2C2DA 5KFEA 2NRRA 5JUMA 4JKAA 2IBKA 5AQOA 4M7XA 1VQ8N 5DB8A 3HM8A 3ZDBA 1ZQAA 3CQYA 3UXPA 4RT2A 4TQRA 4TQSA 1KLNA 3GE1A 4DFJA 4XA5A 1VQON 4C8LA 5KG3A 5CWRA 5KFQA 1BPDA 3Q8PB 4BR7A 2UVVA 1QQMA 3MDQA 1NOMA 4ILGB 2HF4A 4BR2A 1ATNA 5IIMA 1MWMA 1ZQZA 9ICSA 7ICQA 1MDUB 7ICEA 2F9WA 3O1WA 1A76A 1DOQA 1SAZA 3G6XA 1KXPA 3H46O 1U49A 2Q97A 1W2BM 4O5EA 2P9SA 3H1QA 3ZEUB 5DB9A 3M3ZA 3B0XA 5M1QA 3AU2A 2W8KA 3PLAA 1BPBA 1CUKA 4O8UA 4F3OA 1Z6RA 3JS6A 3OBYA 1IM4A 8ICZA 4WYBA 4HTLA 1JMSA 1NGGA 2PFQA 1RGIA 5KFRA 2P6RA 4DSLA 1VQ4N 5IIJA 3J8AA 4OO1J 2JZBB 2DPJA 5GIOA 2YHXA 3MMVA 4B1UB 2HVIA 1NWKA 4F5PA 3LDOA 4WF9L 3Q8RB 3ENOA 4RQ0A 3MBYA 1UA0A 5TKWA 2YI1A 5F9LA 1ZQFA 2FMSA 3WEEA 4CZKA 3QMLA 3EL2A 4ISGA 5C12A 2Q31A 2QW9A 2NLXA 5AQHA 4QWBA 1MQ3A 2QWQA 3PR5B 1RZTA 2FPMA 2BR0A 2V51B 1VQPN 5AR0A 3BJYA 3K75D 4J9LA 1D8YA 2MUTB 2R8KA 2NNWA 5HL7L 2W8LA 4BXOA 4H5VA 1P8ZA 1S72N 3FYHA 4ISFA 4XEIA 1ZQBA 3GIIA 3D7EO 1GLBG 2OWOA 5C15A 5DG7A 3SAFA 3IKMA 5L1KA 3CXCM 3LM9A 3VOVA 1XUPO 3RB3A 2GWSA 4BRCA 4BRKA 2BGWA 4IJNA 4IQUA 4WCEL 3KHGA 3RTVA 4ECXA 3NVMA 4DF4A 3O1BA 1KFDA 2BQRA 3K9KA 3CQXA 2V7ZA 2BPFA 2NRVA 3EW9A 4YR0A 5J2HA 2C2EA 4DSJA 3THVA 3T5KA 2VA3A 8ICPA 4B9SA 1S0OA 2FPKA 4FVUA 2J4RA 2W9BB 3O8MA 3AY9A 3PMLA 3PW2A 4J9MA 4KLTA 4MDAA 2D0PA 3ZX3A 4WFAL 3D2EB 1BPXA 3V72A 4F4KA 3O5BA 1N8RO 4GXKA 1ZQMA 3ZX0A 4K4HA 2YJFA 1X3MA 3UE5A 4Y0WA 4I2IA 4C1NI 4GXIA 3MN6A 1HLUA 3O08A 4ILJA 4BRAA 1YUWA 3PMNA 4ED6A 2VA2A 4ECZA 2E8AA 4PHEA 4NO7A 1TVAA 4E0DA 3GIMA 4C8OA 1HKBA 4BGBA 4JWNA 2XC9A 2P9UB 3G6YA 2YJEA 1JJ2M 2F1IA 5KFWA 3D6RA 3C7NB 2BQ3A 1V4SA 4UB3A 1JXEA 3FE1A 3EYZA 4PPXA 4KLOA 5DBCA 5J2EA 5CA7A 3FZKA 1LV5A 9ICQA 3A8YA 1RDWX 3LDAA 5EXWA 3HSCA 3E2EA 4QZIA 1ZQXA 5EOZA 2BQUA 2KFZA 9ICLA 4FL9A 5J0WA 8ICWA 4IRKA 4MFCA 4BRPA 5BPCA 1NK9A 4H0VB 3C65A 3RH4A 4YD1A 2V4RA 3PW4A 4CD1A 1BA1A 1HPMA 1BA0A 1G99A 3C6HA 3OGUA 4ED2A 3QBWA 4QZCA 2I1QA 1LOTB 4DL4A 1VQ6N 3KHHA 5AZIB 2PFPA 4I29A 4IO8A 1Z00B 3RBDA 3S41A 3OHBA 5BPLA 3TU5A 3H7IA 4BGAA 2NRXA 1NLVA 1KFTA 3SV4A 5F2RA 3ORYA 1HUOA 4A61A 4BR9A 4GV3A 4F5QA 4CZMA 3ZDDA 4TUQA 2KKZA 2NRZA 4P2HA 1MA9B 3OHRA 5F0XA 1HUXA 3FDSA 4YN4A 4F2SA 1D4XA 5DGAA 2NZTA 3FZLA 1T4GA 4F50A 4JNEA 2H5XA 1ATRA 5J2KA 4GV9A 2JZBA 5AQXA 4FOIA 4RQ8A 3ISDA 4FPAA 4Z6EA 2PFNA 4F5OA 2YCHA 1ZJNA 2FF6A 2RDIA 1M90O 3DWLA 2KZZA 3TFSA 3QICA 4F93B 1S0MA 3HRGA 1ZQTA 4NB4A