2NRXA

Crystal structure of the c-terminal half of uvrc, in the presence of sulfate molecules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 75
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrxA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrxA01
4GC7A 4JV2A 4DL5A 7ICGA 4DSEA 3IM1A 2J6SA 4MEYA 5L1LA 2XCPA 3AU6A 4EBEA 2HHXA 8ICKA 2HHSA 4O3SA 5J2CA 2KZZA 1SL2A 4C8MA 3EWAA 1ZQRA 2HW3A 4UAZA 2BQRA 5J2JA 1JXLA 5KT2A 2NRZA 4QW8A 5KFKA 3PV8A 3RAQA 8ICTA 4Q43A 5KG5A 5KT4A 4RQ4A 9ICFA 1N48A 5KFPA 8ICSA 4J9NA 3KHRA 4C8OA 3C1ZA 4B9LA 1NKCA 4PGQA 9ICVA 1U49A 4Q8EA 4DSKA 4RUCA 8ICOA 5KFOA 5J0XA 2BQ3A 2UVVA 1ZQYA 1KFDA 4KITB 3PO4A 5KFIA 4GXJA 4ELVA 4M47A 2AQ4A 5KFCA 5J0UA 4DFMA 4I29A 1ZQIA 8ICXA 3H4DA 2KFZA 4I2IA 4NXZA 3MFIA 5TZVA 4LZDA 4YP3A 3GQCA 1X9WA 2VA2A 4KLEA 4JK1A 2PXIA 1H38A 1HJPA 1MQ2A 2FMSA 4IQUA 7ICFA 4O5CA 1SKWA 4M2YA 1CEZA 2W9CB 1T4GA 3PX6A 4DQPA 4O3OA 2Q0ZX 2FMQA 5D49A 4EYIB 4GC6A 4PPXA 3RB3A 4LVSA 4UB1A 4DL6A 2ATLA 5DBAA 1NOMA 4QZ9A 1S0OA 1D9DA 4ECZA 1KEJA 8ICLA 2I9GA 4ED7A 4YR2A 1LV5A 2ASLA 4UAYA 4KLDA 2ZUCA 5KFWA 2MUTB 9ICGA 1JIHA 4J9OA 1JX4A 1ZQPA 4DSJA 2B21A 7ICEA 5EWEA 4DQIA 1KTQA 4ELUA 4KLJA 1ZQWA 4I2GA 1XSLA 4NY8A 5L1JA 3OSPA 1JXEA 3TAPA 1CUKA 4R63A 2V4QA 3T5LA 2OWOA 3ETLA 2BPGA 2BGWA 5IIKA 2ZJ5A 2WTFA 4F2SA 5KFNA 2HHQA 4RUAA 3GV5B 5D4BA 4DOAA 1LB2B 1NJXA 4F3OA 4I2JA 4QZCA 3T3FA 1UA1A 2W9MA 4F4ZA 4J9MA 2BQUA 4ZH4A 4QZBA 4RNNA 5J2AA 1B22A 4KLLA 1ZQQA 5DQGA 4P4OA 8ICHA 1S0MA 4IQTA 3HW8A 1QSYA 3PR4A 4DFPA 7ICTA 9ICRA 2C22A 3C5FA 9ICEA 1BPBA 2ISPA 2IHNA 2KZMA 4EZ6A 1BPYA 1NKBA 3FYHA 7ICLA 1L5UA 3ZDAA 5KT5A 2KZ3A 1ZJMA 1QSSA 2KFNA 2PFQA 4Z6CA 2BPCA 5F9NA 4YMOA 4QWEA 9ICUA 2KN7A 8ICPA 4YD2A 4C8LA 4ED0A 3G6VA 4I2FA 5J0PA 3M9NB 2PFPA 5KG6A 3K75D 3C65A 3RBDA 8ICRA 4B9UA 3EYZA 4JWNA 5J2EA 4F5NA 5KFGA 3V6HA 4DOBA 1T3NA 9ICLA 4O5KA 2J6UA 3THVA 3B0XA 1N56A 3PW7A 2RDIA 1NKEA 3Q8QB 4F5QA 2ZUDA 1NK7A 4UB5A 3GFKB 3BJYA 3Q8MA 2DPJA 1X9SA 4FBUA 5IILA 4CCHA 2FLLA 4IR1A 4FS1A 5JUMA 1COOA 2FPKA 4J9RA 4ECYA 4PGYA 1UT5A 3UQ0A 1L3UA 4TQRA 2FMPA 4ECXA 2HHTA 9ICKA 5KFMA 4O9MA 4KLFA 5KFYA 5F9LA 5KFXA 4RPXA 2AJQA 5KFSA 5KFZA 3RJEA 7ICNA 3MBYA 4YMMA 1BGXT 4ECTA 3Q8KA 2ALZA 5J2BA 5J0QA 1L3VA 2C28A 4J9PA 4IRKA 3OJUA 7ICMA 3PY8A 2C2RA 1ZQBA 4J9LA 3QE9Y 2J6TA 4NLGA 5KFAA 4K4IA 3JPRA 2A1JB 4MFFA 3Q8RB 5J2KA 3HX0A 1RZTA 4RQ5A 4RQ0A 4C8NA 5KG4A 3M8SA 3TANA 3QZ8A 2R8HA 2IBKA 1MC8A 2XO7A 4K4GA 9ICAA 2NRVA 4YXMA 3OJSA 4QWDA 4YCXA 5DG9A 2ZJAA 2C2EA 2KTQA 1X2IA 3ISBA 5CB1A 5KFBA 3SV3A 9ICCA 5KFDA 4ELTA 2DFLA 4UB2A 4DO9A 1L3SA 2VA3A 1XC9A 4KLQA 4ED8A 4UBCA 1S10A 4DSIA 4M9JA 2XGPA 5DGBA 4R8UB 2NRWA 4ECRA 5DKWA 1NK5A 1BPEA 4B9VA 5KTQA 5KFHA 2F1JA 1TVAA 4MFCA 7ICHA 4KN4A 3QZ7A 2MAXA 5KG3A 4PHDA 3OHAA 4ECQA 5DB7A 1KLNA 3SI8A 5J0TA 3V7KA 3RJHA 4GXKA 3N4MB 3RAXA 4RZRA 4TURA 4KMUA 4E0DA 8ICEA 4M04A 4Q45A 4KLIA 4UQGA 4B9SA 4YVZA 4YR3A 5IINA 1U47A 3JPNA 1QSLA 2BCVA 9ICWA 3C2KA 1ZQEA 5CR0A 1NJYA 2PFNA 3RBEA 1S0VA 1C7YA 2FLPA 2P66A 3MR6A 1ZQGA 4B9MA 3MFHA 5KFTA 1ZQXA 3IHQB 3SV4A 4MEXA 8ICAA 9ICJA 4DF8A 1SL1A 4UAWA 5KG1A 5KG0A 5DBBA 2IMWP 3M9OB 5KFQA 4XUSA 3JPOA 4F92B 3RJFA 1ZQLA 7ICKA 1BVSA 2HVHA 2UVWA 1EXNA 1U48A 3NTUA 4O3PA 4R66A 4DEZA 3PW2A 4IQVA 1B43A 1ZQJA 2ISOA 4R65A 5KFFA 5CWRA 4PHPA 2ASDA 3G6XA 1NK9A 3OSNA 2JEIA 4MF2A 4UBBA 4EYHB 4F2RA 3GV8B 8ICYA 2XY6A 3H8WA 2F1IA 2Y1JA 5KFRA 7ICVA 4RQ3A 3RJIA 4DFKA 1NK0A 3LWMA 3MABA 1U9LA 4RNMA 5C5JA 5BOMA 4MFAA 1U45A 5J2GA 4BWJA 5J2IA 4ED1A 1XU4A 2LYHA 1S77D 3Q8SB 4TUSA 3HP6A 4ECUA 4DL2A 4Z6FA 1A77A 5J0OA 3RB0A 5J0WA 3PW4A 1TK8A 3RR7A 3B0YA 2IA6A 3TFRA 4NLKA 4I2EA 1X9MA 2UVUA 4YFKA 3UQ2A 3PW0A 4JUZA 5EOZA 1ZQHA 4YN4A 1QTMA 9ICOA 8ICIA 3LK9A 3RR8A 1Y88A 2W8KA 1QLNA 4PHAA 2AGPA 5DQHA 5DG8A 4ECSA 3AU2A 2AQ0A 2W9BA 9ICNA 5EWFA 4DWIA 2W9BB 5KFEA 3LDAA 2VANA 3MDAA 4DS4A 4IRDA 5DLFA 3GILA 3RH5A 4PGXA 3SYZA 4MF8A 4M0AA 3GIJA 2UVRA 4O3NA 5KT7A 4O5EA 3UXNA 4RT3A 2BR0A 3ZDDA 5L9XA 4YQWA 3C2LA 4QWBA 1U4BA 1NJZA 4M9LA 1IXRA 4RQ6A 3MR5A 4EBDA 8ICZA 4GXIA 4EEYA 1ZJNA 8ICUA 3EZ5A 4P4PA 4TUPA 3H40A 4X5VA 8ICMA 1K1SA 4RNOA 4QZAA 5IIOA 4RQ2A 4Q44A 2ZUBA 3V6KA 5DLGA 1TV9A 5DDMA 2JZBA 2H5XA 1JMSA 1TAUA 4KLOA 4M9HA 4B9TA 2VA8A 2IHMA 3KHLA 4DS5A 4KLGA 4I2BA 2I1QA 3M8RA 8ICNA 1KFTA 4QZHA 4UB4A 3GV7B 2BCSA 2NRRA 3BDPA 2Y1IA 1KSPA 1MSWD 1ZQCA 1KFSA 2MUTA 3ZDEA 5KT3A 3QEBZ 4ECVA 1IM4A 4RPYA 2BKEA 1BPZA 3C21A 2AGOA 2AU0A 4I2HA 4KLSA 1TAQA 1ZQNA 1D8YA 5HMMA 4FS2A 3SZ2A 1S9FA 7ICSA 5KT6A 5KFVA 2RDJA 1KRPA 1MQ3A 1A76A 9ICHA 3PX4A 4KLMA 1RPLA 2W9AA 8ICCA 1V9PA 4ED6A 1SZPA 4QZGA 4F4YA 4EBCA 2V9WA 4M6WA 2ZTDA 4DQRA 3PVXA 3GIKA 2XY5A 3C5GA 1T7PA 4BDPA 4DSLA 7ICUA 4F8RA 7ICRA 3OHBA 3PW5A 5DB6A 4F91B 4QZ8A 4JWMA 4XRHA 5BPCA 2BCRA 4DQSA 3E2EA 3MDCA 2ASJA 3ISCA 2M9NA 1XSNA 3JPQA 4NM2A 3MR2A 2ZJ8A 3RJKA 3RB4A 1SL0A 3RJGA 1ZQAA 2HHUA 7ICQA 4JV1A 1DOQA 4RQ1A 3GDXA 3RTVA 2PI5A 1ZQSA 8ICFA 1HUZA 1K1QA 2XY7A 3C23A 4F50A 5BOLA 1TK0A 1Z00B 5HHHA 3TFSA 4IRCA 5DQIA 5J0RA 3ORYA 5HNKA 4DF4A 4IQWA 2XCAA 3RRHA 9ICSA 9ICQA 5J29A 5J0YA 3HWTA 3N97B 1Z00A 3TI0A 2HHWA 3V72A 1ZQMA 5CA7A 2AGQA 4ECWA 2C2DA 2XC9A 3OGUA 5KFUA 3JPSA 2NRTA 2R8IA 1ZQVA 4Z6EA 3MR3A 3ZD9A 5L1IA 3T5JA 2GWSA 4TQSA 8ICVA 4QZIA 4F5OA 1RYSA 4K4HA 1XO1A 4JV0A 1ZQZA 4O3QA 5DB8A 3H8JA 2ZTCA 5KFJA 8ICBA 3RRGA 1UA0A 3RB6A 5DBCA 2A1JA 4DL3A 4RQ8A 9ICPA 4QWCA 4DOCA 4J9SA 5DGAA 1DGSA 3V7JA 4O0IA 2R8KA 4DQQA 2V4RA 4BXOA 5J2DA 4RQ7A 4FO6A 4P2HA 4DFJA 3UPQA 2HVIA 3BQ2A 4QW9A 1S76D 1NK8A 2BHNA 5J2FA 9ICXA 4R8UA 2FPMA 4YG2A 3HT3A 3MGIA 2PI4A 4HYKA 3TARA 2JEFA 2P6RA 5KFLA 1XS9D 1UT8A 1WCLA 3C1YA 4PHEA 3MGHA 3BQ1A 4C8KA 4DLGA 5CHGA 3EPGA 3PNCA 3JPTA 2HHVA 1NK4A 8ICGA 8ICJA 5D46A 5DG7A 4QZEA 5J0SA 3Q8LA 2DPIA 3GIMA 4PH5A 3RH6A 4Q8FA 4B9NA 1KDHA 1T8EA 1AROP 1ZQFA 3LWLA 3V7LA 4F5RA 8ICWA 4KN7A 3C2MA 3PX0A 4BWMA 3PR5B 1SKRA 3GIIA 4FBTA 3ZDCA 5CP2A 1D9FA 4I2AA 2P6UA 4J9KA 4KLTA 4DL7A 1WCNA 4F93B 4DLEA 3FDSA 3H7IA 4F4XA 1TK5A 2FLNA 3UXOA 1RXWA 4I2CA 7ICJA 3JPPA 7ICPA 1ZQUA 4M9GA 3KTQA 4O3RA 1HUOA 3BQTA 4NLNA 5HP4A 7ICOA 1TFRA 8ICQA 1D8LA 3G6YA 2BDPA 4QWAA 4YR0A 3PMNA 4RU9A 4RPZA 3V6JA 3EPIA 4BXOB 4NM1A 3M9MB 4DL4A 2NRXA 1NK6A 3RJJA 4G3IA 5DB9A 2F1HA 4F4KA 4R64A 1ZETA 1XSPA 4I28A 4ED2A 4YMNA 2JEGA 4LZGA 7ICIA 4DSFA 1ZQDA 5KG7A 2XGQA 3K4GA 4QZDA 1S97A 3ZDBA 3ZD8A 9ICBA 1Z3EB 2BCQA 2ZTEA 4I2DA 5HHIA 4EZ9A 1SKSA 1JN3A 2R8GA 3AUOA 3TAQA 9ICIA 5DDYA 9ICTA 1XWLA 3H8SA 2BPFA 5KG2A 3QEAZ 1TKDA 3PO5A 2JZBB 5HMLA 4BGDA 3H4BA 3T5KA 4YXJA 5EWGA 3HPOA 3ISDA 1BPDA 3PMLA 4QZFA 4ED3A 4KLUA 5IIIA 4YD1A 1ZQTA 4UB3A 3KHGA 1S0NA 4RT2A 4P4MA 5J2HA 2R8JA 4F5PA 2PFOA 3BQ0A 5IIJA 1PZNA 4M9NA 4J9QA 3RH4A 2JEJA 4I27A 4GLXA 4XA5A 5CJ7A 2W8LA 1RYRA 4F4WA 4NLZA 5L1KA 1NJWA 3Q8PB 4KTQA 3UXPA 1ZYQA 4XQ8A 2W9CA 3KHHA 4KLHA 4Z6DA 5IIMA 3TQ1A 1L3TA 1ZQOA 4TUQA 3EW9A 2BCUA 1BPXA 2FPLA 1ZQKA 3T5HA 4M6WB 1RXVA 4IR9A 9ICMA 3NGDA
chains in the Genus database with same CATH superfamily
3SMVA 7ICGA 1NGBA 3K59A 3S3OA 2J6SA 4DB3A 4CZGA 5L1LA 1M1KO 3WXKA 8ICKA 5AKGA 2D6FC 2HHSA 4BDZA 3SQ1A 5ALJA 4GV9A 5DM6L 4V19S 4UAZA 2BQRA 4ISFA 1B4FA 3PV8A 4QW8A 2P9IB 3P1GA 1N33K 3SD7A 4CFBA 4O5BA 1N48A 5KFPA 8ICSA 4J9NA 2GH1A 3KHRA 3C1ZA 4B9LA 4AHTA 1BHLA 4PGQA 3U4LA 1S5LU 1EWQA 3C29A 3F2CA 4DSKA 1S1TA 3TR8A 2BQ3A 3I0SA 2AQ4A 8ICXA 5ALGA 1ZQIA 3H8MA 4AYBC 4NXZA 4HUEA 4AQYK 4JI2K 4JV5K 2BE2A 2W9CB 5AQTA 3FC4A 3VQ7A 4M3TA 3A5OC 4NXMK 3ZSOA 2JLEA 1CI4A 4RW8A 1S9GA 2ATLA 4OPKA 4XIUA 3JXUA 5C2DA 4QZ9A 1D9DA 4XEIA 1OW5A 2XIDA 3O80A 1SWWA 2VIXA 1LV5A 4RWTA 2ZUCA 4B6JA 4BACA 4JKCA 2G09A 4J9OA 1JX4A 1ZQPA 2HI0A 1FO4A 4CF8A 1NGCA 4ELUA 5LY3A 4NY8A 2OXOA 5L1JA 3GE1A 5ALTA 2JGAA 2OYYA 1CUKA 3VQ5A 3AQFA 2BPGA 3OYIA 4CJRA 5EX5A 1HPZA 2HHQA 1NGHA 4DOAA 1WUAA 3ALYA 4I2JA 1UA1A 2WF8A 4FE3A 3P83D 2EWSA 1KVAA 3MECA 1ATNA 1RBTA 5J2AA 4B1YB 2YMQA 1ZQQA 5DQGA 2FF3B 4IQTA 4EELA 4DG1A 3I0RA 3HW8A 1QSYA 3O6WA 2OPQA 4USAA 2F9WA 4JI1K 2HBKA 5J2PA 3ZT0A 4G9ZA 2IHNA 1BI4B 4EZ6A 1JJ2M 1KAYA 3LAKA 5M1PA 3ZDAA 2KFNA 2PFQA 2QLTA 2LSNA 1MWKA 3OYLA 3ZSRA 4XH4A 2ASOA 4BRNA 3VN5A 3V6DA 1KAXA 3EY1A 2F77X 4YD2A 4NXNK 2KNJA 2IDOA 4NCBA 4I2FA 5J0PA 1E4FT 2P9SA 3K75D 5BRDA 2KEYA 3QO9A 4DU3A 4BDYA 3EYZA 2DFFA 4JWNA 3NGYA 3E1YA 4HWIA 1YJ9N 4JYAK 4ZOHC 1NG9A 1FFUA 1Q7YO 2AA4A 2YHAA 4KH5A 5TKYA 4J8FA 4YHHK 1A5VA 3B0XA 1JCGA 3PW7A 3D7EO 4Y2XA 3Q8QB 4I2EA 3SBGA 3AVAA 2YTUA 3MWTA 4H0PA 5AQOA 4BRFA 3V1QA 3U8XA 5GTIU 4FS1A 4PQUA 3ZSYA 1COOA 3DLLL 3UQ0A 4TQRA 1EX4A 3LDLA 3WK6A 3H46O 1UPHA 1QQ5A 4KHSA 1LW2A 5KFXA 3AVFA 4UATA 4FWOA 3RJEA 1B0XA 3MBYA 1QVGM 3WKEA 4ECTA 4J2DA 2OA8A 2ALZA 1LWFA 5J0QA 4J9PA 3QIOA 3PY8A 4CEZA 4A2AA 4DCCA 5GADP 5KFAA 3ETRA 3JPRA 3LAMA 4O8UA 3PIPL 2A1JB 3QINA 4LF5K 3TKAA 4MFFA 5J2KA 2PBDA 2IC3A 1X9XA 5KG4A 1X3NA 4UAUA 3TADC 2IBKA 1KKXA 4CK1A 3OYMA 1EXQA 3D2EA 3KZBA 4N5SA 1QQNA 4YCXA 4NYFA 2E8MA 5DG9A 3ISBA 4Q5VA 5KFBA 3MCPA 3P4IA 5AKXA 4ELTA 1L3SA 4B1WB 5C42A 4RW4A 1FKPA 2P9IA 4ED8A 5J1EA 4JKFA 1S10A 1Y97A 2VWBA 4CZFA 3BS7A 4YFUA 1ASVA 3O1BA 2E2PA 5LJWA 1NK5A 5DKWA 2EH9A 2IVNA 1GOBA 2ZIVB 3CJCA 1S1WA 4FK0A 4MFCA 3HK2A 3L4PA 5KG3A 2O6KA 4PL1A 5J0TA 3RJHA 1I39A 1PK1B 1XMOK 1KN5A 3NRWA 2G06A 1DKGD 4KMUA 4UQGA 1EP4A 4BGBA 1W9HA 2HOEA 4BRHA 2QKQA 3ZEUA 3C2KA 3AN1A 2NZTA 3LDOA 5E26A 1NJYA 1JLEA 4N56A 2LMRA 2P66A 3MR6A 3VA0A 1ZQGA 1Q9XA 3E9LA 3TTDA 3MFHA 4MEXA 9ICJA 1N60A 1A5XA 1D8BA 3ITHA 1WSGA 1QS4A 5CYMA 1SL1A 1I94K 5KG1A 1U2VA 5KFQA 4CK3A 1OVYA 3VEYA 1Q81O 2MU2A 2IOFK 7ICKA 2HVHA 1LCUA 3S3MA 1ZD3A 3HRGA 2GWKA 3GBTA 3DAWA 3CMEN 5AI0A 2VJ5A 4O3PA 2D3DA 4IQVA 2WAQF 2YN4A 1SZHA 4R65A 1PVRA 2ISOA 2Z1HA 3FLCO 4IO8A 2A3ZA 3R3LA 5F0XA 1VQ6N 1RT3A 2A1AA 3WK8A 5A2QO 3G6XA 1SS6A 4H0YB 3MMVA 3U3GA 4UARA 3TU5A 2O8FA 3H8WA 4CZIA 3SK3A 3VQPA 1A6SA 1NK0A 1BOTO 3EKSA 3MABA 1U9LA 2E1ZA 3HPHA 5F2RA 1HNXK 5C5JA 5ALMA 3OS2A 2OTLN 2CGKA 3Q8SB 3F2DA 3QUCA 4TUSA 4ECUA 3RB0A 4NO7A 1IH7A 2E5LK 2VGMA 3O1WA 2IA6A 1L7PA 3TFRA 4FJLA 3LYSA 3PW0A 1ZBLA 1ZQHA 1QQMA 4H5VA 1HYVA 3V1RA 3HKZC 1AQ6A 5KI6A 2W8KA 2KLAA 3KVGA 3RVCA 3NE6A 5AQMA 5AM4A 4C0ZA 5DG8A 2QARA 5HRNA 4ECSA 1T94A 3U6FA 4FJ5A 1VLBA 5EWFA 4DWIA 1X1PA 3CCUN 1Z26A 1SXDA 2W9BB 2FSKA 4WYBA 5KGXA 3E0FA 3N7RC 1DGKN 4DR4K 3RH5A 1NZBA 4IG0A 4M0AA 2G07A 3BZKA 3AMZA 1LOTB 5CR4A 4FZYA 2E1EA 4F71A 2YKNA 5KT7A 3UXNA 4RT3A 3M8PA 3IG8A 1F21A 1Z05A 3C2LA 2GELA 1U4BA 3KIOA 3NCIA 2K60A 3GG4A 1ZJNA 3NF6A 8ICUA 4AP9A 2YNIA 1WSEA 3K5LA 3LP2A 4MHVA 3H40A 4X5VA 4O5FA 1PUZA 2ZQBA 4BE2A 4DTSA 1Z25A 3V6KA 3K5NA 2IOHA 2HNDA 4JHDB 3BS5B 4H4MA 4DUZK 4LF9K 5FP0A 2H3IA 2VA8A 4CERA 1XC3A 2IHMA 2GV9A 4H03B 2ZXHA 4UAVA 4PJ0U 8ICNA 4RQMA 2Y1IA 1QHAA 2BUPA 4IFVA 3CQYA 1KSPA 1BO5O 1NZPA 1RDCA 3ZDEA 4ECVA 2QXLA 3FZLA 2AU0A 4G9BA 4CGZA 1ZQNA 7ICSA 5HMMA 2LI6A 2L5YA 3QU9A 2Y9UA 5K4LA 3UMCA 1RPLA 4KLMA 4KBOA 3AO1A 1V9PA 2GLEA 1JLBA 3ENOA 4PUOA 4BQLA 4QZGA 4F4YA 3DXKB 4I2PA 4M6WA 3PVXA 2E88A 3GIKA 1QQ7A 3C5GA 3J81j 4BDPA 4YOTA 1T03A 5DB6A 3L2UA 2CXYA 3KLFA 3CCQN 4B9QA 4JWMA 3NMUA 3HRDD 5AK4A 4XRHA 3TSPA 3B8AX 1VRUA 3ED5A 5KPZA 2PMZF 2ZJ8A 3RB4A 5D3GA 3H08A 2PI5A 5ALIA 1RG6A 3N7SC 2MRLA 3AY9A 4JHDA 1K1QA 3L3VA 4JMUA 3C23A 1XNQK 2G8WA 5EVZA 4H5NA 2OCEA 3M6KA 5DQIA 4DF4A 3RRHA 9ICQA 4CJFA 1IBMK 5J29A 1GLDG 3UB5A 3UKRB 1Z00A 3V72A 5J8YA 3CCMN 4ECWA 3BY5A 2XC9A 2CGLA 3FZFA 2W3RA 5KFUA 5LMUK 3G4SN 1DGJA 1YITN 2D0BA 2R8IA 4CRXA 1XHXA 1PK3A 4B08A 1LAVA 4YDUC 3D2EB 2Q31A 1ZQVA 4KHQA 4Z6EA 8ICVA 3AVMA 4CEQA 4F5OA 2FC0A 1XO1A 1TL1A 3EE9A 1Q9YA 2ZTCA 1E4GT 1X6JA 1YXQA 5DBCA 2A1JA 3WK4A 3VGKA 4CBXA 5KPTA 2A40A 4IKFA 1HYSA 3A8YA 3GOIA 4AILC 3Q7CA 4BR2A 4H0TB 4O0IA 2R8KA 2PAVA 4DQQA 4BXOA 4CHYA 4P2HA 3BQ2A 3VQEA 2F76X 2HOIA 4FJ8A 4R8UA 4YG2A 3WNFA 3J7ZO 3TPQA 1V85A 2P6RA 1NMDA 1QE1A 2RQ5A 5KFLA 1XS9D 1UT8A 3C1YA 4PHEA 4EFHA 4E19A 4KHNA 3B6PA 4CZHA 4OKEA 3EPGA 1RDFA 2KK0A 2W3SA 8ICGA 2WFBA 5DG7A 5J0SA 3GIMA 1VQ8N 3RH6A 1ESVA 4B9NA 3QBXA 3VENA 3B9JA 3QEVA 3CFOA 3LWLA 3V7LA 1RGIA 4H5WA 5AQLA 4KN7A 2KKPA 1SKRA 4JKBA 5ALNA 2G0AA 3GIIA 2GWJA 5CYQA 5BRHA 5CP2A 4KLTA 1HQUA 4RCHA 3TWHA 4F3TA 4I2CA 4F4XA 2FLNA 1SAZA 1VRTA 2I7NA 1ZQUA 3CI5A 2P1JA 4FJ7A 3CJ9A 3BQTA 3JYTA 3CNHA 3V9UA 4FK4A 2BDPA 1Z1BA 3PMNA 1ASUA 3P38A 2ZXIA 4BXOB 4NM1A 2GBZA 3P5JA 3CCLN 2NRXA 3KJVA 3A2FA 5DB9A 4CEOA 2ZF5O 3V9SA 4CGFA 4I28A 3AGKA 4GKKK 4YMNA 2JEGA 4LZGA 1ZQDA 4U6PA 4OKJA 3ASMA 3WXLA 2O8DB 4Z94A 1NBWA 5C24A 1S97A 3ZD8A 2WF9A 4Y0WA 2IOFA 4I2DA 4EZ9A 5T7BA 1SKSA 1YJNN 2ZIVA 1SXEA 3TAQA 9ICIA 5CE3A 3AL0B 3MN5A 4BC4A 3FZKA 3HL8A 3QEAZ 3PO5A 4JKGB 2JZBB 3T5KA 4BGDA 3H4BA 2JGUA 3K0SA 4FZXC 4YXJA 3HPOA 2DFEA 1RT6A 2LHTA 1YT3A 1GLAG 3PUFA 1MWMA 4BRPA 5IIIA 3F5AA 3N4PA 1F0MA 5FROA 3TAEA 5ADXH 1S0NA 1BQNA 4P4MA 3U26A 2R8JA 4BROA 2YV0X 5IIJA 2BGGA 1SGGA 4LH5A 2UXBK 3VTHA 4J9QA 3DLRA 2OTJN 1BNOA 4J2BA 3AA4A 2W8LA 2UU9K 2RRDA 4F4WA 4IDHA 1N63A 1NJWA 3Q8PB 3OYHA 3OPXA 5AM1A 3UXPA 1ZYQA 3O3HA 4Z6DA 4FO0A 5GINA 4TUQA 2BCUA 4FJKA 4M7YA 2CGJA 3T5HA 2G8KA 4M6WB 4CBWA 4FVMA 4FM1A 1GLEG 1V4TA 4LFBK 1FW6A 4FWPA 2HHXA 4O3SA 1N62A 1VQ7N 5J2CA 1XUPO 2RPIA 3THWA 1N6QA 5BRFA 3EWAA 2HW3A 1NGFA 2LM4A 5J2JA 1JXLA 3CFPA 5KT2A 2NRZA 3I55N 3G71N 4PL7A 4NJ8A 3AM9A 4M7XA 4BG8A 3IP4B 3K1RB 4KB0A 5ALPA 1ATSA 1TV6A 3M6ZA 4JI4K 1U49A 3D2NA 4Q8EA 2KHQA 2VWKA 2Z1JA 3ULDA 1OH7A 4RUCA 4CF3A 3J7YP 4FK2A 1KFDA 3PO4A 1SUQA 4GXJA 4M47A 3CCVN 1ZXOA 4DFMA 4JKHA 3SUNA 4BE1A 1HX1A 3H4DA 2VQEK 4I2IA 8ICTA 4O3MA 4NCAA 4JK1A 1FFVA 2PXIA 4XH5A 1MQ2A 4IQUA 7ICFA 4M2YA 1CEZA 3AAPA 3QERA 1N32K 2Q0ZX 3M1FA 4GVEA 5D49A 4EYIB 2YHXA 5AFUA 3S3NA 4LVSA 4DL6A 4NB4A 4OJOA 2K8CB 3OYDA 4BX9C 2Q97A 1L7MA 1KW4A 3C94A 1S0OA 4ECZA 8ICLA 3NF9A 4IXCA 4FZLA 4ED7A 4YR2A 2KOBA 3SAHA 2ASLA 2PZSA 3VQ9A 9ICGA 3NASA 4M3RA 3O5BA 4ACOA 4ISGA 2B21A 4B8AB 3KLEA 5TKWA 1VJ5A 1L6NA 3RSEA 1KAZA 4DQIA 1KTQA 4KLJA 5AK3A 2FSNA 3CF5L 3OSPA 3HOTA 1JXEA 3CHWA 4FWRA 3VQQA 1CLQA 4R63A 3L2QA 3ETLA 3M1YA 3WKBA 4JKDA 5IIKA 2MSNA 4B3SK 4F2SA 2KHOA 5ALKA 3NBPA 4CIGA 1LB2B 3GV5B 1RBRA 3HVRA 1NJXA 2QWMA 4PKIA 2W9MA 4JKAA 2W6KA 1X66A 4ZH4A 4RNNA 4FZNA 3T1YK 4AHCA 2E6LA 2ESEA 4JI7K 2KJ8A 2ZIWA 4KLLA 1LWEA 5C15A 1YTAA 3A0IX 5AQFA 4K42A 9ICEA 2E2QA 1BPBA 1WG8A 3KOOA 3TAGA 1BPYA 3LDNA 4DR3K 3WNHA 4K43A 2YCHA 3F9KA 3IG5A 4B1UB 1RYUA 5AQZA 2KHVA 4Y2TA 8ICPA 4UASA 2F9TA 3F2KA 3K2PA 1DLOA 4ICAA 4BC5A 4C8LA 4ED0A 3G6VA 3CPEA 2PFPA 1FEZA 5KAIU 1MA9B 1GLCG 5BPMA 2WF5A 1EQYA 3AVBA 8ICRA 1ZRMA 3K1ZA 3JSMA 4BRLA 3VC8A 3NH0A 1A5WA 4YOVA 3OYJA 4O5KA 2QW9A 4KI6A 3THVA 4DTMA 1R0AA 1TUUA 4M3XA 4F5QA 3SJHA 2ZUDA 2DPJA 4UB5A 3GFKB 3Q8MA 2HF4A 1LKYB 3PIOL 3G6EN 3ZI4A 3ZSQA 4CCHA 3O9SA 4BC3A 4IR1A 4BQZA 3KD1E 4ECYA 1L3UA 1ZBSA 4IG3A 1UT5A 1QZ5A 4FLVA 4ECXA 4O55A 1JL2A 3F53A 3K58A 4OLBA 1LAWA 4FJMA 3S41A 4IL6U 2D0OA 3L3UA 3MXMA 4FLXA 1IBKK 1P90A 5AQQA 3AO5A 5ALXA 5AIBA 1CXQA 1JCEA 5J2BA 3F9MA 3HYFA 2ZIXA 2E6MA 4FJHA 4NLGA 4YOYA 5KAFU 3LP0A 2RP5A 1VQMN 2D0CA 1BA1A 3AAQA 4DV3K 3CQXA 3Q8RB 3CJAA 4H5RA 5ALZA 2XICA 1O1WA 5AM3A 4RQ5A 1SB3C 2HCFA 4C8NA 4CF1A 2YNGA 1RT5A 4LJXA 3TAMA 2IVPA 4E3SA 1MC8A 4YXMA 2P51A 1LVHA 4W5QA 2ZJAA 9ICCA 2UXCK 1X2IA 3SV3A 3ATUA 1HKCA 2DFLA 4UB2A 4DO9A 3ID8A 4FSVA 4KLQA 4IDKA 4QS9A 4LF8K 3VMFB 3J81O 3MXIA 4KTZA 3CCSN 1SV0C 4B9VA 4K25A 2F1JA 2HNYA 4BRCA 3L2WA 7ICHA 3MWPA 3NGZA 5JVGL 3OHAA 1GOCA 2EAPA 3A5MC 3CFRA 5DB7A 1KLNA 2E1YA 5JU5A 5GTHU 3SI8A 1IJJA 5HL7L 5ALLA 1RNHA 3BEXA 4RZRA 3ULEA 4PHTX 2EQYA 4TURA 1HRHA 3LALA 4E0DA 5AKHA 4M04A 4CE9A 3L5KA 5HLFA 2ITGA 4DU4A 5AQYA 3UKUB 4GV3A 1YVNA 3A5LC 3I33A 3KKRA 3MXJA 4KH4A 5JS1A 1O08A 4LFAK 5CR0A 1J2MA 2CH6A 4B1VA 2DGZA 3RBEA 5T14A 5LL6Z 4FZMA 3D2SA 1VSKA 2NLXA 2KJ5A 3QUBA 3CJ7A 1BNPA 5ALQA 1TVRA 4UAWA 1HUXA 5DBBA 4KHYA 3DMJA 5AQNA 1WN7A 1PVQA 5HBMA 2KIWA 3DRPA 1ATRA 2F96A 1ZQLA 1N8RO 3U9ZA 5BR8K 4QIWC 2UVWA 3OBYA 4W5OA 1U48A 3BP8A 2IOCA 2KW4A 5JRTA 4WFNL 1ZQJA 3DWLA 5CWRA 2K89A 4CJKA 1IKYA 4CJLA 4JD2B 3H0RB 3MN7A 2HOQA 1B9DA 4MF2A 4UBBA 5AQHA 3VA3A 2E8AA 4F2RA 3GV8B 3OYAA 2Y1JA 5KFRA 2YNFA 2WTUA 1J5OA 4RNMA 3MEGA 4W5NA 5BOMA 4FCYA 1U45A 3O4QA 2D0AA 2HSZA 5CZ1A 3NF8A 1GOAA 1CZBA 1ED1A 1Q82O 3D2FA 1QH9A 2PYJA 4NL9C 1X9MA 1EETA 4YFKA 3UQ2A 1QTMA 4JUZA 4RG8A 4CF2A 3OTOK 9ICOA 1QLNA 3M7DA 4PHAA 2RE2A 3VGLA 2AGPA 5AKJA 2Q2RA 2I5HA 2AQ0A 3AU2A 4H0OA 3CM5A 1HNVA 9ICNA 4HCBA 5KFEA 3LDAA 2VANA 3MDAA 2EDUA 4Z0UA 1QVFM 4IRDA 3GILA 3CC4N 3DXMB 3I8DA 3AV9A 4DR1K 2LM1A 1LW0A 4O5EA 1VQLN 5AQXA 2BANA 1JLCA 2F44A 1VQ4N 3ZDDA 4KHUA 2KQ2A 2Y0SF 3VEZA 1MA7A 3KZIU 1NJZA 1YF5L 4PKGA 3ZEUB 4EEYA 5GIOA 3VQ4A 3LZIA 3EZ5A 5BPLA 2KVCA 1B92A 1FXXA 1V4SA 1YZ7A 5FRNA 4OX9K 8ICMA 3E9PA 1K1SA 4U67L 2N1RA 3JAMO 4QZAA 4H0XB 4Q44A 2ZUBA 5DLGA 4OJ5A 3FM9A 5DDMA 4CJUA 4RW9A 2H5XA 2G8IA 5HR6A 2KKZA 4CE6A 1VQKN 4M9HA 2ITMA 3U3YA 5CEHA 4NCGA 4CF0A 2ZJPL 2KVSA 3GDQA 3SPYA 5G5HA 4US8A 1L8OA 4I2BA 4KLGA 4X65K 2I1QA 1U6ZA 4FLYA 2YB4A 3C7NA 3GV7B 1Z4NA 1GLFO 1XQSC 2BCSA 3O9RA 2K8BB 4MDAA 2OM6A 3VPZA 1MSWD 3QEBZ 1IV8A 4LFCK 4US9A 4RPYA 2BKEA 1BPZA 2AGOA 3AVIA 4I2HA 4KLSA 1D8YA 3AA3A 4FS2A 1YIJN 5AM5A 2RDJA 1J2NA 1MQ3A 1KRPA 3T1HK 4L8RB 5LJVA 1NOYA 4Y2YA 2W9AA 3AVKA 3G10A 3H0LB 3GU3A 1ZRNA 3KKAC 1SZPA 3WKCA 4EBCA 3LDPA 3L8BA 5KL8B 4DSLA 4WQ4C 2WB1C 2DF4B 2XY5A 3IN5A 3OHBA 2LPEA 3PW5A 5M1NA 4GKJK 4MO5A 3VEXA 1S1VA 4JI0K 1WYGA 3QNMA 2Q4TA 1WSIA 1Z1VA 1ZC6A 2ASJA 1QQOA 2RKIA 2XRIA 1YZ6A 3JPQA 3F2BA 3O0FA 3MR2A 3RJGA 2QB0B 1ZQAA 3SUQA 5HOOA 4DHYA 4CIEA 2P9UB 1DOQA 4RQ1A 5C10A 1RQNA 3QU7A 4E1NA 1SQKA 3MN6A 2GUPA 2XY7A 3QXGA 5BOLA 3WUHA 1K73O 5HHHA 3TFSA 4IRCA 1RDDA 2VCPA 5HNKA 5BN8A 3CRXA 1FKOA 5HRRA 9ICSA 4EHUA 3O9UA 4M63C 3LDQA 1WUDA 2YJEA 3TI0A 4BUGA 2HHWA 4ZTFA 3M8QA 4DQ8A 3SUOA 3MX5A 5HP1A 3OTQA 3QMLA 1UCVA 3HO1A 3V9ZA 1T44A 3MR3A 3ZD9A 2GWSA 4QZIA 4K4HA 4I9QA 2A3VA 4A59A 4O3QA 2G5IB 4CGJA 3OY9A 3AVLA 5ALHA 1UA0A 3RRGA 3DOLA 3RB6A 3FGUA 1YVUA 4A62A 4HUFA 3QEWA 2QARB 4DOCA 4WFBL 4J9SA 4LD0A 5A0LA 4CNQA 1L8LA 1VSLA 4CI6A 3EUB2 1S5JA 2V4RA 4PZNA 4DFJA 3UPQA 2HVIA 3RFAA 4R5PA 2IAJA 4B3MK 5AI5A 9ICXA 2PI4A 3HT3A 1IG9A 3TARA 1ZD5A 1VDVA 2W7OA 3ZX3A 1UOCA 2W11A 4CEAA 4RQNA 1YTUA 2F7TA 1TYQA 3HXMA 3Q8LA 1IBLK 3KZXA 1WLJA 2LBOA 4PH5A 3AVJA 2BTFA 5FPDA 4CJEA 1W7AA 8ICWA 1PVPA 3NVKA 3ZDCA 2D1KA 1RBUA 2O8EB 1WCNA 4F93B 4B8CA 4DLEA 3ONNA 1TK5A 2E8NA 4MFBA 3IS9A 1RXWA 1C0TA 3QEIA 4Y2PA 2E4LA 2E8OA 1DT9A 3L3FX 3S6JA 3KFUF 7ICOA 1WAFA 3E66A 5KQ8A 1TFRA 8ICQA 4E1MA 5C2FA 1D8LA 1C1AA 3O9QA 2QWRA 4QWAA 4YR0A 2A5XA 2JXJA 3J8AA 5KRSA 3EPIA 5E84A 1RTJA 5AQGA 3M9MB 3MCAB 1W2BM 3RJJA 1Z19A 4F4KA 1O13A 2JRZA 4GFJA 4CJTA 4AYBF 2CRXA 7ICIA 1KL9A 4KHWA 4CJQA 5B5EU 3R8EA 5FRMA 5KG7A 2XGQA 3ZDBA 5JICA 9ICBA 3C7NB 1M90O 3CQ8A 3C6AA 3HTVA 2G8VA 3CG7A 1JN3A 2R8GA 3AUOA 3OYCA 3VCBA 3T79A 4JI5K 3H8SA 3Q7BA 1TKDA 3VGMA 5HMLA 2GEMA 1BISA 3MGVA 2D4WA 2UUBK 2ZE2A 2O8BB 2H3QA 4DV7K 5J8YC 4M3WA 4M3YA 4J2AA 4QZFA 2X6SA 4UB3A 4WJ3B 4B1XB 4RT2A 1C0UA 2JH1A 5J2HA 2PFOA 2YKMA 1PZNA 2Z1IA 4FJJA 3RWUA 4FWQA 2K4EA 4XA5A 5BN9A 4DCHA 3WXIA 2JH7A 3DXMA 4O8KA 4DV2K 3D6RA 3K9JA 3TQ1A 1S3XA 5DMRA 2FPLA 1XHZA 1ZQKA 3BUZB 1E3MA 3SQ0A 3S9HA 2VJ4A 3C6UA 3THYB 4IR9A 4DTOA 1IG8A 4GC7A 5FPNA 4JV2A 4DL5A 4DSEA 2XY8A 3E9OA 4KTWA 4MEYA 2XCPA 3AU6A 2P9NA 4JKEA 2DQNB 5AKZA 4MO4A 3RMDA 4JS5A 3ZCMA 2KZZA 4H4OA 4KAZA 4C8MA 4Y1CA 1KVBA 3RAQA 5KG5A 2OH2A 2AP1A 2NNWA 1JKHA 3AO4A 3IKMA 2P9PA 1FIQA 3P39A 4C8OA 3G25A 2RN2A 3WK9A 4IJNA 5IT9O 1JALA 2WF6A 9ICVA 3CETA 3QU5A 2LYBA 1SIJA 3OA9A 2WONA 2ZIUA 4BR0A 3LDSA 4JD2A 5KFIA 3HVTA 4OVLA 4DTJA 5J0UA 4I29A 3LPUA 4FM2A 1ILYA 1BIUA 4PKHA 4CESA 4YP3A 4PA1A 1X9WA 3HOSA 1H38A 3VF6A 1HJPA 4F72A 4IEIA 1JUDA 1SKWA 1HNZK 4DTPA 5AM0A 4DQPA 2QKBA 3OBWA 1U2VB 1P7DA 1C20A 3D45A 3ID6A 4GVMA 1HNIA 4PPXA 1CXUA 3RB3A 4UB1A 3VQ8A 4KB1A 4RW6A 2P9KB 2AH5A 2AXTU 1WB9A 2QEXN 1KEJA 3V9WA 2I9GA 2XI9A 3O3FA 4P0PB 1K6YA 2MUTB 3DDHA 1X3MA 1NGJA 3QNNA 5JS2A 3DV9A 4KV8A 4DSJA 5LMNK 7ICEA 2P9LA 4FPAA 2O4IA 3T1AA 2F8SA 3G0ZA 1EO1A 4MQ3A 1S8OA 2V4QA 2OWOA 1RTHA 3T5LA 3J7AP 2BGWA 5CY4A 5KFNA 5D4BA 5E41A 4QZCA 3T3FA 3AVNA 3BZCA 4J03A 3UE5A 4J9MA 2NUBA 2YMMA 4QZBA 1TE2A 1L7OA 2HMXA 3CC2N 4P4OA 1DTQA 3ISNC 1HKGA 2OPRA 2KSOA 4I6MA 2WUSA 1CZAN 3QU4A 7ICTA 4NLCA 1RBVA 2C22A 2HBJA 4CJ3A 4CJPA 5AKLA 5AI4A 3KHYA 1NKBA 3FYHA 4M41A 7ICLA 1WAJA 3AO2A 3ZT2A 5KT5A 1QSSA 4FJNA 3FAHA 2W55A 2FBVA 2BPCA 5F9NA 4CBUA 1RTIA 3P31A 2KD1A 4YMOA 4QWEA 1SV5A 4M45A 4C23A 2W04A 3M3ZA 1BU6O 5GAEP 1X42A 5FPMA 1V38A 3AO3A 5KG6A 3NDKA 2ZIXB 1BA0A 2HNZA 3PSFA 5AQKA 2YI1A 1BL3A 3VQ6A 5BPNA 5J2EA 4F5NA 3H6EA 4DOBA 3DJCA 1T3NA 4CZJA 1WSHA 4C4SA 2VG6A 4E7IA 2DTUA 2JV3A 2J6UA 1HNWK 2KKVA 1N56A 3QLHA 1SWVA 3NVYA 2HOFA 2YX6A 2RDIA 3EEQA 5BR9A 3CW2C 4C1NK 4BC2A 1NGDA 5J2QA 5IILA 4EIAA 3M6GA 3PSPA 2FLLA 1S22A 3UIQA 2G5HB 3NUQA 3NVVA 5AHXA 2FMPA 9ICKA 4ZHRA 1DTTA 2PFUA 3HZ6A 3ZT4A 4CGDA 4DV4K 4ZTJA 3WKDA 5ELZA 4HUGA 5F9LA 5CHIA 1UAXA 3D2QA 5KFZA 4EP4A 1ZBIA 3BF3A 3WNGA 4IRKA 1L3VA 3U9DA 7ICMA 3OJUA 3RSEB 3OYGA 2C2RA 1ZQBA 3FFKB 3QE9Y 2J6TA 4JK8A 4M42A 3CIPA 5ALDA 2YHWA 4OCZA 2ETJA 3R9PA 4CDGA 3AARA 1JLGA 1RZTA 1BCOA 4RQ0A 3AVGA 4CEBA 3TANA 2VKQA 2D0PA 3LPTA 1VHXA 2PYLA 1H1VA 2Z7JA 1Y64A 9ICAA 4C80A 2NRVA 1HQEA 4FW2A 4IC9A 4HHTA 1BCMA 5ALRA 1YJWN 3VESA 2KTQA 2C2EA 3N28A 4FOEA 3ZSVA 1TKTA 2VA3A 4UY8O 4N47A 4Z4IA 4AH9A 3F5TA 4UB6U 3IMXA 4FJXA 4DSIA 4BRKA 2Q0UA 5DGBA 3ZYYX 1OH5A 2PKEA 4R8UB 2NRWA 1L7NA 4ECRA 4C1NI 1BPEA 4K8XA 1N5XA 3A0HU 4BJQA 3NVMA 2I5JA 2JMGA 1C6VA 2D8CA 3UM9A 2ODGA 5KFHA 1TVAA 3QICA 5AIAA 4KKOA 4DV1K 4KN4A 3QZ7A 4FLZA 3HSTB 2MAXA 5IWAK 3PLAA 4ECQA 3CM6A 1ZD2P 2FDRA 3R9KA 3KLHA 2K4HA 4EEKA 3V7KA 4K41A 4GXKA 3N4MB 3RAXA 1VK0A 3THXB 1KLMA 1TGOA 8ICEA 4CJSA 3K57A 4Q45A 4JK7A 3IDWA 3EKUA 2JHDA 4YR3A 1U47A 3DEEA 3L4QA 2ZJQL 4JRPA 3QUTA 2BCVA 1QSLA 9ICWA 1Q8KA 1ZQEA 2IS3A 4BVPA 4IWVA 2PFNA 1S0VA 1RT7A 2Q1NA 1D4XA 3A5NC 1C7YA 2FLPA 3KKAA 5EE9A 4I2QA 4B9MA 3IHQB 3SV4A 2B0CA 4WQ4A 1Z6RA 5ALWA 4DF8A 2OHFA 5KG0A 2HBLA 2NV3A 2IMWP 1P8ZA 5ALVA 2KV2A 1VSDA 2WOMA 1B9FA 4F92B 3RJFA 3TABA 1BVSA 3HSCA 5AZJA 2H3VA 4CECA 3NTUA 4FFDA 5M1KA 4R66A 4CHNA 3PW2A 3KWGA 3QIPA 1B43A 2QA4N 4DV5K 5KFFA 3DLHA 2WFAA 4FLUA 4PHPA 1NJIO 2ZGYA 1NK9A 3OSNA 4RW7A 2J4RA 2O8DA 2GO7A 8ICYA 2XY6A 2OANA 2KSOB 4CW7B 7ICVA 3L4IA 5KPRA 5I3UA 3QU2A 3LWMA 1S9EA 2O8BA 3AVCA 4AM6A 2P9KA 2LYHA 2H3GX 3HP6A 4Z6FA 4BRIA 5KNIA 3PW4A 1TK8A 3RR7A 3LM2A 3THWB 4Y2SA 3LP3A 3RMAA 4YN4A 4YNQA 1HEKA 3LK9A 8ICIA 5JMVA 5FPEA 4BE0A 4LSNA 5M1OA 2RLTA 3THXA 4Z4FA 4W5RA 4DS4A 4C4RA 3EL2A 4CFCA 3QB0A 3WQUA 4OJPA 4MLHA 4EP5A 4PGXA 4MF8A 4OPAA 5G5GA 3TTCA 4LF4K 4WQ5A 2FJ6A 4N76A 2FBTA 1JRPA 1ZQ1C 2OPSA 5F3XB 5JVHL 2BR0A 1TYQB 4JNEA 3I56N 5L9XA 2P9LB 4QWBA 3C28A 1VSIA 4JAXA 2VQFK 1C0MA 8ICZA 4EBDA 4GXIA 4CHQA 1K9MO 4P0PA 1OVQA 3KLIA 4P4PA 4B3OA 2ES6A 1TUYA 1QZ6A 3M5RA 1GLJO 1JLFA 4RNOA 4DR7K 4EX7A 2LYAA 1TV9A 1J9AA 1RDAA 2JZBA 3UMBA 4Z4GA 3O4NA 1JMSA 1ZD4A 5I42A 2HB5A 1HPMA 3SI6A 3IDHA 3BS5A 2RHFA 3KHLA 4DS5A 3CMAN 3OYBA 4CJ5A 5KGWA 5AFUH 5H1SQ 4NYNA 3H1QA 3H3NO 2NRRA 3TSUA 3BDPA 3ZETB 2G8UA 3KK3A 3CD6N 1YUWA 1KFSA 2MUTA 5KT3A 1SV4A 1JXBA 4CEFA 4DUYK 5HROA 1GLBG 4CHOA 1HLUA 2DPNA 4QNLA 3SZ2A 1S9FA 5J2MA 2YB1A 4NWIA 5KFVA 2A19A 9ICHA 3PX4A 5L1MA 1K8AO 4FWLA 3H0MB 3UKUA 4ED6A 5ALUA 1YAGA 3BQ7A 7ICRA 1T7PA 4CZEA 7ICUA 1VSEA 3KKSA 4YY3K 4JI3K 2VGNA 3O9TA 4QZ8A 5KL1B 2O8FB 2R7YA 1WWVA 4Y2VA 3MEEA 4E7JA 3NH2A 1HJRA 1NU0A 3ISCA 2M9NA 2O8CA 4NM2A 2QB0A 5ADXA 4FLWA 4KO0A 4FVUA 3RJKA 5AQWA 2BZFA 2V52B 5AK6A 2QWNA 3OS1A 3THYA 1BIZA 5GAHP 1ZQSA 5K14A 3VF4A 1HUZA 1VSMA 4E7LA 2QI2A 3NGIA 1TK0A 1Z00B 4OJ6A 4FJIA 1HMVA 3ORYA 3RF9A 2P5GA 3F5EA 5AKKA 3HWTA 3N97B 4KH6A 3H45C 3SBTA 5AQIA 3SQ4A 5CA7A 3QEXA 1GLLO 4KHPK 2AGQA 5ALFA 1BG3A 4IO9L 3OGUA 1K8KB 2BH1A 2WF7A 2PMZC 3JPSA 1IKXA 5CRXA 4GV6A 1NGGA 2ZGZA 3CC7N 2W6LA 4C4TA 5DB8A 4CJ4A 4EAHD 5KFJA 5EE1A 2YHBA 1JI7A 4M3ZA 4DL3A 3AVHA 4RQ8A 9ICPA 3VETA 1OKJA 4QWCA 4KREA 1Z4OA 3HM8A 4W5TA 3DOKA 1DGSA 3AA2A 3NVZA 3V7JA 2V7ZA 3LVWA 4R79A 1V97A 2E1FA 5J2DA 4FO6A 5MLCQ 2GX9A 4CEEA 2DUYA 1RT1A 1NK8A 1N5WA 3QESA 5J2FA 1HR0K 2FPMA 4KMOB 2JEFA 3LP1A 2QWLA 3MGHA 2Y0SC 4C8KA 3KK7A 2OPPA 4DLGA 3VQDA 5CHGA 5I9EB 4KPYA 3EE8A 3PNCA 3ZSXA 1J54A 3JPTA 3GZFA 1K5OA 4H8KA 4QZEA 4EX6A 3ALRA 2H3FA 1WSFA 2O4GA 4E7KA 3I8BA 5AKEA 1KDHA 1T8EA 1ZQFA 1BUPA 3CYMA 3IFRA 4FOIA 4F5RA 4KX3A 3C2MA 3MK6A 4BWMA 3PR5B 2QTDA 3VERA 3I1YA 4AHUA 1VQNN 1D9FA 4I2AA 4J9KA 3IUCA 2EX3A 3OYFA 2B4JA 2IIRA 4OJRA 3UXOA 3JPPA 3QX7A 4M9GA 2E2OA 1KD1O 4O3RA 1HUOA 4HVJA 5HP4A 5JLHA 3JS6A 3DRSA 2DL0A 3G6YA 3DLGA 4RU9A 4RPZA 3V6JA 3V1OA 4DTUA 4YOXA 1N5YA 2ZIWB 4P0QA 4DL4A 4EENA 1C0FA 1NK6A 5AJ3K 4G3IA 3WK5A 4BR5A 2YHYA 4UB8U 1ZETA 4ED2A 3SMPA 2WB1F 5FLXO 4IOXA 1Q46A 2O8EA 2BCQA 2QM1A 2ZTEA 5HHIA 3WNEA 4UW9A 1TKXA 2Q0RA 4B1ZA 3OS0A 5DDYA 1YI2N 5EOYA 1XWLA 4KFBA 2BPFA 2QXFA 5KG2A 2W40A 3EN9A 3KK1A 4DR2K 5EWGA 1MDUB 3NRZA 1DXSA 1BPDA 1RDBA 1CRXA 3PMLA 4A8EA 4CGIA 4I7FA 1OXJA 5HRPA 1NMNA 4WE1A 4BR7A 3KHGA 4OKKA 5HRSA 3BQ0A 4DV0K 2QKKA 4OO1J 4M9NA 2JEJA 5C25A 1S6PA 4QS8A 4JI6K 5AICA 5CJ7A 1GO3F 4NLZA 3NFAA 1T3VA 4LF6K 3CERA 4KLHA 4XQ8A 1KVCA 5IIMA 1L3TA 1DRGA 4LY7A 3SR6A 1EWRA 1JL1A 2AHOB 1NI3A 5ALEA 3MC1A 4PZOA 4WFAL 4WCEL 5B66U 1VQ5N 1RXVA 3J80O 5JLFA 4H0VB 2DBYA 1RBSA 3IM1A 3L0QA 3FR0A 2K4PA 4EBEA 5AQUA 4G1QA 1SL2A 3ENBA 1ZQRA 2CPRA 4FL9A 3ICXA 1Q3UA 3ZLJA 5KFKA 5AQJA 1IV0A 4Q43A 3DM2A 5M1FA 5KT4A 4RQ4A 9ICFA 1T6DA 4DTNA 4IFEA 4FLTA 1W0HA 2G8HA 3DLEA 3L2RA 3NS1A 1NKCA 2FXUA 1A0PA 2WHEA 2P9UA 8ICOA 3NF7A 5KFOA 5J0XA 2YMPA 4PL2A 1QHTA 3C0BA 2UVVA 4OGCA 1ZQYA 4CJWA 4KITB 4ELVA 4IEEA 3I28A 5EE3A 1IO2A 1N2XA 5KFCA 1ASWA 2VYPA 2KFZA 1WOQA 4BRQA 3MFIA 2JWLA 5TZVA 4LZDA 3GQCA 4KLEA 2VA2A 4CD1A 3SAFA 4N41A 3AGRA 2DWQA 2FMSA 1HIWA 4O5CA 1JROA 2KJ9A 1T4GA 3PX6A 1G99A 4O3OA 3D2FB 1UQVA 2FMQA 1F5SA 1OH6A 4MDBA 4GC6A 2FLOA 4YOUA 4B3TK 2X6NA 1DK2A 5DBAA 1NOMA 3CXCM 1JLQA 1UHUA 4GY2B 4DV6K 4QIWF 3SUPA 4UAYA 4KLDA 5KFWA 5B8HA 4M3UA 1JIHA 4CHPA 4A2BA 3H1VX 5EWEA 3HJEA 4K0KK 2RHKA 3B6OA 2E2NA 3FFIA 1ZQWA 4I2GA 1XSLA 5KRTA 3TAPA 4O0JA 4O4GA 1X9JA 1EKEA 1W97L 3QETA 2ZJ5A 4Y2RA 2WTFA 4RUAA 4F3OA 4ISEA 3HJFA 1JCFA 4PL8A 4TSXA 4OD0A 3NHGA 4F4ZA 2BQUA 4AF1A 3OYKA 4QS7A 2YQEA 5AKYA 1B22A 3SCXA 4IZ9A 2QWPA 8ICHA 2QK9A 2W7PA 1S0MA 1Q8IA 2A42A 2I7PA 3NH1A 3T7ZA 5C0YA 9ICRA 3PR4A 4DFPA 3QEPA 4MLEA 3C5FA 1F44A 1K8KA 1QQCA 3H3OB 4IOAL 4CF9A 2ISPA 3O8MA 5TISU 2P35A 2KZMA 5FDLA 5ALSA 1FK9A 1L5UA 1ZJMA 2KZ3A 4Z6CA 2A1SA 2JWKA 4NV0A 1RILA 9ICUA 2BDUA 2KN7A 2W03A 3WXJA 4LF7K 4FWKA 3ZX0A 1ZOLA 3M9NB 4DTXA 4C7ZA 2H3ZA 4QAGA 5J2NA 3SENA 4Y2QA 3C65A 2UUAK 3RBDA 3N4QA 2EAMA 4B9UA 3PSTA 5KFGA 3DRRA 3V6HA 3SJJA 2OYQA 9ICLA 2WC9A 1S72N 5AR0A 1NGEA 4AM7A 1NGAA 1COKA 3QFPA 5AQVA 4X64K 4HCCA 3T69A 2NO5A 1NKEA 4FPBA 4ID5A 2KE7A 1NK7A 1MU2A 2FBXA 3BJYA 5AZIA 3ENHA 2I6XA 1X9SA 4CFAA 4FBUA 1Q18A 1KC8O 2YMLA 4J9RA 5JUMA 2FPKA 1LWCA 4PGYA 3IRXA 4YOWA 5ALOA 3SEIA 5AM2A 2HHTA 3HI0A 4FJ9A 5KFMA 4O9MA 4KLFA 2RF2A 2VG5A 5HR7A 5KFYA 1UWBA 5CZ2A 3VEVA 2ZM6K 2F8LA 3IRUA 4RPXA 2AJQA 5KFSA 2D5RA 7ICNA 4YMMA 1BGXT 2E20A 1KXPA 4CK2A 3NAEA 2UXDK 3Q8KA 3V81A 3L2VA 2C28A 1ZBUA 2VWJA 4J9LA 4WF9L 4IBNA 4K4IA 3OYEA 2OZMA 1WSJA 4BRMA 3HX0A 3IAYA 3M8SA 2YX8A 3QZ8A 3OVNA 3R6MA 2R8HA 4AHVA 2XO7A 4K4GA 4IFYA 4BR4A 3OJSA 2YY6A 2W43A 4QWDA 1D5AA 3K5MA 2B5JA 3LVVA 4PY5A 2DKZA 1HKBA 4WQ5C 5CB1A 3FZHA 5KFDA 1U04A 4CVNE 4ICLA 4Y2JA 1LKYA 4OJLA 1XC9A 2B6AA 2K8AA 4UBCA 1VQ9N 2WAQC 2WBNA 4BVOA 4M9JA 1TAMA 2XGPA 1IG6A 4KRFA 3ZETA 3DLBA 3WEEA 3D6JA 5KTQA 2X74A 5DM7L 1NNLA 2IGIA 4QOZB 4C7YA 4PHDA 1SV0A 2YJFA 5EE0A 1CZ9A 3WKAA 1N34K 3R1XA 1NNEA 1ZBHA 5KQDA 5M1QA 1JLAA 2Z1GA 4CZLA 1X6IA 4KLIA 3AA5X 2HDOA 4B9SA 2EZXA 4YVZA 3DXKA 1NM1A 5IINA 3LM9A 3HM9A 2HMIA 3RMCA 3JPNA 1REVA 3WXMB 2B6GA 1VQON 4JI8K 2ZG6A 4DMNA 1N61A 2KG5A 3I76A 3SMSA 3CPWM 3VQBA 5ALYA 5DK5A 3NVWA 4HAIA 2KP7A 3MN9A 4I6MB 5KFTA 1ZQXA 1T3QA 8ICAA 3K9KA 3WT0A 3A0BU 3TAFA 2W42A 3M9OB 4XUSA 3JPOA 1OUQA 3VEWA 4CEDA 4E89A 3HPGA 4E1JA 3O4WA 1ZXIA 5AQRA 3QDKA 1EXNA 3TTFA 4A57A 2OZSA 5E79U 4DEZA 1BWFO 3KK2A 4RTFD 2KICA 1G15A 1RT2A 2ASDA 4Y1DA 3ZT1A 3VTIA 1TKZA 2EANA 3N7PD 1Q3VA 2JEIA 3WEEB 1RT4A 2G8FA 4EYHB 4K8ZA 4LH4A 4PWDA 2F1IA 5F1XA 4RQ3A 1VSFA 3RJIA 4DFKA 1J53A 4GW6A 3OYNA 4Z4EA 4MFAA 2HBMA 1KBUA 2ASMA 5J2GA 4BWJA 2F8KA 4AHRA 5J2IA 4ED1A 2F4VK 4B3RK 1XU4A 3E01A 3CP8A 2HMPA 3VEOA 1S77D 3IG1A 1ZBFA 4DL2A 3W3DA 1A77A 5J0OA 4JS4A 5J0WA 2Y9TA 3B0YA 3O08A 4NLKA 2DY4A 3EZWA 2UVUA 4KX5A 5EOZA 1WWUA 4ILJA 1C1BA 4NLBA 3RR8A 1Y88A 4OGEA 2QWQA 3LZJA 2P9SB 2V51B 4YDUA 3ZSWA 5DQHA 2OEHA 2QWOA 3CJ1A 1WBDA 2W9BA 1J6ZA 3DLKA 3W0LA 4QCLA 4BRDA 2GTDA 2KMDA 5AK5A 4ILHA 5DLFA 3SYZA 2HHHK 2NYVA 2ASPA 3GL1A 3GIJA 2UVRA 4O3NA 2EAOA 3C6TA 3MX2A 1I3AA 4YQWA 4DFDA 1RCHA 4M9LA 1IXRA 4RQ6A 3MR5A 2FBYA 4HTLA 1X40A 5AZIB 1XNRK 4TUPA 1WNSA 4CJVA 4FWNA 4RQ2A 5IIOA 2UYTA 3ULEB 3WU2U 2W54A 2XHBA 1VQPN 3QNOA 2G08A 4FW1A 5AQPA 4QJFB 1TAUA 3PZPA 3QUQA 2ZIUB 4KLOA 3ZX2A 4CD3A 4B9TA 4A61A 2UUCK 1S1UA 2R18A 3M8RA 1KFTA 4QZHA 2FF6A 4UB4A 2O8CB 3C95A 1Q86O 4LSLA 2CH5A 3MEDA 3O3GA 1M6YA 3WQTA 1ECWA 1ZQCA 1RDWX 4BREA 4EHTA 1KQSM 4KI4A 1IM4A 4U7BA 3C21A 3T19A 1TAQA 4JB3A 3KWIA 3SLCA 2KIVA 3RMBA 5KT6A 1KQQA 2E5SA 4P0QB 1C0GA 2X78A 4BY9C 4FZZA 1A76A 2JR5A 2LKYA 2QB1A 1S1XA 8ICCA 3QBWA 2V7YA 4LC9B 4FM0A 3SNNA 2V9WA 3VQAA 4DQRA 1QCKA 2ZTDA 3QFUA 4F8RA 3CJBA 4ID1A 4BRAA 4F91B 2GUIA 2F8TA 4OLAA 4JKGA 1NGIA 5BPCA 2BCRA 4DQSA 3E2EA 5H2FU 2EHGA 3MDCA 2HF3A 2CN1A 5AKIA 1XSNA 2Q3SA 4FWMA 4CF4A 1S6QA 3IV6A 1SL0A 3K5OA 4DKWA 4I9LA 2HHUA 1SZ2A 7ICQA 4JV1A 1RTDA 3GDXA 3RTVA 2M0NA 8ICFA 4JLHA 5EY4A 4X62K 3FZMA 5AZJB 2ZD1A 4F50A 1O03A 1N36K 5J0RA 1IKWA 1KCFA 4IQWA 3WK7A 4O44A 2XCAA 1HJOA 4E7HA 1XMQK 5J0YA 2W41A 3VOVA 1J5EK 1ZQMA 2EZYA 2A41A 4DU1A 2C2DA 3OW2M 4A5BA 3EO3A 1VSHA 2NRTA 3ZSZA 3BGRA 4CJ7A 4JEPA 2HSTA 5L1IA 2K4IA 2ZWHA 3T5JA 4TQSA 1RYSA 4JV0A 1ZQZA 4GNIA 3VQCA 3KBBA 3H8JA 1TL3A 4BG9A 4CHZA 2A1RA 8ICBA 2ATQA 5EU7A 3QYPA 1XI1A 2FE9A 4Z4HA 4HTUA 4BGAA 4CGGA 5DGAA 4FWSA 4CF5A 3UMGA 1T6CA 3KD3A 4FJGA 3KD5E 1NWKA 4RQ7A 2F3NA 1XNSA 4FXDA 4L3QA 3FE1A 4QW9A 2EZZA 1S76D 3TACB 2BHNA 3MGIA 3MDQA 5SWMA 4HYKA 3KLGA 3SQIA 1WCLA 3BQ1A 4GIBA 5EXWA 3DYAA 3SAGA 2HHVA 5JTIA 1NK4A 8ICJA 5D46A 4Y2UA 4CZKA 1RDUA 3ATVA 4H5TA 2DPIA 4Z4CA 3HBTA 1IIPA 2NO4A 2DFHA 3HILA 4Q8FA 1AROP 3AQEA 4XH1A 4CFDA 3MAQA 3V4IA 4DR6K 1IKVA 3PX0A 4FBTA 5GAGP 2P6UA 4DL7A 1MN8A 2NRHA 1ITGA 3FDSA 3H7IA 7ICJA 7ICPA 3HKZF 4IS7A 3SPZA 3D0PA 3KTQA 1OH8A 3TADA 4FYDA 2GOLA 4NLNA 1BI4A 1VAZA 4JN4A 5AI9A 4X66K 3CCRN 4YORA 5GIPA 1J97A 4F9OA 1DEJA 3L6QA 1DK3A 3HP9A 3VF2A 3CCJN 4DTRA 1QQ6A 3LANA 1RM6C 1BQMA 1HYZA 3UKRA 2Q36A 5AQSA 4JK9A 4IOCL 4BR9A 2F1HA 4R64A 1XSPA 4OPJA 3F73A 1NOZA 3ZT3A 4CGHA 2VG7A 1WBBA 1FJGK 4DSFA 4IJAA 2E8PA 2F2AB 2FSJA 3CCEN 4J2EA 4Q0BA 4CZMA 3K4GA 4QZDA 2P9NB 1Z3EB 1VSJA 3V9XA 2P5OA 5C12A 1NLVA 9ICTA 3DI6A 2PY5A 1YHQN 4CIFA 1RQLA 3PSIA 3LL3A 1R59O 2YNHA 5BREA 2DKXA 2ZJRL 3SQ2A 1BDGA 4AHSA 5SZTA 2XVTA 2P9PB 3ISDA 1RFQA 4U7CA 2FI1A 4ED3A 1XO0A 4KLUA 3BF1A 4YD1A 1ZQTA 4OPHA 4F5PA 2A6AA 2E3TA 1URJA 1C1CA 4ILGB 3TSQA 3RH4A 4I27A 4GLXA 4NL9A 1RYRA 4JRQA 5L1KA 4KTQA 2W9CA 3KHHA 5AI6A 3C6HA 1ZQOA 3EW9A 1BPXA 2MA1A 3E58A 1T05A 1PK1A 3AEVA 3OHRA 5AI8A 4BRGA 4A5AA 4DR5K 2IVOA 4GMJB 9ICMA 3NGDA
chains in the Genus database with same CATH topology
7ICGA 1NGBA 2J6SA 4DB3A 4CZGA 5L1LA 1M1KO 3WXKA 8ICKA 2HHSA 4GV9A 5DM6L 4UAZA 2BQRA 4ISFA 3PV8A 4QW8A 2P9IB 1N48A 5KFPA 8ICSA 4J9NA 3KHRA 3C1ZA 4B9LA 4PGQA 3U4LA 4DSKA 2BQ3A 2AQ4A 8ICXA 1ZQIA 4NXZA 2W9CB 5AQTA 3A5OC 2ATLA 3JXUA 5C2DA 4QZ9A 1D9DA 4XEIA 3O80A 1LV5A 4RWTA 2ZUCA 4JKCA 4J9OA 1JX4A 1ZQPA 1NGCA 4ELUA 5LY3A 4NY8A 5L1JA 3GE1A 1CUKA 2BPGA 5EX5A 2HHQA 1NGHA 4DOAA 1WUAA 4I2JA 1UA1A 2EWSA 1ATNA 5J2AA 4B1YB 1ZQQA 5DQGA 2FF3B 4IQTA 3HW8A 1QSYA 3O6WA 2F9WA 2HBKA 4G9ZA 2IHNA 4EZ6A 1JJ2M 1KAYA 5M1PA 3ZDAA 2KFNA 2PFQA 1MWKA 4XH4A 2ASOA 4BRNA 1KAXA 4YD2A 4I2FA 5J0PA 1E4FT 2P9SA 3K75D 5BRDA 3EYZA 1YJ9N 4JWNA 3E1YA 4HWIA 1Q7YO 2AA4A 4KH5A 5TKYA 4J8FA 3B0XA 1JCGA 3PW7A 3D7EO 4I2EA 3Q8QB 3SBGA 3MWTA 4H0PA 5AQOA 4BRFA 3U8XA 4FS1A 1COOA 3DLLL 3UQ0A 4TQRA 3LDLA 3H46O 5KFXA 4FWOA 3RJEA 3MBYA 1QVGM 4ECTA 2ALZA 5J0QA 4J9PA 3PY8A 4A2AA 5GADP 5KFAA 3JPRA 4O8UA 3PIPL 2A1JB 4MFFA 5J2KA 2PBDA 5KG4A 1X3NA 2IBKA 3D2EA 3KZBA 1QQNA 4YCXA 5DG9A 3ISBA 5KFBA 3MCPA 3P4IA 4ELTA 4B1WB 1L3SA 2P9IA 4ED8A 4JKFA 1S10A 2VWBA 4CZFA 3O1BA 2E2PA 5LJWA 1NK5A 5DKWA 2IVNA 3CJCA 4MFCA 5KG3A 5J0TA 3RJHA 1DKGD 4KMUA 4UQGA 4BGBA 2HOEA 4BRHA 3ZEUA 3C2KA 2NZTA 3LDOA 5E26A 1NJYA 2P66A 3MR6A 1ZQGA 3E9LA 3TTDA 3MFHA 4MEXA 9ICJA 1SL1A 5KG1A 1U2VA 5KFQA 1OVYA 3VEYA 1Q81O 7ICKA 1LCUA 2HVHA 3HRGA 2GWKA 3GBTA 3DAWA 3CMEN 4O3PA 4IQVA 2ISOA 3FLCO 4R65A 4IO8A 2A3ZA 3R3LA 5F0XA 1VQ6N 3G6XA 1SS6A 4H0YB 3MMVA 3TU5A 3H8WA 4CZIA 3SK3A 3EKSA 1NK0A 1BOTO 5F2RA 3MABA 1U9LA 2E1ZA 5C5JA 2OTLN 2CGKA 3Q8SB 4TUSA 4ECUA 3RB0A 4NO7A 2VGMA 3O1WA 2IA6A 3TFRA 3PW0A 1ZQHA 1QQMA 4H5VA 2W8KA 2KLAA 3KVGA 3RVCA 5AQMA 5DG8A 4ECSA 5EWFA 3CCUN 4DWIA 2W9BB 2FSKA 4WYBA 1DGKN 3RH5A 4M0AA 1LOTB 5CR4A 5KT7A 3UXNA 4RT3A 1Z05A 3C2LA 2GELA 1U4BA 3GG4A 1ZJNA 8ICUA 3H40A 4X5VA 4O5FA 3V6KA 4JHDB 2VA8A 1XC3A 2IHMA 4H03B 8ICNA 2Y1IA 1QHAA 2BUPA 3CQYA 1KSPA 1BO5O 3ZDEA 4ECVA 2QXLA 3FZLA 2AU0A 1ZQNA 7ICSA 5HMMA 4KLMA 1RPLA 4KBOA 1V9PA 3ENOA 4BQLA 4QZGA 4F4YA 3DXKB 4M6WA 2E88A 3PVXA 3GIKA 3C5GA 4BDPA 4YOTA 5DB6A 3CCQN 4B9QA 4JWMA 3NMUA 4XRHA 3TSPA 3B8AX 5KPZA 2ZJ8A 3RB4A 2PI5A 3AY9A 4JHDA 1K1QA 3C23A 5EVZA 4H5NA 5DQIA 4DF4A 3RRHA 9ICQA 5J29A 1GLDG 3UB5A 3UKRB 1Z00A 3V72A 3CCMN 4ECWA 2XC9A 2CGLA 3FZFA 5KFUA 1YITN 3G4SN 2R8IA 4YDUC 3D2EB 2Q31A 1ZQVA 4Z6EA 8ICVA 4F5OA 1XO1A 3EE9A 2ZTCA 1E4GT 1YXQA 5DBCA 2A1JA 3VGKA 4CBXA 5KPTA 2A40A 3A8YA 3GOIA 3Q7CA 4BR2A 4H0TB 4O0IA 2R8KA 2PAVA 4DQQA 4BXOA 4P2HA 3BQ2A 4R8UA 4YG2A 3J7ZO 3TPQA 2P6RA 1NMDA 5KFLA 1XS9D 1UT8A 3C1YA 4PHEA 4EFHA 4CZHA 3EPGA 8ICGA 2WFBA 5DG7A 5J0SA 3GIMA 1VQ8N 3RH6A 1ESVA 4B9NA 3QBXA 3VENA 4H5WA 3LWLA 3V7LA 1RGIA 5AQLA 4KN7A 1SKRA 4JKBA 2GWJA 3GIIA 5BRHA 5CP2A 4KLTA 4RCHA 4I2CA 4F4XA 2FLNA 1SAZA 2I7NA 1ZQUA 3CI5A 3CJ9A 3BQTA 2BDPA 3PMNA 3P38A 3NGDA 4BXOB 4NM1A 3CCLN 2NRXA 5DB9A 2ZF5O 4I28A 3AGKA 4YMNA 2JEGA 4LZGA 1ZQDA 3WXLA 4Z94A 1NBWA 1S97A 3ZD8A 4Y0WA 4I2DA 4EZ9A 1YJNN 1SKSA 3TAQA 9ICIA 5CE3A 3MN5A 4BC4A 3FZKA 3QEAZ 3PO5A 4JKGB 2JZBB 3T5KA 4BGDA 3H4BA 4YXJA 3HPOA 1GLAG 1MWMA 4BRPA 5IIIA 3N4PA 5ADXH 1S0NA 4P4MA 2R8JA 4BROA 5IIJA 3VTHA 4J9QA 2OTJN 2W8LA 4F4WA 4IDHA 1NJWA 3Q8PB 3UXPA 1ZYQA 4Z6DA 4FO0A 5GINA 4TUQA 2BCUA 4M7YA 2CGJA 3T5HA 4M6WB 4CBWA 1GLEG 1V4TA 4FWPA 2HHXA 4O3SA 1VQ7N 5J2CA 1XUPO 5BRFA 3EWAA 2HW3A 1NGFA 5J2JA 1JXLA 5KT2A 2NRZA 3I55N 3G71N 4PL7A 4M7XA 4BG8A 1ATSA 1U49A 4Q8EA 4RUCA 1KFDA 3PO4A 4GXJA 4M47A 3CCVN 1ZXOA 4DFMA 4JKHA 1HX1A 3H4DA 4I2IA 8ICTA 4JK1A 2PXIA 4XH5A 1MQ2A 4IQUA 7ICFA 4M2YA 1CEZA 3AAPA 2Q0ZX 3M1FA 4GVEA 5D49A 4EYIB 2YHXA 5AFUA 4LVSA 4DL6A 4NB4A 2Q97A 1S0OA 4ECZA 8ICLA 4IXCA 4ED7A 4YR2A 3SAHA 2ASLA 9ICGA 3O5BA 4ISGA 2B21A 5TKWA 3RSEA 1KAZA 4DQIA 1KTQA 4KLJA 2FSNA 3CF5L 3OSPA 3HOTA 1JXEA 3CHWA 4FWRA 4R63A 3ETLA 4JKDA 5IIKA 4F2SA 2KHOA 1LB2B 3GV5B 2QWMA 1NJXA 4PKIA 2W9MA 4JKAA 4ZH4A 4RNNA 4KLLA 5C15A 3A0IX 5AQFA 4K42A 9ICEA 2E2QA 1BPBA 1BPYA 3LDNA 4K43A 2YCHA 4B1UB 5AQZA 8ICPA 2F9TA 3F2KA 4BC5A 4C8LA 4ED0A 3CPEA 3G6VA 2PFPA 1MA9B 1GLCG 5BPMA 1EQYA 8ICRA 4BRLA 4YOVA 4O5KA 2QW9A 3THVA 1TUUA 4F5QA 3SJHA 2ZUDA 2DPJA 4UB5A 3GFKB 3Q8MA 2HF4A 3PIOL 3G6EN 4CCHA 3O9SA 4BC3A 4IR1A 4BQZA 4ECYA 1L3UA 1ZBSA 1UT5A 1QZ5A 4ECXA 3S41A 2D0OA 1P90A 5AQQA 1JCEA 5J2BA 3F9MA 4NLGA 4YOYA 1VQMN 1BA1A 3AAQA 3CQXA 3Q8RB 3CJAA 4H5RA 4RQ5A 4C8NA 2IVPA 1MC8A 4YXMA 2ZJAA 9ICCA 1X2IA 3SV3A 3ATUA 1HKCA 2DFLA 4UB2A 4DO9A 3ID8A 4FSVA 4KLQA 4QS9A 3VMFB 3CCSN 4B9VA 4K25A 2F1JA 4BRCA 7ICHA 3MWPA 5JVGL 3OHAA 3A5MC 5DB7A 1KLNA 2E1YA 3SI8A 1IJJA 5HL7L 3BEXA 4RZRA 3ULEA 4PHTX 4TURA 4E0DA 4M04A 5AQYA 3UKUB 4GV3A 1YVNA 3A5LC 3I33A 4KH4A 5CR0A 2CH6A 4B1VA 3RBEA 3CJ7A 2NLXA 4UAWA 1HUXA 5DBBA 5AQNA 1ATRA 1ZQLA 1N8RO 3U9ZA 2UVWA 3OBYA 1U48A 3BP8A 4WFNL 1ZQJA 3DWLA 5CWRA 4JD2B 3MN7A 4MF2A 4UBBA 5AQHA 2E8AA 4F2RA 3GV8B 2Y1JA 5KFRA 4RNMA 5BOMA 1U45A 1Q82O 3D2FA 1X9MA 4YFKA 3UQ2A 1QTMA 4JUZA 9ICOA 1QLNA 4PHAA 2RE2A 3VGLA 2AGPA 2Q2RA 3AU2A 2AQ0A 4H0OA 9ICNA 5KFEA 3LDAA 2VANA 3MDAA 1QVFM 4IRDA 3GILA 3CC4N 3DXMB 4O5EA 1VQLN 5AQXA 1VQ4N 3ZDDA 3VEZA 4PKGA 1NJZA 1YF5L 3ZEUB 4EEYA 5GIOA 3EZ5A 5BPLA 1V4SA 8ICMA 3E9PA 1K1SA 4U67L 4QZAA 4H0XB 4Q44A 2ZUBA 5DLGA 5DDMA 2H5XA 2KKZA 1VQKN 4M9HA 2ITMA 2ZJPL 3GDQA 4KLGA 4I2BA 2I1QA 1U6ZA 3C7NA 3GV7B 1GLFO 1XQSC 3O9RA 2BCSA 4MDAA 3VPZA 1MSWD 3QEBZ 4RPYA 2BKEA 1BPZA 2AGOA 4I2HA 4KLSA 1D8YA 4FS2A 1YIJN 2RDJA 1KRPA 1MQ3A 5LJVA 2W9AA 1SZPA 4EBCA 3LDPA 4DSLA 4WQ4C 2XY5A 3OHBA 3PW5A 5M1NA 4MO5A 3VEXA 1ZC6A 2ASJA 1QQOA 3JPQA 3MR2A 3RJGA 1ZQAA 5HOOA 4DHYA 2P9UB 1DOQA 4RQ1A 5C10A 1SQKA 3MN6A 2GUPA 2XY7A 5BOLA 3WUHA 1K73O 5HHHA 3TFSA 4IRCA 5BN8A 2VCPA 5HNKA 4EHUA 9ICSA 3O9UA 4M63C 3LDQA 2YJEA 3TI0A 2HHWA 4DQ8A 3MX5A 3QMLA 1T44A 3MR3A 3ZD9A 2GWSA 4QZIA 4K4HA 4A59A 4O3QA 3RRGA 1UA0A 3RB6A 3FGUA 4A62A 4DOCA 4WFBL 4J9SA 4CI6A 2V4RA 4DFJA 3UPQA 2HVIA 9ICXA 2PI4A 3HT3A 3TARA 3ZX3A 2F7TA 1TYQA 3Q8LA 4PH5A 5FPDA 2BTFA 8ICWA 3NVKA 3ZDCA 2D1KA 1WCNA 4F93B 4DLEA 1TK5A 1RXWA 1DT9A 7ICOA 3E66A 5KQ8A 1TFRA 8ICQA 5C2FA 1D8LA 3O9QA 2QWRA 4QWAA 4YR0A 2A5XA 3J8AA 3EPIA 5E84A 5AQGA 3M9MB 3MCAB 1W2BM 3RJJA 4F4KA 1O13A 7ICIA 3R8EA 5KG7A 2XGQA 3ZDBA 5JICA 9ICBA 3C7NB 1M90O 3C6AA 3HTVA 1JN3A 2R8GA 3AUOA 3H8SA 3Q7BA 1TKDA 3VGMA 5HMLA 2GEMA 2D4WA 4QZFA 4UB3A 4B1XB 4RT2A 5J2HA 2PFOA 1PZNA 4FWQA 4XA5A 5BN9A 4DCHA 3WXIA 3DXMA 4O8KA 3D6RA 3K9JA 3TQ1A 1S3XA 2FPLA 1ZQKA 3BUZB 1IG8A 4GC7A 5FPNA 4JV2A 4DL5A 4DSEA 3E9OA 4MEYA 2XCPA 3AU6A 2P9NA 4JKEA 4MO4A 2KZZA 4C8MA 3RAQA 5KG5A 2AP1A 2NNWA 3IKMA 2P9PA 3P39A 4C8OA 3G25A 4IJNA 9ICVA 3CETA 3OA9A 4BR0A 4JD2A 5KFIA 5J0UA 4I29A 1ILYA 4PKHA 4YP3A 1X9WA 3HOSA 1H38A 3VF6A 1HJPA 4IEIA 1SKWA 4DQPA 3OBWA 1U2VB 3ID6A 4PPXA 3RB3A 4UB1A 2P9KB 2QEXN 1KEJA 2I9GA 2MUTB 1X3MA 1NGJA 4DSJA 7ICEA 2P9LA 4FPAA 1EO1A 2V4QA 2OWOA 3T5LA 2BGWA 5KFNA 5D4BA 4QZCA 3T3FA 3UE5A 4J9MA 4QZBA 3CC2N 4P4OA 1HKGA 4I6MA 2WUSA 1CZAN 7ICTA 4NLCA 2C22A 2HBJA 3KHYA 1NKBA 3FYHA 7ICLA 5KT5A 1QSSA 2BPCA 5F9NA 4CBUA 3P31A 4YMOA 4QWEA 4C23A 3M3ZA 5GAEP 1BU6O 5FPMA 5KG6A 1BA0A 5AQKA 2YI1A 5BPNA 5J2EA 4F5NA 3H6EA 4DOBA 3DJCA 1T3NA 4CZJA 2J6UA 1N56A 2YX6A 2RDIA 5BR9A 4C1NK 4BC2A 1NGDA 5IILA 4EIAA 3M6GA 2FLLA 1S22A 2FMPA 9ICKA 2PFUA 3HZ6A 5ELZA 5F9LA 5CHIA 5KFZA 3BF3A 4IRKA 1L3VA 3U9DA 7ICMA 3OJUA 3RSEB 2C2RA 1ZQBA 3FFKB 3QE9Y 2J6TA 4JK8A 3CIPA 2YHWA 3R9PA 3AARA 1RZTA 4RQ0A 3TANA 2D0PA 1H1VA 1Y64A 9ICAA 2NRVA 1YJWN 3VESA 2KTQA 2C2EA 4FOEA 4UY8O 2VA3A 3F5TA 3IMXA 4DSIA 4BRKA 2Q0UA 5DGBA 3ZYYX 4R8UB 2NRWA 4ECRA 4C1NI 1BPEA 3NVMA 4JK9A 5KFHA 1TVAA 3QICA 4KN4A 3QZ7A 2MAXA 3PLAA 4ECQA 3V7KA 4K41A 4GXKA 3N4MB 3RAXA 8ICEA 4Q45A 4JK7A 3EKUA 4YR3A 1U47A 3L4QA 2ZJQL 1QSLA 2BCVA 9ICWA 1ZQEA 4BVPA 4IWVA 2PFNA 1S0VA 2Q1NA 1D4XA 3A5NC 1C7YA 2FLPA 4B9MA 3IHQB 3SV4A 4WQ4A 1Z6RA 4DF8A 5KG0A 2HBLA 2IMWP 1P8ZA 4F92B 3RJFA 1BVSA 3HSCA 5AZJA 3NTUA 2QA4N 5M1KA 4R66A 3PW2A 3KWGA 1B43A 5KFFA 4PHPA 1NJIO 2ZGYA 1NK9A 3OSNA 2J4RA 8ICYA 2XY6A 2OANA 7ICVA 3L4IA 5KPRA 3LWMA 4AM6A 2P9KA 2LYHA 2H3GX 3HP6A 4Z6FA 4BRIA 3PW4A 1TK8A 3RR7A 3LM2A 4YN4A 8ICIA 3LK9A 5JMVA 5FPEA 5M1OA 4DS4A 3EL2A 3QB0A 3WQUA 4MLHA 4PGXA 4MF8A 4OPAA 3TTCA 4WQ5A 5JVHL 2BR0A 1TYQB 4JNEA 3I56N 5L9XA 2P9LB 4QWBA 4JAXA 8ICZA 4EBDA 4GXIA 1K9MO 4P4PA 1TUYA 1QZ6A 3M5RA 1GLJO 4RNOA 1TV9A 2JZBA 1JMSA 1HPMA 3IDHA 3KHLA 4DS5A 3CMAN 5AFUH 5H1SQ 3H1QA 3H3NO 2NRRA 3TSUA 3BDPA 3ZETB 3CD6N 1YUWA 1KFSA 2MUTA 5KT3A 1GLBG 1HLUA 2DPNA 3SZ2A 1S9FA 5KFVA 9ICHA 3PX4A 1K8AO 4FWLA 3UKUA 4ED6A 1YAGA 7ICRA 1T7PA 4CZEA 7ICUA 2VGNA 3O9TA 4QZ8A 3ISCA 2M9NA 4NM2A 5ADXA 4FVUA 3RJKA 5AQWA 2V52B 2QWNA 5GAHP 1ZQSA 3VF4A 1HUZA 2QI2A 1TK0A 1Z00B 3ORYA 3HWTA 3N97B 4KH6A 3H45C 3SBTA 5AQIA 5CA7A 1GLLO 2AGQA 1BG3A 4IO9L 3OGUA 1K8KB 2BH1A 3JPSA 4GV6A 1NGGA 2ZGZA 3CC7N 5DB8A 4EAHD 5KFJA 4DL3A 4RQ8A 9ICPA 3VETA 1OKJA 4QWCA 3HM8A 1DGSA 2V7ZA 3V7JA 4R79A 5J2DA 4FO6A 5MLCQ 2GX9A 1NK8A 5J2FA 2FPMA 2JEFA 2QWLA 3MGHA 4C8KA 3KK7A 4DLGA 5I9EB 5CHGA 3EE8A 3PNCA 3JPTA 4QZEA 3I8BA 1KDHA 1T8EA 1ZQFA 1BUPA 4FOIA 3IFRA 4F5RA 3MK6A 3C2MA 4BWMA 3PR5B 2QTDA 3VERA 1VQNN 1D9FA 4I2AA 4J9KA 3IUCA 2IIRA 3UXOA 3JPPA 4M9GA 2E2OA 1KD1O 4O3RA 1HUOA 5HP4A 5JLHA 3JS6A 3G6YA 4RU9A 4RPZA 3V6JA 4YOXA 4DL4A 1C0FA 1NK6A 4G3IA 4BR5A 2YHYA 1ZETA 4ED2A 3SMPA 4IOXA 2BCQA 2QM1A 2ZTEA 5HHIA 4B1ZA 2Q0RA 5DDYA 1YI2N 5EOYA 1XWLA 2BPFA 5KG2A 2W40A