2NRXA

Crystal structure of the c-terminal half of uvrc, in the presence of sulfate molecules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 75
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrxA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrxA01
1S0OA 5KFOA 1X9MA 1CEZA 2C2EA 4IRCA 5KG6A 4QZDA 3Q8QB 4JWNA 4R66A 4UAWA 4O3NA 4DQSA 3PO4A 4M6WB 5J2AA 4RQ2A 4NLNA 2Y1JA 5J2BA 5CJ7A 2NRRA 5J2CA 3H8JA 5KG7A 3N4MB 4O5KA 4KTQA 1ZQMA 8ICKA 2B21A 3RB3A 1ZQVA 2A1JA 4RQ5A 1TKDA 5DBAA 1ZQJA 3JPTA 3UQ0A 5J29A 8ICWA 5EWFA 1ZQWA 4P4OA 4PGYA 3M9MB 2FLPA 3UXOA 2P66A 3UXPA 9ICSA 2ASLA 2PFQA 4KLQA 4KLSA 9ICFA 4RQ1A 7ICKA 4RUCA 2R8HA 3QEAZ 4ECUA 1TVAA 5BOLA 3M9NB 5KFKA 4RQ3A 1Z3EB 4E0DA 1MQ3A 4I2GA 3QZ8A 8ICZA 4F50A 3FYHA 4YP3A 3RJHA 1NOMA 4B9UA 4NXZA 5EOZA 3TI0A 4DWIA 3PX0A 5DLGA 2KFZA 1Y88A 3T3FA 4DL5A 5HNKA 2KZMA 2JZBA 4F4WA 3JPOA 3RAXA 3TFSA 5L9XA 4EYIB 3PW5A 4Z6FA 3Q8KA 4R63A 1NK4A 1RZTA 1RXWA 4F5NA 2F1HA 4JUZA 2C22A 1S76D 2BHNA 3T5JA 4XA5A 4J9OA 3GIMA 3BQ0A 1D9DA 2KN7A 4DS4A 4RQ7A 2BQUA 5KFUA 5J0TA 1HUZA 4F2SA 1KDHA 1A77A 1ZJMA 4TUQA 3PNCA 3RAQA 9ICKA 2FPMA 4RQ6A 4R8UA 7ICVA 1ZQZA 4GXJA 1TAQA 4JV0A 1XC9A 3LWLA 3C5GA 2RDJA 4F5QA 7ICOA 1COOA 8ICSA 2PXIA 4GC7A 4DFKA 3PO5A 3GFKB 5KT2A 3GIKA 4C8KA 1ZQSA 3QZ7A 4NLKA 4R65A 4ECWA 4JV2A 2W9BA 2UVVA 3PW0A 3MR2A 2BCSA 2ZUCA 1T7PA 4I29A 4IRKA 5J0QA 2KFNA 1S10A 3KHHA 1WCNA 3ZDDA 4ELVA 3M8SA 2W9CB 5DDYA 1SL0A 2ALZA 2ZUDA 2XCAA 1ZQHA 1U45A 3OGUA 5DBCA 3SYZA 4XRHA 1NK8A 2BKEA 2BCVA 1ZQXA 4EBEA 2DFLA 2AGQA 4JWMA 2MUTB 5KFQA 1XSNA 4B9LA 4EZ9A 3KTQA 4G3IA 1S0MA 3PX6A 2AQ4A 1RXVA 4MF2A 4RT3A 4I2CA 4DLGA 4RNOA 3C2MA 8ICNA 4F91B 1XO1A 5KFZA 8ICYA 3TAPA 2XO7A 4FS1A 3NTUA 1NK5A 4F4KA 4M9NA 4O5EA 4O3RA 4PH5A 1WCLA 4F5RA 2BCRA 1SKWA 4DSJA 1ZQNA 4YR2A 3TANA 5KG2A 4KLIA 2VA8A 4FO6A 4DSFA 1BPDA 2KZ3A 4K4IA 4LVSA 1A76A 3ISBA 3RH4A 2KZZA 3TFRA 4J9PA 5BOMA 1V9PA 4F5PA 3ZDCA 3RRHA 4Q44A 2F1JA 4QZAA 4RPZA 9ICXA 3MR3A 5KFGA 3HW8A 4ED0A 4O3QA 5HMLA 3PW7A 1TFRA 3EWAA 1ZQTA 9ICOA 5EWEA 5J0RA 4MEYA 4RNNA 4Q45A 4MFAA 3QE9Y 1BGXT 2ZTCA 8ICTA 2ZJ8A 5F9NA 4EZ6A 5KFXA 7ICFA 9ICLA 3C2LA 4KLOA 3GV8B 3ZD9A 5DQIA 5IIMA 9ICVA 3HWTA 3QEBZ 1BPEA 4DSIA 5J0PA 3ZDAA 9ICEA 4HYKA 1JX4A 8ICGA 3HPOA 3PR5B 2R8KA 5IIOA 4KLJA 1NK7A 1S0VA 1JIHA 3HT3A 1X9WA 2BPGA 4P4MA 2ZJ5A 3PMNA 5DGAA 7ICSA 4F93B 5DQHA 3RJEA 4NM1A 2W9MA 4ED8A 4M6WA 4J9QA 4GC6A 2FLLA 4ECSA 4I2EA 7ICPA 1UA0A 3ZD8A 4F2RA 4IQWA 7ICRA 4QWBA 1ZQEA 3BJYA 3ETLA 4O0IA 2BCUA 4ECTA 2XY6A 4FBUA 3H8SA 5KFNA 1B43A 3AU2A 1L3SA 4PHEA 4DO9A 4C8OA 4DQQA 3H4DA 1ZQGA 3RBEA 1XS9D 4KLMA 4DFJA 4DSKA 3ISDA 2BQRA 1RYSA 1HJPA 3MGIA 2W9AA 3ZDBA 9ICQA 5KFYA 4UBCA 4DS5A 1T8EA 1T3NA 3EPIA 8ICXA 1NK0A 2RDIA 4M0AA 1U9LA 4DFMA 4UAYA 1IM4A 5DB9A 1N56A 5KT3A 3GIIA 3E2EA 3T5KA 2C2RA 4O9MA 5HMMA 4QZFA 4ED6A 4C8MA 3JPSA 4YMMA 5HHHA 1ZYQA 4I27A 2BQ3A 2FMSA 4KLDA 3Q8RB 1ZQIA 1MC8A 2HVHA 2PFNA 2ZTDA 8ICUA 1XWLA 4RQ4A 5KFMA 1BPZA 4CCHA 5J0UA 4FBTA 5J0XA 1QLNA 2HVIA 3RJGA 2AQ0A 4I2AA 5KT7A 4O3SA 1BVSA 3H4BA 1ZQCA 1D8LA 8ICHA 1NKCA 4DL3A 3GIJA 3N97B 5KG4A 4PGQA 7ICIA 4KLFA 3Q8PB 3BDPA 4DF8A 4QZIA 4J9RA 2ASDA 4ECYA 9ICRA 1NKBA 3JPNA 3G6VA 2NRZA 3BQ1A 3V7KA 8ICOA 3THVA 5DB7A 4QWCA 5J2JA 2V9WA 1ZETA 1X9SA 3RJKA 1NK6A 3PR4A 1QSSA 5IINA 1UT5A 3BQTA 3MGHA 1NJWA 2AU0A 4ZH4A 5J0OA 4PGXA 2JZBB 4IQVA 5DG8A 4ED1A 2BDPA 3JPRA 3RR8A 7ICTA 7ICEA 4Z6CA 4QZHA 1U48A 4QZ8A 2FPLA 4YMNA 3OJUA 4QZBA 1L3TA 2ASJA 2AGOA 5CHGA 3RB0A 1NJYA 2JEFA 3MDAA 3MABA 7ICJA 4QWDA 3G6YA 4ECXA 1NKEA 4Z6EA 3OSPA 5L1KA 3EPGA 4YN4A 4ELUA 5C5JA 5DKWA 4Q8FA 4QWEA 1BPBA 4M47A 3EW9A 4UQGA 3LK9A 7ICGA 3ZDEA 2PI4A 3MR5A 2Y1IA 4TQSA 3V6KA 2ZTEA 1MQ2A 4EEYA 2HHXA 2HHQA 4C8LA 3HX0A 4F4ZA 1ZQBA 2GWSA 5HP4A 5KFEA 1ZQFA 1KEJA 4DQPA 1NK9A 4B9MA 5TZVA 2XY7A 4ED7A 4F92B 2W9CA 4TQRA 3TQ1A 3Q8LA 1KSPA 5DB6A 5IIJA 1KRPA 3V7LA 4ECVA 4BGDA 4I2FA 1K1QA 4BXOB 1RPLA 4NM2A 4UB2A 2W8LA 4KLTA 3B0YA 4PHAA 2MUTA 1TAUA 2IMWP 3K4GA 3V72A 4RQ0A 3MFHA 5DDMA 4KN7A 2BPCA 8ICPA 2PFPA 2J6UA 1NJXA 2F1IA 5L1LA 4UB3A 5KFRA 3M8RA 1N48A 2KTQA 1Z00B 2PI5A 4KLGA 1ZQRA 3LWMA 4I2BA 4J9SA 9ICPA 1ZQUA 5EWGA 4LZDA 4DOAA 2JEGA 4MFFA 5DG9A 1RYRA 1XSPA 3IM1A 4QZGA 9ICUA 4XQ8A 4F3OA 4YCXA 2HHUA 4RU9A 5IIKA 4QW8A 4GXKA 1TK8A 3RR7A 9ICNA 1JMSA 2ZJAA 4C8NA 1QTMA 2J6SA 4ECQA 1ZQDA 1UT8A 1L5UA 5KFLA 4KLLA 5KT6A 4TUPA 4TURA 4YXMA 2J6TA 1T4GA 5L1JA 3C23A 5DBBA 2ATLA 2DPJA 4XUSA 3RBDA 2BGWA 1SZPA 3RJIA 4MF8A 1UA1A 5J0WA 1HUOA 2XGPA 3FDSA 4YG2A 5KFWA 4ED3A 1PZNA 1ZQQA 2JEIA 5KFDA 3ORYA 2HW3A 3SI8A 1KFSA 4DSLA 4GLXA 1KFDA 2NRWA 5DGBA 3GV5B 4I28A 4FS2A 4DOCA 3RB6A 1DGSA 1XSLA 4M04A 2P6RA 3H7IA 4DL4A 4J9KA 1ZQYA 3LDAA 3UPQA 8ICEA 4UB4A 4UBBA 2JEJA 5KFCA 3AUOA 1U47A 3OSNA 5J2EA 1SL1A 4LZGA 2AGPA 2HHVA 3KHGA 4NLZA 1SL2A 3GV7B 2DPIA 2XCPA 2M9NA 2XC9A 1NJZA 4YXJA 4IR9A 4NLGA 4M9JA 3NGDA 5IIIA 1H38A 2HHTA 5CA7A 3G6XA 1U49A 5CWRA 1QSLA 9ICWA 2VANA 4I2JA 4YMOA 4I2DA 1TK0A 1QSYA 5KFAA 3PW4A 2UVWA 2BPFA 4KMUA 3RH5A 3PW2A 4KITB 1BPYA 5KT4A 1S97A 3IHQB 5J0SA 4ELTA 1S0NA 1ZQKA 2R8JA 4DSEA 3EYZA 4PPXA 3RTVA 2C2DA 2R8GA 4UB1A 3C5FA 2ZUBA 7ICNA 1LB2B 9ICTA 4QZEA 5CB1A 7ICUA 2A1JB 5DG7A 3Q8SB 3C65A 1XU4A 5KFBA 8ICVA 5KT5A 3SZ2A 1ZJNA 2ISPA 1SKRA 3OJSA 4B9VA 5KG5A 3Q8MA 3RJFA 4DF4A 4RZRA 5JUMA 8ICFA 4IQUA 4KLEA 5KFFA 4YVZA 4P4PA 8ICMA 2UVRA 4QZCA 5IILA 4MEXA 5KTQA 4DQIA 3TAQA 5L1IA 3MDCA 1U4BA 4O5CA 1SKSA 2MAXA 5BPCA 3H8WA 2FPKA 2NRVA 4KLHA 4PHPA 3PV8A 9ICGA 1L3UA 9ICAA 4DL7A 1JXLA 2VA3A 2HHSA 3PMLA 4K4HA 9ICBA 4B9TA 8ICBA 3SV4A 3PVXA 1JN3A 1ZQAA 7ICHA 2Q0ZX 4QZ9A 4R64A 4RPXA 4J9MA 4M9HA 8ICCA 8ICQA 3MBYA 3T5HA 5KG3A 4J9LA 5KG0A 4X5VA 4EBDA 5KFHA 4B9SA 4RUAA 1D9FA 2IHNA 8ICIA 4UB5A 3RRGA 9ICJA 3V7JA 4IQTA 2ISOA 1KLNA 3C1ZA 3GDXA 4K4GA 2XGQA 4J9NA 3TARA 1C7YA 3MR6A 3OHAA 4R8UB 4PHDA 4DFPA 1ZQLA 8ICRA 4JK1A 3OHBA 4F4XA 4ECZA 1JXEA 4M9LA 3KHRA 3T5LA 9ICHA 5HHIA 4YR0A 1K1SA 3GQCA 2LYHA 5KFPA 1IXRA 1TV9A 4RPYA 2IA6A 4BDPA 4ED2A 3SV3A 4BXOA 3PY8A 2IHMA 2W9BB 5KFVA 3AU6A 4P2HA 5KG1A 4Z6DA 4YD2A 1X2IA 2UVUA 2R8IA 4MFCA 3EZ5A 1KTQA 5DLFA 4O3PA 2FLNA 1ZQPA 5J2DA 4RQ8A 4I2HA 1D8YA 4IR1A 2HHWA 4YR3A 4GXIA 4DLEA 4QW9A 3H40A 4DQRA 1DOQA 1S9FA 3BQ2A 4F8RA 1Z00A 4KN4A 2V4RA 2OWOA 5DB8A 3ISCA 3K75D 1EXNA 2H5XA 3C21A 4ECRA 2PFOA 3M9OB 1TK5A 4B9NA 4Q8EA 5F9LA 3V6HA 4EBCA 5J2KA 4RNMA 5J2IA 2FMQA 1KFTA 4UAZA 3B0XA 1S77D 5D4BA 8ICAA 3C2KA 2I9GA 3JPPA 4KLUA 1MSWD 3PX4A 8ICLA 7ICLA 4F5OA 3GILA 2BCQA 4DL6A 1ZQOA 5DQGA 4QWAA 3HP6A 9ICIA 3C1YA 4BWMA 4YQWA 3MFIA 5J2GA 2FMPA 4DOBA 1L3VA 4M9GA 2NRTA 2P6UA 4I2IA 4TUSA 4IRDA 5KFIA 2AJQA 2NRXA 2I1QA 4YD1A 5J0YA 1CUKA 5CP2A 2C28A 7ICMA 5J2HA 4M2YA 5CR0A 7ICQA 3JPQA 2XY5A 4JV1A 2W8KA 3V6JA 5D49A 4BWJA 2WTFA 3RH6A 9ICCA 1B22A 3KHLA 1AROP 4NY8A 9ICMA 3UQ2A 2V4QA 3RB4A 3UXNA 4RT2A 3RJJA 4YFKA 8ICJA 4Q43A 4O3OA 4DL2A 2IBKA 5J2FA 4DEZA 5D46A 4EYHB 4F4YA 2BR0A 1LV5A 1BPXA 5KFTA 5KFJA 2VA2A 5KFSA
chains in the Genus database with same CATH superfamily
1X9MA 3MDQA 3CXCM 1QZ5A 3NRZA 1F0MA 4UAWA 3PO4A 3FZLA 5J2AA 3E9PA 4I9QA 1OH5A 4JKDA 2NRRA 1Q46A 3N4MB 3D0PA 4O5KA 1ZQMA 4KMOB 4CJUA 4FFDA 3RB3A 4M3WA 5AQXA 2EAOA 4RQ5A 4FVUA 4EEKA 3JPTA 1VSJA 2WUSA 5J29A 4CJTA 3NF8A 3VQQA 1ZQWA 4PGYA 5A2QO 2FLPA 4ID1A 9ICSA 4KLQA 4DTSA 1KQSM 1JLGA 2P5OA 3N4QA 1VLBA 1VK0A 3O4WA 1PVPA 5FROA 4KHSA 1UPHA 1Z3EB 1IBKK 4CF9A 1ZXIA 5J8YA 2A41A 3L4QA 3QZ8A 2YMLA 2E88A 3FYHA 4KHWA 2OXOA 4DWIA 2XVTA 2KKVA 2KFZA 3AVHA 4IXCA 5KGWA 2P9LA 5HNKA 4JNEA 2G09A 1TYQA 1ZBFA 5AM5A 2EZXA 2ZE2A 2DY4A 3FGUA 4Z6FA 2YB4A 5EE0A 4OGCA 2H3FA 2F7TA 4KTWA 4XA5A 2GUIA 1LOTB 5LMNK 3GL1A 4WFAL 3BS5B 1HKCA 3S3OA 3BQ0A 1U2VB 4NCGA 5EE9A 4AHTA 2BQUA 5J0TA 2NUBA 3PNCA 4PL1A 4DTUA 2FPMA 3VC8A 3RVCA 4OVLA 1PUZA 4JD2B 5AKYA 4R8UA 1ZQZA 4BRHA 2JV3A 3VQ8A 3L0QA 4JV0A 1Z4OA 3QUBA 1XC9A 1ZD4A 2QB1A 1WG8A 1XMQK 1WBDA 1PVQA 3I0RA 8ICSA 1OVYA 3VOVA 3CC4N 5C42A 2DFHA 2Y0SF 1KVBA 1ZC6A 4BRIA 3OYDA 3KKAC 3GU3A 4C8KA 3WQTA 1ZQSA 4R65A 4ECWA 4AF1A 2YI1A 2H3IA 2W9BA 1SV5A 2FJ6A 4FJ8A 1T7PA 3QU9A 2YMPA 2ZIUB 4US9A 2FXUA 3K59A 4L3QA 3HPHA 3EKUA 3W3DA 3LZIA 1GLEG 2HOEA 4JAXA 3OW2M 1SL0A 1DRGA 4OPHA 4FE3A 3QU4A 1NGIA 3SUQA 3U3GA 1QS4A 1KVCA 1YXQA 1V85A 4JI5K 2BCVA 4EBEA 1H1VA 4EZ9A 5AJ3K 3KTQA 4RWTA 4MF2A 4I2CA 4RNOA 1P7DA 1XMOK 4JKAA 3H0RB 4F91B 1XO1A 2G07A 8ICYA 4FS1A 4I6MA 1K8KB 2YNFA 4O5EA 4RW4A 3F2BA 4FM0A 4PH5A 4C23A 3NF7A 2ZD1A 3H0MB 3PSFA 4Y2UA 3AA2A 4KHPK 2O8EA 2YY6A 4FO6A 1VQ7N 1BPDA 1RTDA 2KZ3A 1XNRK 4CECA 4J2BA 5EXWA 4J2EA 4J9PA 2GEMA 2Z1HA 1V9PA 2ZIVB 3RRHA 2LPEA 3ZI4A 4Q44A 1HPZA 2F1JA 4IOCL 3ULEA 1FJGK 2G8IA 3MR3A 1Z4NA 3M3ZA 1URJA 3QEIA 1YZ7A 1KQQA 1BL3A 4RTFD 3CCEN 2WF7A 4MEYA 3VQ7A 3QE9Y 4JKFA 1J9AA 4DUYK 4DTPA 4RG8A 2ZTCA 3EEQA 4B08A 2WF6A 3ICXA 1VQKN 1S1TA 7ICFA 4OCZA 5JU5A 3C2LA 2XHBA 4CK3A 5DQIA 3SI6A 2RLTA 3IRXA 1BPEA 3LDLA 4HYKA 4DV5K 3PR5B 3IFRA 1YJWN 1OH7A 1NU0A 5IIOA 4KLJA 3H3OB 5AQMA 1VQPN 3HKZC 5AKIA 2HNZA 3KD3A 1CRXA 2KJ9A 2QWMA 4KFBA 4BGBA 1NGBA 2ASOA 2YHWA 4KREA 4F93B 4NM1A 3AL0B 2G8UA 4J9QA 4GC6A 2F2AB 4ECSA 1RT4A 2VJ5A 3O9QA 7ICPA 4Y2XA 5AK5A 4F2RA 4IQWA 7ICRA 2KKZA 2W6KA 3AARA 4FJLA 3BJYA 5LMUK 1HLUA 2XY6A 3AU2A 1L3SA 2QXFA 2YNGA 3KZBA 1W2BM 1NNLA 2E3TA 4DQQA 1ZQGA 3V1RA 3ATUA 5AIAA 3RBEA 1QHAA 2P9SB 5ADXH 2BQRA 2O6KA 1RQNA 3MGIA 1U04A 5KFYA 3IV6A 2PYJA 1T3NA 4A61A 3JSMA 4CZFA 5AZIB 1V97A 2ZIWA 8ICXA 1U9LA 4DFMA 1HJRA 4WQ4A 4BRCA 4K0KK 4C8MA 1GLBG 1ZYQA 5HHHA 4CZJA 5H2FU 3TAGA 4LFBK 2WB1F 2BQ3A 2RHFA 2FMSA 2FF6A 4KLDA 3KD1E 3V9UA 2HVHA 1EXQA 2NO4A 1TV6A 2QM1A 8ICUA 4HUGA 1XWLA 5SWMA 1EP4A 4MO4A 4I2AA 2OZMA 1D8LA 1QQMA 7ICIA 4BRDA 4QIWC 3AVKA 4DF8A 1MN8A 3DI6A 1O13A 4UW9A 1RT7A 5AKXA 4ECYA 9ICRA 3NF6A 3V7KA 3E58A 2QLTA 3NMUA 1X9SA 3VEZA 5IINA 5AM3A 2A3ZA 4FLTA 2P9LB 1RG6A 2IOFA 7ICTA 3RR8A 3SQIA 1TYQB 5FLXO 4CD3A 7ICEA 2YHXA 4FM1A 2WF9A 4GVEA 1L3TA 7ICJA 5AK6A 2AGOA 5CHGA 5CE3A 1FIQA 3IN5A 2JXJA 4Z6EA 5M1NA 5CYQA 3AEVA 1ZBIA 3TTCA 4HVJA 5K14A 4Q8FA 2HOIA 4AYBF 4QWEA 2E5LK 4IJAA 1IKVA 3FM9A 1TKTA 7ICGA 4YFUA 4EFHA 3V6KA 4KO0A 2JR5A 2YHBA 4YOXA 2ITMA 2PFUA 4NYNA 1T3QA 3U3YA 4HWIA 3D2SA 4F3TA 3TQ1A 3A5OC 1QHTA 2F8TA 4I2FA 4EX6A 4NM2A 3SLCA 4UB2A 4AHVA 2W8LA 4OX9K 2AXTU 1S1UA 2FBVA 4W5OA 2J6UA 1NJXA 4LD0A 5L1LA 4NV0A 4UB3A 4KB1A 5KFRA 3C7NA 2JGAA 4KLGA 3QIOA 1ZQRA 2E1YA 1JLAA 4J9SA 4O44A 2P9NB 4CGZA 4LZDA 4DOAA 3LPTA 1GLDG 1XSPA 3IM1A 1C20A 4HTUA 1Z19A 1WSEA 3PZPA 5IIKA 9ICNA 4QS7A 3RR7A 4BGAA 4DTOA 4FJIA 4N76A 2J6SA 4ECQA 3CCRN 1X6IA 4DR5K 4FLWA 2KOBA 3KK2A 4KLLA 4UASA 5B66U 3NS1A 4TURA 4KX5A 2P9UB 4I6MB 3VQ9A 1T4GA 1CXUA 3D2FA 2WBNA 3GG4A 3RBDA 1DXSA 1SZPA 1UA1A 1HUOA 4NXMK 2WONA 3KOOA 5B5EU 5ALPA 2XGPA 4YG2A 3H1QA 4B3OA 1GLCG 2O8EB 3IDWA 1GLJO 3WNEA 3MGVA 2HW3A 3SI8A 4AHUA 4CF8A 1WBBA 1R59O 3K1RB 3OTOK 1RILA 4J2AA 4DOCA 1NLVA 3RB6A 4MFBA 4EAHD 2A1SA 2P6RA 3WK9A 2B6GA 1X3NA 4YY3K 2JEJA 2JGUA 5J2EA 1SL1A 1V4SA 4LZGA 3CIPA 4H0VB 4JLHA 5M1QA 3TU5A 4ZTJA 2UUBK 2ZGZA 3MMVA 4NLZA 4MHVA 2DTUA 4A57A 2KKPA 3GV7B 1Z26A 2E1EA 2M9NA 1K6YA 2EAMA 4YXJA 3VF4A 1JCFA 3VQDA 4BRNA 3QU2A 3K58A 4IR9A 4FWOA 1SZHA 5IIIA 5CA7A 3G6XA 1FKOA 5CWRA 4B8CA 3PSPA 5BN8A 1QSYA 5KFAA 2E1FA 3NHGA 3PW2A 1NM1A 1NNEA 1M90O 5KT4A 4RW6A 4CFAA 3IHQB 5J0SA 4DU1A 4DHYA 5AKLA 3RSEA 1E4FT 4ILHA 1O1WA 4KH5A 3I55N 1J5OA 3AMZA 2DQNB 3EYZA 3I0SA 3J7AP 2QW9A 3G4SN 5F3XB 2E6LA 1YI2N 4P0QB 1YJ9N 3C5FA 2ZUBA 2EANA 7ICNA 3TAMA 4FZZA 5ALZA 7ICUA 1C6VA 2KVSA 3HVRA 1TKZA 4XH1A 1XU4A 5KFBA 3OYBA 4O8KA 4OLBA 2ISPA 2OH2A 4RZRA 4KB0A 4DU4A 2IVPA 3U6FA 5KFFA 1Q81O 2CXYA 4YVZA 5LJWA 2NYVA 4MEXA 2UVRA 3AVIA 4OJ5A 3O9TA 4FLUA 4DQIA 1IBMK 3LVWA 1VSLA 1YJNN 1SKSA 4C7YA 1LAWA 3H8WA 4FZMA 4R5PA 1X9XA 5HP1A 3WQUA 1K9MO 3LP2A 4K8ZA 5AKEA 4BREA 2G8KA 3LDPA 1L3UA 1QQ5A 1JXLA 2HHSA 2PAVA 3U26A 3J80O 2OM6A 4B9TA 2ETJA 1IIPA 1ZQAA 4QZ9A 4RPXA 4M9HA 3L3UA 1FXXA 3E01A 3MBYA 4WQ5A 4JYAK 1BQMA 1JLEA 5AQRA 8ICIA 3RRGA 4KH4A 4CEBA 1KLNA 4H5VA 3GDXA 4IC9A 3P83D 1BU6O 3SD7A 3R6MA 3GE1A 3WXIA 3OPXA 4Y2JA 1M6YA 4Y1DA 4M9LA 1CZBA 3B6PA 1RQLA 4JI4K 9ICHA 3G0ZA 1IG8A 4C4SA 1HJOA 3GQCA 1B0XA 5HR6A 5KFPA 2IA6A 2G8WA 5GIOA 4BXOA 4Z94A 5M1KA 3THWA 3JS6A 5GADP 4P2HA 5KG1A 4CF3A 3ETRA 4H03B 2UVUA 3SPZA 3HILA 1KTQA 2FLNA 1CZAN 3WKDA 4RQ8A 4O5BA 3HOTA 4IR1A 3F5EA 3AVMA 4TSXA 4WQ4C 4GXIA 4CBWA 3MWTA 4BC5A 3BQ2A 1GLAG 4KHNA 2V4RA 3WNGA 1Z1BA 3HRDD 3VGKA 1IG6A 4WJ3B 3QNMA 3BZKA 4ECRA 3L4PA 3V9ZA 5GIPA 2LHTA 2GV9A 1NGHA 5J2IA 2FMQA 3GZFA 3OYMA 4GV6A 3BY5A 4H5NA 3THXB 3R8EA 3BS7A 4CJKA 2KVCA 1MSWD 5M1PA 2F3NA 1LW0A 5JS2A 4CEFA 4FLYA 7ICLA 4F5OA 4ISEA 3TKAA 4BG8A 3QETA 3GILA 2BCQA 4ID5A 3M6ZA 3VEOA 5DQGA 3GBTA 4QWAA 1VQMN 3HP6A 3K9KA 2Q36A 1NMDA 4FZNA 4CE9A 3DOLA 3AA5X 4BRAA 4CHZA 1JLCA 4FCYA 3CM5A 4KHUA 3MFIA 2KK0A 4RQNA 4DOBA 1N5WA 4M9GA 5HRNA 2P6UA 5C12A 1CUKA 5CP2A 2YMQA 3D2FB 5CR0A 3VTIA 3PLAA 1QQCA 3JPQA 3KIOA 3CCVN 3E9OA 1SWVA 3T79A 4BRLA 3K5LA 3V6JA 5ALSA 4Z4CA 1EETA 5D49A 3OVNA 4UAVA 5FRNA 2RN2A 3P39A 3QFPA 9ICMA 3AVBA 3RB4A 4OJLA 4CF2A 3T1HK 3CF5L 2P5GA 5ALJA 4B1UB 1ECWA 2G5IB 1L8OA 3VEXA 5J2FA 4MO5A 4EYHB 3MC1A 1RT6A 1TK5A 1XUPO 1SB3C 2W11A 1S0OA 1Z05A 1DK3A 2C2EA 3LP0A 4GMJB 3OYGA 4M6WB 2Y1JA 3SQ1A 1XNQK 4R79A 4U7CA 5ALGA 3H8JA 5KG7A 4CDGA 4PL8A 5T7BA 3CD6N 2B21A 1ZQVA 1TKDA 5AK4A 2LYBA 8ICWA 3A0HU 2P66A 3CMAN 2ASLA 2PFQA 5AFUH 3A2FA 4RQ1A 4W5NA 4RUCA 3ATVA 3RSEB 1FEZA 1HIWA 4A8EA 5ELZA 3PSTA 3M9NB 5KFKA 5KQDA 4RQ3A 2EQYA 5JS1A 4E0DA 3OBYA 5KAIU 2HSZA 3PIPL 2GUPA 1LWCA 1ZRNA 1VSEA 5F0XA 3PX0A 5DLGA 1Y88A 3T3FA 4DL5A 2KZMA 2HNYA 2JZBA 4I2PA 4BR7A 4F4WA 3WXLA 3JPOA 4C7ZA 3RAXA 4KRFA 4BC4A 4NO7A 1S76D 4F5NA 3MEDA 1XHZA 4FWLA 2KHOA 4CERA 2KV2A 3MXMA 3GIMA 3OYLA 1XNSA 2KN7A 3M7DA 4O8UA 4U7BA 2BUPA 4F2SA 2HF3A 1A77A 3TSPA 4M42A 4TUQA 2DFFA 3P31A 4CFDA 5DM7L 3AM9A 5BRDA 4GXJA 2PZSA 4U67L 3BUZB 4F5QA 1PK3A 7ICOA 3SCXA 1OH6A 2WF5A 4CZIA 3THYA 2E1ZA 4GC7A 4PKHA 4OJ6A 3WUHA 3CCSN 4DFKA 4DR3K 5KT2A 2I7PA 3H45C 1HNWK 1G99A 3PW0A 3MR2A 2K89A 2BCSA 1Q8KA 3NH0A 3CFPA 1YF5L 3HKZF 4O0JA 3CJ7A 1MA7A 2YB1A 2YTUA 5CYMA 3C6AA 5DDYA 4FWQA 2ALZA 1D8BA 1J5EK 2XCAA 3DLHA 3OGUA 3VERA 4XRHA 4CGDA 2ZJPL 2BKEA 1ZQXA 2AGQA 3H46O 2MUTB 1JCEA 4B9LA 1RDBA 4MQ3A 2UUCK 3PX6A 2PBDA 4H8KA 5J2MA 2O8BA 4DLGA 2QWNA 5HROA 1RT2A 4WFNL 5ALOA 2CPRA 1VQ4N 2XO7A 2DGZA 2J4RA 3MWPA 4FSVA 1VHXA 4O3RA 5GTHU 5AI9A 5ADXA 4DSJA 2O8FB 3N7RC 3ZETA 1KBUA 3DLEA 4EELA 2FF3B 1FK9A 3TANA 4KLIA 1JLFA 5BRFA 2H3QA 4DSFA 3HXMA 4LVSA 1Q3UA 1A76A 4PWDA 3RH4A 2D4WA 2KZZA 3TFRA 1KVAA 1YTAA 2PYLA 2DBYA 5BOMA 4F5PA 3AO3A 3IKMA 3U9DA 4A59A 4QCLA 1ATSA 4PUOA 9ICXA 5KL1B 4P0PB 4ED0A 3HW8A 4WQ5C 3T1AA 4FXDA 3PW7A 1TFRA 3EWAA 4AM6A 4JS5A 2KW4A 5EWEA 2VWKA 5F1XA 2P9PA 3OS2A 5J0RA 2VQEK 2M0NA 4Q45A 4QIWF 1REVA 3CG7A 1BGXT 2Y9TA 3N7PD 2HOFA 2BTFA 3WKEA 4EZ6A 5LY3A 4IFYA 2LBOA 4YOTA 3LM2A 1BQNA 4GY2B 3ZD9A 4JKGB 5IIMA 3DXKA 1DEJA 3O4QA 3QEBZ 5BR9A 1S8OA 4DSIA 4B1XB 4EHUA 4H5RA 1T6CA 4BR9A 9ICEA 1EQYA 2RP5A 8ICGA 3DLLL 1N32K 3HPOA 1Q3VA 1N62A 3C29A 1NK7A 1N8RO 4Z4FA 2OPQA 1TE2A 2BPGA 3FAHA 3AY9A 4P4MA 1HEKA 3FZKA 5DQHA 4FJ5A 3O4NA 4ED8A 2FLLA 5BPMA 3KHYA 4BR5A 4I2EA 1KAZA 1UA0A 3CM6A 3ZEUA 4FWMA 3E1YA 1ZQEA 4O0IA 5AQGA 2A19A 2Z1IA 1ZBSA 2XI9A 2ES6A 1Q18A 4BY9C 2Q97A 3S9HA 3TSQA 1CI4A 1IO2A 1LKYB 3P1GA 4J2DA 3L3FX 2W9AA 1GLLO 3ZDBA 3HVTA 1T8EA 3QNNA 1DGJA 3EPIA 1VSFA 2RDIA 4M0AA 3PUFA 3VEVA 3GIIA 4L8RB 4QZFA 4ED6A 4Y2QA 2DWQA 3JPSA 3DRSA 1ZOLA 3LANA 4DR6K 1WSFA 2ZWHA 3Q8RB 5HRRA 1MC8A 5G5HA 4E1MA 4BC2A 2PFNA 1G15A 3L4IA 5EE3A 4PKIA 5IWAK 1BPZA 1R0AA 4WYBA 3HSTB 4CCHA 5J0UA 3L2RA 5J0XA 2AQ0A 4BJQA 5KT7A 5GAGP 3SUPA 2D0BA 1NKCA 4DL3A 4UATA 4DQ8A 4YHHK 1HQEA 3WEEA 4KLFA 2CGJA 3K2PA 2ASDA 3UKUA 5I3UA 1NKBA 4ILJA 1MWMA 3G6VA 1MA9B 8ICOA 1V4TA 1HYSA 1HPMA 3VF2A 4CE6A 4O55A 5J2JA 4CZHA 4LF6K 2D0AA 5HR7A 1UT5A 1OUQA 3WKBA 3BQTA 3MGHA 1NJWA 2AU0A 4ZH4A 2V52B 3F73A 1HNXK 2JZBB 5AQQA 3NVZA 5T14A 4GNIA 4QZ8A 3OJUA 1X66A 4YMNA 1JL1A 3EZWA 3K5MA 3RMCA 1RDWX 5HOOA 3OY9A 4ZHRA 2D0PA 3OSPA 5L1KA 4YN4A 5C5JA 4KPYA 1BPBA 1VRUA 4QS9A 1LWEA 3LK9A 4JI0K 3ZDEA 5J1EA 1T44A 2QB0A 1KC8O 4TQSA 5BN9A 3ZSVA 1RTIA 4EEYA 2HHXA 4F4ZA 5JRTA 5SZTA 1NOYA 4B3TK 3QX7A 1FKPA 3LL3A 4H4MA 4F92B 2W9CA 1X3MA 4NLCA 3L8BA 3VGMA 3V7LA 4CHPA 2JH1A 4ECVA 4BGDA 1HR0K 2RE2A 3WK5A 2W6LA 4W5QA 3AAQA 3CCQN 1TAUA 1YAGA 2GO7A 3K4GA 1L8LA 3V72A 3IG8A 2OZSA 2BPCA 4GIBA 2PY5A 3HM8A 1WAFA 3UKRA 4JV5K 3AQEA 1J54A 2E2NA 4CVNE 4BR0A 3M8RA 1RDFA 1N48A 4GFJA 3A5NC 2FE9A 4I2BA 5EX5A 9ICPA 1F21A 3NUQA 1GOCA 3EE9A 1FO4A 4IEEA 5DG9A 4W5RA 1YITN 5A0LA 4JI8K 5AIBA 3ISNC 2OCEA 4F3OA 2EX3A 3EL2A 4CBUA 1UQVA 4H0XB 3DXMB 2O8DB 5AZJB 3OYFA 3ED5A 3NGZA 1UT8A 1L5UA 1UCVA 4Q0BA 2JWKA 4LJXA 4TUPA 2F8LA 3TR8A 3LALA 4CJ4A 3KWIA 4OKEA 5L1JA 1KD1O 3C23A 3LAMA 2ATLA 5AI0A 2DPJA 4XUSA 1NGCA 4MF8A 5J0WA 3LDNA 4BACA 4RQMA 3QNOA 5KFWA 3TAEA 3PIOL 3CPEA 1T3VA 1SAZA 5KFDA 3ORYA 1KFSA 1Q8IA 4KHYA 4GLXA 3O1BA 4IOAL 1C0FA 2EH9A 3GV5B 4I28A 4FS2A 2CRXA 2K4PA 2I5JA 4RW9A 1TKXA 4Y2SA 3ZCMA 3H7IA 4LH5A 3LDAA 3A0BU 4IDHA 5ALTA 3AUOA 3OSNA 3O8MA 2LKYA 2IVOA 5GAEP 2HHVA 4UB6U 5KPZA 2NO5A 3KHGA 5ALRA 2BH1A 3WKAA 3CQXA 2DPIA 2XCPA 2UUAK 3ZYYX 2QKKA 2KICA 4GVMA 1LVHA 4M9JA 3NGDA 2HHTA 4FJGA 9ICWA 4JK8A 2VANA 4YORA 4I2DA 1TK0A 4Y2PA 2P9IA 2Q3SA 3ZSZA 4KHQA 5B8HA 5J2PA 2E8AA 4KMUA 3CJ1A 3QU5A 4CHYA 1C0UA 1HNVA 1S97A 2NLXA 2NZTA 1ZQKA 2R8JA 1A5WA 3S3MA 1N33K 2R8GA 1NGDA 4UB1A 2E8OA 1J53A 2VKQA 2EZZA 5KRSA 1BISA 5CB1A 4QOZB 3DEEA 3Q8SB 3C65A 1SWWA 1N6QA 1RFQA 3SK3A 3SZ2A 1ZJNA 4E7IA 4E3SA 1SKRA 3OJSA 2P51A 5KRTA 5KG5A 2G06A 4CEOA 3MXIA 5FP0A 3VESA 3ENOA 2UXCK 3U8XA 4P4PA 3OYJA 4IO8A 5CZ2A 2YKMA 1ZRMA 4BDYA 4CESA 3QEPA 3TAQA 1K5OA 3MDCA 3HSCA 4FJ7A 2MAXA 2XICA 4YDUA 5AQUA 3NF9A 3VCBA 3HYFA 2NRVA 3G71N 4JI3K 4KLHA 1EWRA 5CEHA 5TKWA 1VSMA 2D1KA 2F4VK 3NH2A 3PMLA 5AQIA 3SV4A 1JN3A 3ZT0A 2Q0ZX 1WYGA 4R64A 4M7XA 1HNIA 1FW6A 2ZXHA 1MU2A 4K8XA 3G6EN 8ICQA 4FPAA 2HCFA 3NAEA 4B9SA 3VMFB 3UKUB 3ZSWA 3AO1A 3ID8A 1VSHA 3VEYA 1WUDA 5E84A 3C1ZA 4K4GA 1WN7A 3TARA 1EKEA 4R8UB 4PHDA 4JK1A 3NVWA 3VA0A 1TVRA 1X1PA 1JXEA 1L7PA 3A5LC 1JALA 4F72A 3V9SA 4BE0A 2LYHA 4PZNA 4RPYA 3SAHA 4C80A 4ED2A 1WSJA 3J81j 2IHMA 2W9BB 5I9EB 5KFVA 2HMIA 3ZSXA 2DKZA 3VTHA 2QB0B 2DPNA 1X2IA 2R8IA 3EUB2 2O4IA 4B9QA 1JROA 4BR2A 1HX1A 5J8YC 2ZGYA 4PA1A 5EY4A 4DQRA 4F8RA 3H40A 1DOQA 4LSLA 3CETA 1Z00A 3KZIU 1N63A 5DB8A 2E2OA 3LDOA 1ZD3A 3K75D 1JCGA 5KPRA 3T69A 3L6QA 5BRHA 1EXNA 5KL8B 2K4HA 2KIWA 2OYYA 4BX9C 5FPDA 3I8BA 4QAGA 3V1QA 4Q8EA 3C6HA 4NWIA 5F9LA 4EBCA 2G5HB 5J2KA 4RNMA 3ZSOA 1JXBA 4B1WB 3HRGA 4UAZA 4QJFB 2I9GA 3JPPA 4KLUA 3PX4A 3QEWA 4BUGA 5AFUA 5AKHA 1KKXA 4JEPA 4DCCA 3TAFA 4GV9A 4Y1CA 4N41A 3CJAA 3OYKA 5EU7A 2ZIXA 3EO3A 3P5JA 2LM4A 1U6ZA 2YCHA 3DYAA 3QU7A 4IO9L 2HBJA 4CI6A 3VA3A 1L3VA 4OLAA 3ULEB 3C94A 4I2IA 5DM6L 5ALLA 5KFIA 2D0CA 4YD1A 3ZT3A 5J0YA 2C28A 7ICMA 4KTZA 5J2HA 3VN5A 4OJOA 4CGFA 1YZ6A 5C0YA 2IGIA 2XY5A 4JV1A 4Z4HA 2GLEA 2W8KA 3AVLA 3O1WA 4AHRA 2B4JA 4BWJA 1S1WA 1B22A 1ITGA 4BVPA 1AROP 2OPPA 4NY8A 3FZHA 2ZG6A 3QYPA 4YFKA 1E3MA 4Q43A 3AVNA 3Q7CA 3KKSA 2Q0UA 2IBKA 3MEGA 4DEZA 5D46A 4CHNA 1BPXA 4X62K 3F2KA 3QEXA 3AAPA 1A5VA 4JKEA 4M45A 1CEZA 3CJCA 3KLHA 4IRCA 5KG6A 4QZDA 2FSJA 2PMZC 4JWNA 3HO1A 2EWSA 3H0LB 2IOHA 4NLNA 3AV9A 4BRKA 2HBMA 3SQ4A 3F53A 4CJLA 2F77X 8ICKA 5AM2A 3GDQA 4BRMA 3A8YA 3QEVA 2A1JA 1VRTA 2BDUA 1ZQJA 1HRHA 2P9IB 2GH1A 4J03A 5AQJA 3UXOA 5C2FA 5AI5A 4C1NI 1XC3A 4KLSA 9ICFA 4CRXA 2AHOB 1IKWA 3KK1A 3IP4B 1BCMA 3ULDA 2DKXA 3QEAZ 2ZIWB 4ECUA 1TVAA 5BOLA 2H3GX 2QA4N 4LFAK 4UARA 4CGGA 2WFAA 3WK6A 4OKKA 5ALNA 3TADA 3CRXA 3DLRA 4DTRA 1MQ3A 5J2NA 4I2GA 3ALRA 2FBTA 1A6SA 2H3VA 1W7AA 4YP3A 1O03A 1SXDA 4NXZA 5EOZA 1D4XA 3TI0A 4ISGA 3OYHA 1VQ5N 3R1XA 2QARA 2RF2A 2WF8A 2EHGA 3MAQA 3DLBA 1SGGA 4DV7K 2AP1A 3TFSA 5L9XA 4EYIB 5EOYA 3Q8KA 1RZTA 1VJ5A 4R63A 1RXWA 4LF7K 2VJ4A 3IG5A 3C6UA 3UE5A 4GW6A 2I6XA 4AILC 5FRMA 5AQVA 4IOXA 4DS4A 3DRPA 1KAXA 2E8MA 1ASUA 1RBRA 1S9EA 5BR8K 2OTLN 1YIJN 4LSNA 4YOYA 9ICKA 4FWSA 4CK1A 2H3ZA 4RQ6A 7ICVA 3OYAA 3D2EA 3O3FA 1X9JA 2W7OA 2RDJA 3VGLA 1COOA 1I94K 5AI6A 2XY8A 2A6AA 3QFUA 4Y2RA 1OKJA 3ZT4A 1LAVA 4ICAA 2F8KA 3GIKA 4FLVA 2E8PA 3OTQA 3QMLA 3QZ7A 4NLKA 2W41A 3R9PA 3TTFA 3O3HA 3AVGA 5DMRA 3OS1A 3IRUA 4B1YB 2IS3A 1ESVA 4I29A 4IRKA 2KFNA 1S10A 5M1FA 3KHHA 1WCNA 3DOKA 4H0TB 4YOVA 3ZDDA 4ELVA 4ZTFA 1IG9A 4NCBA 2ZUDA 1ZQHA 4XEIA 4DV0K 5HLFA 5AQSA 1NK8A 4IEIA 3OYIA 5AQWA 1IV0A 3WK7A 1XSNA 3F9MA 1S0MA 2AQ4A 1RXVA 3ID6A 5AI8A 3C2MA 4G9BA 3SAFA 2P9KA 3C7NB 3O08A 4RW7A 4YDUC 4CEQA 3NTUA 4F4KA 4CF5A 2HNDA 3J8AA 1WCLA 4CEDA 4CJPA 3RMAA 1NGEA 4YR2A 5KG2A 3NFAA 2VA8A 4Q5VA 4FL9A 3RFAA 1K73O 3ISBA 4CJ7A 1ZBUA 3NGIA 3ZDCA 2HSTA 5AQTA 1NJIO 2KLAA 4QZAA 4UY8O 4GKKK 4Z0UA 5KFGA 5HMLA 3CYMA 1NBWA 2YNHA 3M6KA 1ZQTA 9ICOA 3ZT2A 3DDHA 4U6PA 2HOQA 3HTVA 1Q86O 1L7MA 2A40A 2EZYA 1IJJA 3U4LA 3M8PA 4MFAA 1Q9YA 2ZQBA 3SJHA 3CI5A 1OW5A 8ICTA 2ZJ8A 5F9NA 1BIUA 1IBLK 1QQ7A 3C0BA 3CFRA 1DTQA 1WSIA 9ICLA 2ASMA 4KLOA 4BE1A 2JWLA 3HWTA 1SXEA 1ZQ1C 2RPIA 4IS7A 2YJEA 2HBKA 4Y2TA 4DTXA 3ZDAA 1JX4A 4GKJK 4FJMA 2I5HA 1S0VA 1JIHA 3LPUA 3NGYA 4WCEL 4B3MK 3J7ZO 2YKNA 2ZJ5A 3QB0A 3PMNA 5DGAA 7ICSA 2W9MA 3KK7A 3N4PA 1WAJA 3TACB 1RDUA 4N5SA 4O4GA 1HUXA 4KX3A 4QWBA 1RBVA 4N56A 2BCUA 1B43A 4PHEA 4HUEA 4C8OA 3H4DA 4CFCA 1XS9D 1MDUB 2ZF5O 3ISDA 1RYSA 1HJPA 4NB4A 4EHTA 2IOCA 4DS5A 1W97L 2X74A 4KAZA 4DFDA 3K5NA 1NK0A 3NVVA 1GO3F 4HTLA 1IM4A 5DB9A 1N56A 5KT3A 1YHQN 4JI2K 2C2RA 4FLXA 2Q2RA 1FFVA 4O9MA 2VCPA 2QKBA 3SJJA 4YMMA 1BG3A 2JHDA 4I27A 3NE6A 4CJSA 4DCHA 5ALFA 4FWNA 3WKCA 2A1AA 3H6EA 4DTNA 4FBTA 3VEWA 1BVSA 5C10A 3N97B 3GIJA 2ASPA 5KG4A 4PGQA 3Q8PB 3BDPA 5C25A 4QZIA 3BS5A 3BQ1A 3THVA 2D6FC 5DB7A 4CF1A 4DV4K 1NK6A 1QSSA 2WC9A 2RQ5A 4C0ZA 1RT3A 3T19A 9ICUA 4PGXA 3DV9A 4IQVA 5DG8A 2BDPA 1J6ZA 1NGFA 1YVNA 4OD0A 2FBXA 4JD2A 4CEZA 4PHTX 4LF9K 2G8VA 4QZHA 1U48A 3QBWA 4G9ZA 4CJRA 4QZBA 2ASJA 5CY4A 5ALKA 3RB0A 2FI1A 1NJYA 3MDAA 3BEXA 3NDKA 3UM9A 3G6YA 4ECXA 1NKEA 3A0IX 3O9SA 3UB5A 2ITGA 2AA4A 3MCAB 2HB5A 3FFKB 5AQNA 2G0AA 3SMPA 4CF4A 2KG5A 1J2MA 2PI4A 2YN4A 1C1BA 3MR5A 1MQ2A 3AA4A 3H08A 4FYDA 2HHQA 4FWPA 4C8LA 1ZQBA 4JKBA 5HP4A 4DQPA 4JRQA 1NK9A 2IVNA 2XY7A 2P1JA 3VPZA 1N61A 4ED7A 4BVOA 4CJQA 1QQOA 4IKFA 5KGXA 1BOTO 3AA3A 1BI4A 3Q8LA 1KSPA 5DB6A 3KJVA 3CP8A 3E66A 4EP5A 1K1QA 4BXOB 2X6SA 3D2QA 3MXJA 4FWKA 4CIGA 3THWB 2JMGA 4KLTA 2YJFA 3SENA 4PHAA 4PY5A 2YMMA 1VQNN 2IMWP 4E7KA 4RQ0A 2YQEA 3MFHA 1RT1A 4KN7A 3J7YP 2PFPA 5CZ1A 1QH9A 3TADC 4IWVA 5AKGA 2XIDA 1K8KA 2CH6A 1N60A 1KLMA 4K25A 4AHSA 4F71A 5EWGA 2E6MA 3NCIA 3QINA 1RYRA 1TL1A 2KJ5A 4B8AB 4YOWA 4XQ8A 4LC9B 4QNLA 4YCXA 5AQZA 2HHUA 3HL8A 4CJ5A 2W7PA 4C1NK 1FFUA 1QTMA 2LI6A 4DV6K 4PZOA 4FO0A 5KFLA 2HHHK 2ZIVA 2P9KB 1AQ6A 5KT6A 1LCUA 2W40A 3QLHA 1VQ8N 4YXMA 2J6TA 1N5XA 3CC2N 1NZPA 1QVFM 5DBBA 3VQ4A 4CJWA 1WWUA 1IH7A 4KI4A 5GINA 3WNHA 4ED3A 1ZBLA 4FZLA 1PZNA 4C4TA 1ZQQA 2KNJA 2JEIA 2CH5A 3HP9A 4BQZA 2GELA 2N1RA 1DTTA 4CZKA 4B1VA 4DSLA 4LF5K 4CW7B 1KFDA 5DGBA 4M63C 4FK4A 1TUUA 3PSIA 3VF6A 4ACOA 4M04A 1KAYA 1B9DA 4DL4A 4J9KA 1ZQYA 8ICEA 4MDAA 2F9TA 3SBTA 5KFCA 1U47A 4JKHA 4DKWA 1NG9A 3AGKA 3IAYA 2VYPA 3N28A 2K8BB 1B4FA 3HOSA 1SIJA 4CHQA 3MN6A 4OGEA 1GOBA 5CHIA 1NJZA 1S6QA 3CCUN 4LFCK 4NLGA 4M7YA 1H38A 1RBSA 3O0FA 1U49A 4X66K 2OYQA 1QSLA 4YMOA 3MCPA 3CCMN 4CGHA 1KN5A 2UVWA 3L3VA 4X64K 3RH5A 1T03A 2W03A 5MLCQ 3D6RA 2P9SA 2Y9UA 4CGJA 4E7HA 4ELTA 3TWHA 1QE1A 2ZM6K 3SQ0A 3BQ7A 3RTVA 2C2DA 4BQLA 5AZIA 5EVZA 1VAZA 3IUCA 4OPKA 3KLFA 3K1ZA 2VG7A 5DG7A 4A62A 2ESEA 5KQ8A 5KT5A 4M41A 4M3ZA 4B9VA 3Q8MA 3RJFA 2GWJA 3I56N 5CR4A 5ALMA 3A5MC 5D3GA 3D6JA 4V19S 4KLEA 2OPRA 1BCOA 3IMXA 5I42A 4QZCA 5KTQA 2DUYA 4FW2A 3KLGA 5AKKA 5L1IA 3T1YK 5BPCA 3L2QA 2OA8A 1VDVA 2BZFA 3D45A 4CIEA 2F44A 4ZOHC 9ICGA 3CERA 4BRPA 9ICAA 4NJ8A 2VA3A 3K5OA 4K4HA 3BF1A 3MN7A 3KLEA 2VGNA 3ZX3A 2WAQC 3PVXA 7ICHA 1DT9A 4DUZK 2WOMA 3EKSA 4HUFA 1Q7YO 3FC4A 3M5RA 4WF9L 8ICCA 1UHUA 1T94A 5KG3A 4X5VA 5KG0A 1C1CA 3ENBA 5KFHA 2D0OA 1J97A 3VQ6A 3WXMB 4RUAA 1D9FA 2IHNA 5CRXA 9ICJA 4H0YB 4AHCA 5TKYA 1W0HA 2ISOA 2IDOA 1RTHA 1WWVA 2XGQA 4J9NA 3MR6A 3OHAA 2YX8A 4DFPA 3L2VA 2Z1JA 2R7YA 2NRHA 3OHBA 4F4XA 3HPGA 4JN4A 3E9LA 3VQ5A 4ECZA 3VQCA 4FLZA 4BRFA 3THYB 3QICA 2KD1A 4CNQA 4FM2A 4YR0A 1K1SA 3LP1A 5FDLA 1M1KO 1Y97A 2IC3A 4BRGA 4BDPA 3FE1A 1VQ6N 3LVVA 3TTDA 1S5JA 2VG6A 4HHTA 3QBXA 4Z6DA 4JKCA 3ZSQA 1WB9A 5HRSA 4MFCA 3P38A 5AQFA 5DLFA 4I2HA 1SV0A 1ZQPA 1D8YA 4Y2YA 1NI3A 4JK9A 4YR3A 4DLEA 4QW9A 4YNQA 2PMZF 4OKJA 1BDGA 4KN4A 2FC0A 5F2RA 2GWKA 3ISCA 1BI4B 3O5BA 5AKJA 2P9NA 1EWQA 3DLGA 4MLHA 4HCBA 2H5XA 4BDZA 2PFOA 1WLJA 3QUCA 3V6HA 2O8BB 3M1FA 1B9FA 1KFTA 1WSHA 4CJVA 8ICAA 4E7LA 1YT3A 3F2DA 3I8DA 4DTMA 3KZXA 3C2KA 2WFBA 1WNSA 5FPNA 2QTDA 2P9UA 5FPEA 3CC7N 2PKEA 4KBOA 1EO1A 1RGIA 3ZETB 3MX5A 1ZQOA 4GV3A 4H5TA 2E8NA 3C1YA 2FSNA 1F5SA 3CQYA 4YQWA 1QZ6A 2MU2A 5J2GA 1A5XA 2FMPA 3MEEA 2Q0RA 1RM6C 4OPAA 3SUOA 2I1QA 3DAWA 1KL9A 4M2YA 2ZJQL 2P9PB 5AQKA 1RTJA 2LSNA 2A5XA 4C4RA 4FOIA 2WTFA 3UMGA 9ICCA 3C6TA 2OTJN 2UU9K 3IS9A 5HBMA 3UQ2A 1C0TA 3DXKB 4M3RA 4EP4A 2EDUA 4O3MA 4RT2A 8ICJA 4LF4K 4O3OA 4DL2A 1RDCA 4IFEA 2G8FA 5KFTA 1D5AA 4JI6K 2VA2A 2O4GA 5KFOA 4JB3A 4KKOA 5KNIA 3Q8QB 5AQPA 4DV3K 4R66A 4O3NA 4DQSA 3CPWM 3R9KA 4RQ2A 3CJ9A 5J2BA 5CJ7A 1UWBA 3ZEUB 4P0QA 5J2CA 2O8CA 1ZXOA 1Y64A 4KTQA 3V6DA 2W42A 3QESA 2P35A 3S41A 4XH4A 3I1YA 4Y2VA 5DBAA 1YTUA 1KW4A 3UQ0A 1Z6RA 3NVMA 4NXNK 3J81O 3OYNA 4P4OA 5EWFA 3M9MB 2HI0A 4A2AA 2F8SA 2JLEA 2KEYA 3LM9A 3UXPA 4CF0A 5GAHP 4CBXA 7ICKA 1HNZK 2R8HA 3QXGA 1HYZA 4IZ9A 1NWKA 3M1YA 1BA1A 3L5KA 4JI7K 5AICA 1NGGA 3C28A 3ASMA 3HM9A 8ICZA 2IIRA 3LP3A 4F50A 4O5FA 3RJHA 5BREA 1NOMA 4B9UA 3P4IA 2HDOA 1L7OA 2RKIA 4MLEA 1X42A 4RCHA 4DG1A 4EIAA 2YNIA 2KP7A 3PW5A 2GTDA 2QKQA 3D2NA 4OJPA 1J2NA 1NK4A 1WUAA 3OBWA 2F1HA 4JUZA 2C22A 2QK9A 3WEEB 2BHNA 4DB3A 3T5JA 4CD1A 2W04A 4J9OA 1HQUA 2E2QA 1XHXA 1P90A 4CJEA 1D9DA 2MA1A 4RQ7A 5KFUA 1HUZA 1KDHA 1ZJMA 1ILYA 3RAQA 3IDHA 3MECA 1OVQA 4B1ZA 5E41A 3BZCA 3AO2A 1TAQA 3LWLA 3MN5A 1Q82O 3C5GA 3I33A 3RMDA 1N36K 2DFEA 3HBTA 2PXIA 3OHRA 3RWUA 2B6AA 3OYEA 3PO5A 3GFKB 4CEAA 5ALWA 4CZGA 1T05A 3GOIA 4JV2A 1RDAA 2UVVA 2X6NA 2IAJA 2ZUCA 3SMVA 2KHQA 5J0QA 1RNHA 4F9OA 3FFIA 1BIZA 1HYVA 3H8MA 3M8SA 5EE1A 2W9CB 2VG5A 2VWJA 2VGMA 3TPQA 3G10A 5AM4A 1U45A 3SUNA 3SR6A 5DBCA 3SYZA 3KFUF 4XH5A 4DR2K 3RMBA 1QQNA 1JRPA 1HKBA 1V38A 4WE1A 4FK0A 2DFLA 4JWMA 2AH5A 4CFBA 5KFQA 4G3IA 4LH4A 4RT3A 8ICNA 4JRPA 3F9KA 3UKRB 4E7JA 1XO0A 2LYAA 1BA0A 3THXA 2GBZA 5KFZA 3SPYA 3TAPA 2RHKA 2I7NA 4CZMA 1DK2A 3O9RA 1NK5A 4M9NA 4N47A 4Y0WA 1C0GA 1LW2A 2W3SA 4F5RA 5DK5A 2BCRA 1SKWA 5AI4A 4A2BA 1ZQNA 2QWQA 1ASWA 2BANA 3AQFA 3FR0A 3V4IA 2K4IA 5AHXA 4K4IA 4H0PA 5JICA 3O9UA 3VETA 2VQFK 4CZEA 4RPZA 4FPBA 3EE8A 4O3QA 3SEIA 4NL9A 1F44A 1YVUA 4A5AA 5AKZA 2A1RA 1TAMA 2A42A 3LZJA 5GTIU 3MK6A 4RNNA 3E0FA 2WHEA 3EN9A 2DF4B 1RT5A 5H1SQ 5AM0A 4EX7A 2QI2A 2YV0X 4AH9A 3WU2U 5KFXA 2Y0SC 4DV2K 2GX9A 3GV8B 1QQ6A 1ZD2P 2CN1A 9ICVA 4PJ0U 1DLOA 2QWPA 2EAPA 2QWLA 1BNPA 1TL3A 3AVCA 3AVAA 3TABA 5J0PA 4X65K 3FLCO 2R8KA 4H5WA 1IKXA 2YHAA 3ZSRA 4CK2A 4DMNA 1JKHA 1RDDA 2NNWA 3HT3A 1X9WA 1LWFA 4G1QA 2IOFK 2G8HA 3NBPA 1C0MA 3RJEA 3KK3A 3L2UA 4FOEA 4M6WA 1GLFO 1SV0C 3DLKA 2W3RA 5ALUA 4FZXC 2ATQA 3ZD8A 3AGRA 2RRDA 3ETLA 4ECTA 3LAKA 4FBUA 5JVHL 3H8SA 5KFNA 5LL6Z 4DO9A 1VQ9N 3NH1A 3ZX0A 5AQOA 4KLMA 4DFJA 4DSKA 2YX6A 1S3XA 3FZMA 1PVRA 2BE2A 9ICQA 5LJVA 4UBCA 3CQ8A 4M3YA 1S1VA 2XRIA 1RYUA 1N5YA 3AVFA 2B0CA 1ATRA 3CMEN 1S6PA 4UAYA 3H3NO 3QIPA 2O8CB 3JAMO 3E2EA 3T5KA 4K42A 2JRZA 3F5AA 3CFOA 3VQEA 5HMMA 4E1JA 5C15A 3SMSA 2V7YA 4CZLA 4CIFA 4Z4EA 3KD5E 4M3XA 4CEEA 4E1NA 1DKGD 4IDKA 5AQYA 4XIUA 3QO9A 2Q31A 3OA9A 1ZQIA 2ZTDA 4IG3A 4B3SK 4RQ4A 5KFMA 1QLNA 2HVIA 2W55A 1JL2A 5TISU 3RJGA 2VIXA 4O3SA 1CXQA 5AQHA 1ZQCA 3H4BA 8ICHA 3KBBA 5ALXA 2OANA 3F5TA 3EY1A 3WNFA 3I28A 3ENHA 2E5SA 4J9RA 4K41A 1KCFA 3JPNA 2NRZA 1P8ZA 3K57A 5J2QA 5E79U 4DR4K 4QWCA 2V9WA 1ZETA 3RJKA 3B9JA 3PR4A 4JHDA 1Q9XA 4HCCA 5J0OA 4KV8A 4ED1A 5IT9O 3JPRA 2E20A 3HI0A 1S1XA 5E26A 4BG9A 4B3RK 4Z6CA 2FPLA 4ILGB 5C2DA 9ICIA 4E89A 2JEFA 1K8AO 1VQLN 3MABA 3MX2A 4QWDA 4FWRA 1JJ2M 1S22A 1XQSC 1UAXA 3EPGA 4ELUA 5DKWA 4FJNA 2KHVA 1O08A 2KSOA 3EW9A 4M47A 4UQGA 1SS6A 3HK2A 4US8A 4FJ9A 2Y1IA 3WXKA 3LDSA 4FW1A 2ZTEA 1PK1A 3HX0A 2GWSA 3V9XA 5KFEA 1X40A 1KEJA 1ZQFA 2FSKA 2VWBA 4B9MA 2HMPA 5TZVA 3O80A 2F9WA 3QUTA 4JMUA 2QWRA 1S5LU 4TQRA 1KRPA 5IIJA 4JS4A 1RBTA 4A5BA 3B8AX 3NASA 1RPLA 4I9LA 3DWLA 3B0YA 3F2CA 3ITHA 2Z7JA 2MUTA 3AN1A 3ZX2A 3DMJA 5KPTA 3UMBA 5AM1A 5DDMA 1QCKA 8ICPA 5ALQA 2WB1C 4IBNA 2F1IA 3CNHA 5JLHA 2ZJRL 1A0PA 4CJFA 2OPSA 2KTQA 3ZLJA 3LYSA 1Z00B 4AP9A 2PI5A 3LWMA 3HJFA 2W43A 2LMRA 1VSKA 2F76X 2O8FA 1ZQUA 2JEGA 4MFFA 3UMCA 1SV4A 3AVJA 4QZGA 4BR4A 4Z4IA 2KE7A 3K9JA 1ASVA 4RU9A 1TK8A 4QW8A 4GXKA 1L6NA 1JMSA 2ZJAA 4C8NA 4PL7A 3V81A 1ZQDA 4EENA 5JVGL 1S9GA 4FZYA 4OO1J 1ZBHA 4P0PA 3VQAA 3CW2C 1BO5O 3FZFA 3AO5A 2D5RA 3BP8A 2BGWA 3RJIA 3CJBA 1JUDA 5JTIA 5KI6A 3FDSA 3IG1A 3NRWA 4BC3A 1BNOA 5ALYA 2ZIXB 5ALDA 1BWFO 4E19A 1IKYA 2K4EA 2HMXA 2NRWA 4CHOA 4AYBC 1W9HA 5HRPA 4NCAA 1DGSA 3C95A 3B6OA 4JKGA 1XSLA 1JLQA 4I2QA 4K43A 4RW8A 1SQKA 3QUQA 2WAQF 3UPQA 2QXLA 4KI6A 4UB4A 4UBBA 1L7NA 4FVMA 3ZSYA 1RBUA 3KKRA 2V51B 3JXUA 4AQYK 2MSNA 2AGPA 3KVGA 4LF8K 4DV1K 2R18A 1SL2A 2XC9A 1N34K 2K8AA 3BF3A 4FK2A 3VQPA 1I3AA 5BPNA 4I2JA 3LDQA 3D7EO 3PW4A 2BPFA 3KKAA 2OHFA 1JI7A 3DJCA 3SBGA 2UYTA 1XI1A 4KITB 1BPYA 4BROA 3OS0A 1LKYA 4NYFA 2CGKA 1S0NA 1Z1VA 4DSEA 4PPXA 2Q1NA 4PL2A 1WOQA 1LB2B 1RCHA 9ICTA 4QZEA 1UOCA 2CGLA 1C1AA 2Z1GA 4DR7K 2A1JB 1I39A 4QS8A 4AM7A 3N7SC 3L2WA 8ICVA 4OPJA 2GOLA 1GOAA 3O3GA 1SZ2A 5G5GA 4NLBA 4DF4A 5ALIA 5JUMA 8ICFA 3I76A 3HJEA 4IQUA 3ALYA 4IG0A 4J8FA 3NVKA 2E4LA 8ICMA 1ATNA 1TGOA 5IILA 2BGGA 1NGAA 4O5CA 1U4BA 2D8CA 4NL9C 2FPKA 1U2VA 2B5JA 5AK3A 4H0OA 4PHPA 3PV8A 2K60A 3QDKA 4DL7A 3VENA 2QARB 4BE2A 3S6JA 1S72N 3O6WA 4CGIA 4B6JA 9ICBA 4PKGA 8ICBA 4USAA 5L1MA 4JK7A 4YOUA 3WT0A 3OYCA 1X6JA 4J9MA 2WTUA 2V7ZA 3M6GA 3VQBA 3ZT1A 4H4OA 5C24A 3DRRA 3T5HA 2HBLA 4J9LA 1BHLA 4EBDA 2KQ2A 2YHYA 2D3DA 4WFBL 2L5YA 4UB5A 2Q4TA 2UXDK 2FBYA 3V7JA 4IQTA 3S3NA 4JHDB 3W0LA 1C7YA 8ICRA 1ED1A 1ZQLA 3R3LA 3SQ2A 2ZIUA 1NMNA 1DGKN 3D2EB 2MRLA 2LM1A 2UXBK 2HF4A 3KHRA 2OEHA 3T5LA 2E2PA 4I7FA 5JLFA 5HHIA 1KXPA 4M3UA 4ISFA 2A3VA 1TV9A 1IXRA 3JYTA 3AO4A 3SV3A 3TSUA 2KSOB 3PY8A 2ZXIA 4DU3A 3MN9A 3AU6A 1VQON 3U9ZA 3DM2A 1CLQA 4YD2A 1HKGA 3EZ5A 1OXJA 2X78A 3UIQA 1PK1B 1ZD5A 4O3PA 1VSDA 5J2DA 1OH8A 1CZ9A 3CCJN 2HHWA 1TUYA 1S9FA 1QVGM 3SAGA 2OWOA 4HAIA 2ODGA 3M8QA 1HMVA 1SUQA 4FJJA 1Z25A 2F96A 3C21A 3M9OB 1NOZA 5KAFU 4B9NA 5M1OA 5ALVA 1NZBA 3DXMA 2O8DA 5AZJA 5FPMA 3B0XA 1S77D 1EX4A 5D4BA 4DTJA 3KWGA 3ONNA 1N2XA 3CCLN 3V9WA 1WSGA 8ICLA 5HL7L 5AQLA 3WK8A 4FJKA 1E4GT 4M3TA 2NV3A 1IV8A 3T7ZA 2JH7A 4DL6A 3WK4A 5ALEA 4CJ3A 4BWMA 4OJRA 4FJXA 4DR1K 4Z4GA 4MDBA 5BPLA 4UB8U 5JMVA 2K8CB 4UAUA 3WXJA 3H1VX 3CHWA 3KLIA 1NGJA 1YUWA 2G08A 2NRTA 4TUSA 4IRDA 2AJQA 1VSIA 2NRXA 4JI1K 1COKA 4PQUA 2KJ8A 1BUPA 5AR0A 4BRQA 4FJHA 7ICQA 1B92A 3NVYA 4IJNA 4ICLA 3V1OA 2DL0A 3QERA 4KH6A 1MWKA 2FLOA 1T6DA 3Q7BA 1JLBA 4IL6U 3RH6A 3KHLA 2KIVA 5ALHA 3K0SA 3SNNA 2V4QA 4LY7A 2W54A 3UXNA 4W5TA 3RJJA 2QEXN 3G25A 3RF9A 2BR0A 1LV5A 2QWOA 3HZ6A 4F4YA 4IFVA 5K4LA 2FDRA 5KFJA 2KMDA 5KFSA 3BGRA
chains in the Genus database with same CATH topology
1X9MA 3MDQA 3CXCM 1QZ5A 4UAWA 3PO4A 3FZLA 5J2AA 3E9PA 4JKDA 2NRRA 3N4MB 4O5KA 1ZQMA 3RB3A 5AQXA 4RQ5A 4FVUA 3JPTA 2WUSA 5J29A 1ZQWA 4PGYA 2FLPA 9ICSA 4KLQA 1KQSM 3N4QA 3O4WA 1Z3EB 3L4QA 2A41A 3QZ8A 2E88A 3FYHA 4DWIA 2KFZA 4IXCA 2P9LA 5HNKA 4JNEA 1TYQA 3FGUA 4Z6FA 2F7TA 4XA5A 3GL1A 4WFAL 1HKCA 3BQ0A 1U2VB 2BQUA 5J0TA 3PNCA 2FPMA 3RVCA 4JD2B 4R8UA 1ZQZA 4BRHA 3L0QA 4JV0A 1XC9A 8ICSA 1OVYA 3VOVA 3CC4N 1ZC6A 4BRIA 4C8KA 3WQTA 1ZQSA 4R65A 4ECWA 4AF1A 2YI1A 2W9BA 1T7PA 2FXUA 4L3QA 3EKUA 3W3DA 1GLEG 2HOEA 4JAXA 3OW2M 1SL0A 4OPHA 1NGIA 1YXQA 2BCVA 4EBEA 1H1VA 4EZ9A 3KTQA 4RWTA 4MF2A 4I2CA 4RNOA 4JKAA 4F91B 1XO1A 8ICYA 4FS1A 4I6MA 1K8KB 4O5EA 4PH5A 4C23A 4FO6A 1VQ7N 1BPDA 2KZ3A 5EXWA 4J9PA 2GEMA 1V9PA 3RRHA 4Q44A 4IOCL 2F1JA 3ULEA 3MR3A 3M3ZA 4RTFD 3CCEN 4MEYA 3QE9Y 4JKFA 2ZTCA 1VQKN 7ICFA 3C2LA 5DQIA 1BPEA 3LDLA 4HYKA 1YJWN 3PR5B 3IFRA 5IIOA 4KLJA 3H3OB 5AQMA 1VQPN 4BGBA 2QWMA 1NGBA 2ASOA 2YHWA 4F93B 4NM1A 4J9QA 4GC6A 4ECSA 3O9QA 7ICPA 4F2RA 4IQWA 7ICRA 2KKZA 3AARA 3BJYA 1HLUA 2XY6A 3AU2A 1L3SA 3KZBA 1W2BM 4DQQA 1ZQGA 3ATUA 3RBEA 2P9SB 1QHAA 5ADXH 2BQRA 3MGIA 5KFYA 1T3NA 4A61A 4CZFA 5AZIB 8ICXA 1U9LA 4DFMA 4WQ4A 4BRCA 4C8MA 1GLBG 1ZYQA 5HHHA 4CZJA 2BQ3A 2FMSA 2FF6A 4KLDA 2HVHA 2QM1A 8ICUA 1XWLA 4MO4A 4I2AA 1D8LA 1QQMA 7ICIA 4BRDA 4DF8A 1O13A 4ECYA 9ICRA 3V7KA 3NMUA 1X9SA 3VEZA 5IINA 2A3ZA 2P9LB 7ICTA 3RR8A 1TYQB 4CD3A 7ICEA 2YHXA 4GVEA 1L3TA 7ICJA 2AGOA 5CE3A 5CHGA 4Z6EA 5M1NA 3TTCA 4Q8FA 4QWEA 4IJAA 7ICGA 4EFHA 3V6KA 4YOXA 2ITMA 2PFUA 4HWIA 3TQ1A 3A5OC 4I2FA 4NM2A 3SLCA 4UB2A 2W8LA 2J6UA 1NJXA 5L1LA 4UB3A 5KFRA 3C7NA 4KLGA 1ZQRA 2E1YA 4J9SA 2P9NB 4LZDA 4DOAA 1GLDG 1XSPA 3IM1A 9ICNA 5IIKA 4QS7A 3RR7A 4BGAA 2J6SA 4ECQA 3CCRN 4KLLA 4TURA 2P9UB 4I6MB 1T4GA 3D2FA 2WBNA 3GG4A 3RBDA 1HUOA 1SZPA 1UA1A 2XGPA 3H1QA 4YG2A 1GLCG 1GLJO 2HW3A 3SI8A 1R59O 4DOCA 1NLVA 3RB6A 4EAHD 2P6RA 1X3NA 2JEJA 5J2EA 1SL1A 1V4SA 4LZGA 3CIPA 4H0VB 5M1QA 3TU5A 2ZGZA 3MMVA 4NLZA 4A57A 3GV7B 3VF4A 2M9NA 4YXJA 1JCFA 4BRNA 4IR9A 4FWOA 5IIIA 5CA7A 3G6XA 5CWRA 5BN8A 1QSYA 5KFAA 3PW2A 1NM1A 1M90O 5KT4A 3IHQB 5J0SA 4DHYA 3I55N 3RSEA 1E4FT 4ILHA 4KH5A 3EYZA 2QW9A 3G4SN 1YI2N 1YJ9N 3C5FA 2ZUBA 7ICNA 7ICUA 4XH1A 1XU4A 5KFBA 4O8KA 2ISPA 4RZRA 2IVPA 5KFFA 1Q81O 4YVZA 5LJWA 2UVRA 4MEXA 3O9TA 4DQIA 1YJNN 1SKSA 3H8WA 1K9MO 3WQUA 4BREA 3LDPA 1L3UA 1JXLA 2HHSA 2PAVA 4B9TA 1ZQAA 4QZ9A 4RPXA 4M9HA 3MBYA 4WQ5A 5AQRA 8ICIA 3RRGA 4KH4A 1KLNA 4H5VA 3GDXA 1BU6O 3R6MA 3GE1A 3WXIA 4M9LA 9ICHA 1IG8A 1HJOA 3GQCA 5KFPA 2IA6A 5GIOA 4BXOA 4Z94A 5M1KA 3JS6A 5GADP 4P2HA 5KG1A 4H03B 2UVUA 1KTQA 2FLNA 1CZAN 4RQ8A 3HOTA 4IR1A 4WQ4C 4GXIA 4CBWA 3MWTA 4BC5A 3BQ2A 1GLAG 2V4RA 3VGKA 4ECRA 5GIPA 1NGHA 5J2IA 2FMQA 4GV6A 4H5NA 3R8EA 5M1PA 1MSWD 7ICLA 4F5OA 4ISEA 4BG8A 3GILA 2BCQA 3VEOA 5DQGA 3GBTA 4QWAA 1VQMN 3HP6A 3K9KA 2Q36A 1NMDA 4BRAA 3MFIA 4DOBA 4M9GA 2P6UA 5C12A 1CUKA 5CP2A 3D2FB 5CR0A 3VTIA 3PLAA 3JPQA 3CCVN 3E9OA 4BRLA 3V6JA 5D49A 3P39A 3QFPA 9ICMA 3RB4A 3CF5L 4B1UB 3VEXA 5J2FA 4MO5A 4EYHB 1TK5A 1XUPO 1S0OA 1Z05A 2C2EA 4M6WB 2Y1JA 4R79A 3H8JA 5KG7A 4PL8A 3CD6N 2B21A 1ZQVA 1TKDA 8ICWA 2P66A 3CMAN 2ASLA 2PFQA 5AFUH 4RQ1A 4RUCA 3ATVA 3RSEB 5ELZA 3M9NB 5KFKA 5KQDA 4RQ3A 4E0DA 3OBYA 3PIPL 2GUPA 5F0XA 3PX0A 5DLGA 1Y88A 3T3FA 4DL5A 2KZMA 2JZBA 4BR7A 4F4WA 3WXLA 3JPOA 3RAXA 4BC4A 4NO7A 1S76D 4F5NA 4FWLA 2KHOA 3GIMA 2KN7A 4O8UA 4U7BA 2BUPA 4F2SA 2HF3A 1A77A 3TSPA 4TUQA 3P31A 5DM7L 5BRDA 4GXJA 4U67L 3BUZB 4F5QA 7ICOA 4CZIA 2E1ZA 4GC7A 4PKHA 3WUHA 3CCSN 4DFKA 5KT2A 2I7PA 3H45C 1G99A 3PW0A 3MR2A 2BCSA 1YF5L 3CJ7A 3C6AA 5DDYA 4FWQA 2ALZA 2XCAA 3OGUA 3VERA 4XRHA 2ZJPL 2BKEA 1ZQXA 2AGQA 3H46O 2MUTB 1JCEA 4B9LA 3PX6A 2PBDA 4DLGA 2QWNA 4WFNL 1VQ4N 2XO7A 2J4RA 3MWPA 4FSVA 4O3RA 5ADXA 4DSJA 3ZETA 2FF3B 3TANA 4KLIA 5BRFA 4DSFA 4LVSA 1A76A 3RH4A 2D4WA 2KZZA 3TFRA 5BOMA 4F5PA 4A59A 3IKMA 3U9DA 1ATSA 9ICXA 4WQ5C 4ED0A 3HW8A 3PW7A 1TFRA 3EWAA 4AM6A 5EWEA 5F1XA 2P9PA 5J0RA 4Q45A 1BGXT 2BTFA 5LY3A 4EZ6A 4YOTA 3LM2A 4GY2B 3ZD9A 4JKGB 5IIMA 3DXKA 1DEJA 3QEBZ 5BR9A 4DSIA 4B1XB 4EHUA 4H5RA 1T6CA 4BR9A 9ICEA 1EQYA 8ICGA 3DLLL 3HPOA 1NK7A 1N8RO 2BPGA 3AY9A 4P4MA 3FZKA 5DQHA 4ED8A 2FLLA 5BPMA 3KHYA 4BR5A 4I2EA 1KAZA 1UA0A 3ZEUA 4FWMA 3E1YA 1ZQEA 4O0IA 5AQGA 1ZBSA 4BY9C 1Q18A 2Q97A 3TSQA 2W9AA 1GLLO 3ZDBA 1T8EA 3EPIA 2RDIA 4M0AA 3VEVA 3GIIA 4QZFA 4ED6A 3JPSA 2ZWHA 3Q8RB 1MC8A 4BC2A 2PFNA 3L4IA 4PKIA 1BPZA 4WYBA 4CCHA 5J0UA 5J0XA 2AQ0A 5GAGP 5KT7A 1NKCA 4DL3A 4DQ8A 3WEEA 4KLFA 2CGJA 2ASDA 3UKUA 1NKBA 4ILJA 1MWMA 3G6VA 1MA9B 8ICOA 1V4TA 1HPMA 3VF2A 4CZHA 5J2JA 1UT5A 3BQTA 3MGHA 1NJWA 2AU0A 4ZH4A 2V52B 2JZBB 5AQQA 4GNIA 4QZ8A 3OJUA 4YMNA 3EZWA 1RDWX 5HOOA 2D0PA 3OSPA 5L1KA 4YN4A 5C5JA 1BPBA 4QS9A 3LK9A 3ZDEA 1T44A 1KC8O 4TQSA 5BN9A 4EEYA 2HHXA 4F4ZA 3LL3A 4F92B 2W9CA 1X3MA 4NLCA 3VGMA 3V7LA 4ECVA 4BGDA 2RE2A 3AAQA 3CCQN 1TAUA 1YAGA 3K4GA 3V72A 2BPCA 3HM8A 3UKRA 2E2NA 4BR0A 3M8RA 1N48A 3A5NC 4I2BA 5EX5A 9ICPA 3EE9A 4IEEA 5DG9A 1YITN 4F3OA 3EL2A 4CBUA 4H0XB 3DXMB 5AZJB 1UT8A 1L5UA 2JWKA 4TUPA 3KWIA 5L1JA 1KD1O 3C23A 2ATLA 2DPJA 4XUSA 1NGCA 4MF8A 5J0WA 3LDNA 5KFWA 3PIOL 3CPEA 1T3VA 1SAZA 5KFDA 3ORYA 1KFSA 4GLXA 3O1BA 4IOAL 1C0FA 3GV5B 4I28A 4FS2A 3H7IA 3LDAA 4IDHA 3AUOA 3OSNA 3O8MA 2IVOA 5GAEP 2HHVA 5KPZA 3KHGA 2BH1A 3CQXA 2DPIA 2XCPA 3ZYYX 4M9JA 3NGDA 2HHTA 9ICWA 4JK8A 2VANA 4YORA 4I2DA 1TK0A 2P9IA 5B8HA 2E8AA 4KMUA 3CJ1A 1S97A 2NLXA 2NZTA 1ZQKA 2R8JA 2R8GA 1NGDA 4UB1A 5CB1A 3Q8SB 3C65A 1RFQA 3SK3A 3SZ2A 1ZJNA 1SKRA 3OJSA 5KG5A 3VESA 3ENOA 3U8XA 4P4PA 4IO8A 3TAQA 3MDCA 3HSCA 2MAXA 4YDUA 5AQUA 3G71N 2NRVA 4KLHA 5TKWA 2D1KA 3PMLA 5AQIA 3SV4A 1JN3A 2Q0ZX 4R64A 4M7XA 3G6EN 8ICQA 4FPAA 4B9SA 3VMFB 3UKUB 3ID8A 3VEYA 5E84A 3C1ZA 4K4GA 3TARA 4R8UB 4PHDA 4JK1A 1JXEA 3A5LC 2LYHA 4RPYA 3SAHA 4ED2A 2IHMA 2W9BB 5I9EB 5KFVA 3VTHA 2DPNA 1X2IA 2R8IA 4B9QA 4BR2A 1HX1A 5EY4A 2ZGYA 4DQRA 4F8RA 3H40A 1DOQA 3CETA 1Z00A 5DB8A 2E2OA 3LDOA 3K75D 1JCGA 5KPRA 3T69A 3L6QA 5BRHA 1EXNA 5FPDA 3I8BA 4Q8EA 3C6HA 5F9LA 4EBCA 4B1WB 5J2KA 4RNMA 3HRGA 4UAZA 2I9GA 3JPPA 4KLUA 3PX4A 5AFUA 4JEPA 4GV9A 3CJAA 3EO3A 1U6ZA 2YCHA 4IO9L 2HBJA 4CI6A 1L3VA 3ULEB 5DM6L 4I2IA 5KFIA 4YD1A 5J0YA 2C28A 7ICMA 5J2HA 5C0YA 2XY5A 4JV1A 2W8KA 3O1WA 4BWJA 1B22A 4BVPA 1AROP 4NY8A 3FZHA 4YFKA 4Q43A 3Q7CA 2Q0UA 2IBKA 4DEZA 5D46A 1BPXA 3F2KA 3AAPA 4JKEA 1CEZA 3CJCA 4IRCA 5KG6A 4QZDA 2FSJA 4JWNA 2EWSA 4NLNA 4BRKA 2HBMA 8ICKA 3GDQA 4BRMA 3A8YA 2A1JA 1ZQJA 2P9IB 5AQJA 3UXOA 5C2FA 4C1NI 1XC3A 4KLSA 9ICFA 3QEAZ 4ECUA 1TVAA 2H3GX 5BOLA 2QA4N 1MQ3A 4I2GA 4YP3A 4NXZA 5EOZA 1D4XA 4ISGA 3TI0A 1VQ5N 3R1XA 2AP1A 3TFSA 5L9XA 4EYIB 5EOYA 3Q8KA 1RZTA 4R63A 1RXWA 3UE5A 5AQVA 4IOXA 4DS4A 1KAXA 2OTLN 1YIJN 4YOYA 9ICKA 4FWSA 4RQ6A 7ICVA 3D2EA 1X9JA 2RDJA 3VGLA 1COOA 2A6AA 3QFUA 1OKJA 3GIKA 3QMLA 3R9PA 3QZ7A 4NLKA 2W41A 3TTFA 4B1YB 1ESVA 4I29A 4IRKA 2KFNA 1S10A 5M1FA 3KHHA 1WCNA 4H0TB 4YOVA 3ZDDA 4ELVA 2ZUDA 1ZQHA 4XEIA 5AQSA 1NK8A 4IEIA 5AQWA 1XSNA 3F9MA 1S0MA 2AQ4A 1RXVA 3ID6A 3C2MA 3SAFA 2P9KA 3C7NB 3O08A 4YDUC 3NTUA 4F4KA 3J8AA 1WCLA 1NGEA 4YR2A 5KG2A 2VA8A 4FL9A 1K73O 3ISBA 4CJ7A 3ZDCA 2HSTA 5AQTA 1NJIO 2KLAA 4QZAA 4UY8O 5KFGA 5HMLA 1NBWA 1ZQTA 9ICOA 3HTVA 1Q86O 2A40A 1IJJA 3U4LA 4MFAA 3SJHA 3CI5A 8ICTA 2ZJ8A 5F9NA 3C0BA 9ICLA 2ASMA 4KLOA 2JWLA 3HWTA 2YJEA 2HBKA 3ZDAA 1JX4A 1S0VA 1JIHA 4WCEL 3J7ZO 3QB0A 2ZJ5A 3PMNA 5DGAA 7ICSA 2W9MA 3KK7A 3N4PA 1RDUA 1HUXA 4QWBA 2BCUA 1B43A 4PHEA 4C8OA 3H4DA 1XS9D 1MDUB 2ZF5O 3ISDA 1RYSA 1HJPA 4NB4A 4EHTA 4DS5A 1W97L 1NK0A 4HTLA 1IM4A 5DB9A 1N56A 5KT3A 1YHQN 2C2RA 2Q2RA 4O9MA 2VCPA 4YMMA 1BG3A 4I27A 4DCHA 4FWNA 3H6EA 4FBTA 3VEWA 1BVSA 5C10A 3N97B 3GIJA 2ASPA 5KG4A 4PGQA 3Q8PB 3BDPA 4QZIA 3BQ1A 3THVA 5DB7A 1NK6A 1QSSA 2WC9A 9ICUA 1YVNA 4PGXA 4IQVA 5DG8A 2BDPA 1NGFA 1J6ZA 4JD2A 4PHTX 4QZHA 1U48A 3QBWA 4G9ZA 4QZBA 2ASJA 3RB0A 1NJYA 3BEXA 3MDAA 3G6YA 4ECXA 1NKEA 3A0IX 3O9SA 3UB5A 2AA4A 3MCAB 5AQNA 3FFKB 3SMPA 2PI4A 3MR5A 1MQ2A 2HHQA 4FWPA 4C8LA 1ZQBA 4JKBA 5HP4A 4DQPA 1NK9A 2IVNA 2XY7A 3VPZA 4BVOA 4ED7A 1QQOA 1BOTO 3Q8LA 1KSPA 5DB6A 3E66A 1K1QA 4BXOB 4FWKA 4KLTA 2YJFA 4PHAA 1VQNN 2IMWP 4RQ0A 3MFHA 4KN7A 2PFPA 4IWVA 1K8KA 2CH6A 4K25A 5EWGA 1RYRA 4YOWA 4XQ8A 4LC9B 4YCXA 5AQZA 2HHUA 4C1NK 1QTMA 4FO0A 5KFLA 2P9KB 1LCUA 5KT6A 2W40A 1VQ8N 4YXMA 2J6TA 3CC2N 1QVFM 5DBBA 5GINA 4ED3A 1PZNA 1ZQQA 2JEIA 2CH5A 4BQZA 2GELA 4CZKA 4B1VA 4DSLA 1KFDA 5DGBA 4M63C 1TUUA 3VF6A 4M04A 1KAYA 4DL4A 4J9KA 1ZQYA 8ICEA 4MDAA 2F9TA 3SBTA 5KFCA 1U47A 4JKHA 4DKWA 3AGKA 2VYPA 3HOSA 3MN6A 5CHIA 1NJZA 3CCUN 4NLGA 4M7YA 1H38A 1U49A 1QSLA 4YMOA 3MCPA 3CCMN 2UVWA 3RH5A 5MLCQ 3D6RA 2P9SA 4ELTA 3RTVA 2C2DA 4BQLA 5AZIA 5EVZA 1VAZA 3IUCA 5DG7A 4A62A 5KQ8A 5KT5A 4B9VA 3Q8MA 3RJFA 2GWJA 3I56N 5CR4A 3A5MC 4KLEA 3IMXA 4QZCA 5KTQA 5L1IA 5BPCA 3CERA 9ICGA 4BRPA 9ICAA 2VA3A 4K4HA 3BF1A 3MN7A 2VGNA 3ZX3A 3PVXA 7ICHA 1DT9A 1Q7YO 3EKSA 3M5RA 4WF9L 8ICCA 4A5AA 5KG3A 4X5VA 5KG0A 3ENBA 5KFHA 2D0OA 3WXMB 4RUAA 1D9FA 2IHNA 9ICJA 4H0YB 5TKYA 2ISOA 2XGQA 4J9NA 3MR6A 3OHAA 4DFPA 2NRHA 3OHBA 4F4XA 4JN4A 3E9LA 4ECZA 4BRFA 3QICA 4YR0A 1K1SA 1M1KO 4BRGA 1VQ6N 4BDPA 3FE1A 3TTDA 3QBXA 4Z6DA 4JKCA 4MFCA 3P38A 5AQFA 5DLFA 4I2HA 1ZQPA 1D8YA 4JK9A 4YR3A 4DLEA 4QW9A 1BDGA 4KN4A 5F2RA 2GWKA 3ISCA 3O5BA 2P9NA 4MLHA 2H5XA 2PFOA 3V6HA 3M1FA 1KFTA 8ICAA 3C2KA 2WFBA