2NRXA

Crystal structure of the c-terminal half of uvrc, in the presence of sulfate molecules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
b'GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 75
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrxA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrxA01
1X2IA 4DFPA 1NK4A 9ICRA 4I2HA 5KT7A 8ICIA 3MGIA 3T5LA 1NK7A 4I2BA 4I2AA 5CB1A 1ZQJA 2HHSA 2ZJAA 5KG6A 4Q44A 2DPJA 3MABA 4O3NA 4DFKA 4IQWA 1BPBA 1TKDA 4QZDA 4DFJA 3ZDDA 4DOAA 3RJIA 3KHHA 1SKRA 4KLMA 4YD2A 2F1JA 3MFHA 5CJ7A 4ED1A 4B9LA 4Q8EA 2ZUDA 1TV9A 1RXVA 1ZQYA 4EYIB 4RNMA 4RQ4A 4M9LA 3RH4A 4E0DA 2XCAA 5J2EA 4RNOA 4DSLA 5EWGA 4ECZA 4ED6A 4RZRA 3RB0A 4F4KA 5KFUA 4DOCA 4O3QA 8ICVA 1TAUA 5JUMA 4RQ6A 4YCXA 3GIJA 1HUZA 4KLDA 3MR5A 2W8LA 8ICEA 4QZHA 2NRZA 8ICTA 4DL7A 1XSPA 2AGQA 3RJHA 3ISCA 1A77A 1MQ2A 4R63A 5CR0A 3UXNA 4YD1A 3PX0A 4PH5A 5KFTA 4GXIA 2JEJA 4I2EA 5D4BA 2C22A 4O5CA 2HHTA 2XY6A 1NJXA 2F1HA 3OSNA 4M9NA 4GXKA 4EZ6A 2UVUA 2P66A 4RT2A 3OJSA 4MF2A 2M9NA 4F5QA 3PO4A 3IM1A 2BCUA 4DQSA 1XU4A 2F1IA 4IR1A 2P6UA 8ICGA 4P2HA 2R8HA 1S10A 4EBCA 9ICFA 4YN4A 1BVSA 5IIIA 4QWCA 4TURA 4B9UA 2MAXA 4XRHA 1CUKA 4P4OA 4I2DA 4DF4A 4KTQA 5C5JA 5KFXA 1ZQTA 4J9MA 2W9MA 3C2MA 3V6KA 4RQ2A 5DDYA 2AQ4A 1SKSA 5KFZA 2IMWP 4F93B 2I1QA 4Z6DA 4I2GA 2PFOA 4Z6EA 1XS9D 4KITB 4F5RA 4B9SA 2FPLA 4MFAA 4J9LA 4O3OA 3QEAZ 4BGDA 2V4RA 5DBAA 4QWAA 2Y1JA 4DQIA 3JPPA 4RPYA 4TUQA 3MGHA 5J2IA 4GC6A 5KFDA 4UAYA 2XY5A 1S9FA 2BCRA 4QZ9A 3HT3A 1MSWD 5IIJA 4DEZA 3N4MB 3LWLA 3RBEA 9ICMA 3ETLA 5DLFA 3AU6A 2LYHA 3PW5A 3SV4A 5KFKA 1NK9A 5J0PA 4F92B 4R64A 4BXOA 3Q8KA 4PGYA 2BPGA 2NRRA 4M9GA 3V7LA 5J0WA 3KHGA 1ZQDA 3BDPA 4UBCA 5J0UA 3GIIA 4YP3A 7ICQA 4F91B 3AUOA 2BHNA 3H7IA 3TANA 1BPYA 4ELVA 1S0NA 9ICEA 4J9SA 1KSPA 4ED2A 4F4YA 3SI8A 3RH6A 1WCLA 5J2AA 3RAXA 3ZDAA 3C65A 3HX0A 5F9LA 3H4DA 1NKEA 1HJPA 9ICOA 3JPOA 3C23A 2XY7A 1UT8A 4I28A 3PX4A 2BDPA 2FMSA 2KFZA 2KTQA 1V9PA 4C8LA 2C2RA 5KFWA 7ICPA 1ZQHA 4R8UA 3BQ0A 4F4ZA 2NRXA 4TUSA 3RB3A 5DB7A 3GV7B 4YVZA 4DSKA 4C8OA 2FMQA 4J9KA 4KMUA 3RB4A 4KLOA 1UA0A 9ICAA 1B22A 3TAQA 4K4GA 4GLXA 1KEJA 2BPCA 2W9BA 3T5HA 3PY8A 4QWBA 5KFEA 4R66A 4I2JA 8ICZA 9ICHA 1ZQZA 5J0YA 3G6XA 4C8NA 2W9CA 4UB3A 2FLNA 2JEFA 5IIKA 5J2CA 4YMNA 3H8SA 1X9MA 1JXLA 2ISOA 4K4IA 1ZYQA 5DB8A 1NK6A 4ECQA 3PW0A 5J0XA 2BQRA 1SL2A 2FLPA 3SYZA 1DGSA 7ICUA 3Q8QB 8ICFA 5KFVA 5KFYA 3RJKA 4YR3A 4DL4A 1ZQIA 1D9FA 5J2BA 4J9QA 4G3IA 1KFDA 4J9RA 3M9NB 2C2DA 1ZQFA 4Z6FA 1JXEA 1ZQUA 4GC7A 2PI4A 4UB1A 4QZEA 4J9OA 2AJQA 2UVWA 1NJWA 1T4GA 2JEGA 4KLJA 1S0VA 3AU2A 5L1KA 2IBKA 4KLSA 1BPEA 3QE9Y 5EWFA 2BCVA 9ICNA 3UXOA 4JUZA 1L3TA 3ZD9A 4DLGA 4MF8A 2W9BB 1X9SA 9ICQA 3GIKA 2XO7A 5KG4A 7ICKA 4YMOA 4LZGA 1QSLA 1K1SA 3FDSA 5KT4A 3C5FA 5J2KA 3H8JA 5KT2A 1U49A 2JEIA 4MFFA 2W9CB 5D49A 4EYHB 4NLKA 1NOMA 3TI0A 1XSLA 2UVRA 1ZQOA 3RJGA 7ICHA 2KZZA 7ICLA 1QSSA 4RNNA 2ZTEA 4UBBA 5KFLA 5DQIA 4ECWA 1ZETA 4EBDA 9ICKA 4DSJA 4M2YA 4O3PA 4YG2A 2V4QA 1U4BA 8ICBA 3JPTA 5DQGA 3E2EA 2AU0A 3JPSA 1ZQVA 2ASDA 1C7YA 4RQ5A 4ECYA 2KZ3A 4GXJA 4KN7A 4YQWA 3RRGA 1H38A 4F2SA 3RTVA 5EOZA 2OWOA 4IR9A 4I2CA 2HHUA 5DBBA 4EBEA 2HHVA 3EW9A 9ICXA 5J0OA 1NJZA 5L1JA 4UQGA 2B21A 4YXMA 3MR2A 4FS1A 1K1QA 5BOMA 1TAQA 9ICWA 2MUTA 2J6TA 1T7PA 5HHHA 7ICMA 5J0QA 5J2JA 3EPIA 1KLNA 2KN7A 5KFJA 8ICAA 2AGOA 4ECXA 1WCNA 4UAWA 4O3RA 7ICVA 4RT3A 2J6SA 1JIHA 1ZQNA 4RPZA 5KFAA 2NRWA 1ZQEA 2V9WA 4I2FA 3ISDA 3MDCA 2GWSA 3PX6A 5F9NA 5HMMA 2C2EA 5J0RA 4B9NA 3PVXA 8ICPA 3IHQB 4RUAA 3PNCA 3M8SA 2HVIA 3OSPA 7ICRA 4ED7A 4DL3A 1NKCA 1KTQA 5L9XA 3GIMA 3KHRA 5KFOA 1L3SA 1NJYA 4M9JA 4KLUA 4O5EA 1TK5A 4DFMA 4MEYA 5KFCA 3BJYA 1JN3A 3OGUA 4QZCA 1LV5A 2XGPA 3ZDCA 4Q8FA 4JV1A 3JPNA 1BPXA 5DDMA 1TK0A 1IM4A 2NRTA 2ZJ5A 3UQ0A 2VA3A 4DO9A 4ED0A 3RR7A 4RUCA 5KG5A 2FLLA 3GV8B 2JZBA 2HHXA 2MUTB 5KFQA 4F50A 1D8LA 2ZTDA 3LDAA 3T3FA 8ICOA 4EEYA 3RRHA 3QEBZ 9ICCA 5D46A 5KFMA 4PHDA 5L1LA 1T3NA 4IRDA 4NY8A 4QZGA 4MEXA 4B9TA 3G6VA 3BQ2A 3K75D 2BCQA 2J6UA 4EZ9A 2HHQA 3PW4A 1UT5A 1SZPA 3TQ1A 9ICPA 1A76A 3K4GA 3EYZA 3UQ2A 3T5JA 1TVAA 4KLLA 1QTMA 4NLZA 2PI5A 3C1YA 3B0YA 5KFFA 4ED8A 4F5NA 4DSFA 1L5UA 2ASJA 4O0IA 3V72A 4BXOB 4DSEA 5J2FA 3PR4A 3M8RA 4IRCA 1RYSA 2BPFA 4QW8A 4YR0A 1COOA 3QZ7A 1ZQAA 3KHLA 3HWTA 4HYKA 4YXJA 4ED3A 1L3UA 8ICLA 3H8WA 3EZ5A 3ISBA 9ICTA 1S77D 3RB6A 5BOLA 5CA7A 2ISPA 4O5KA 1ZQBA 3Q8MA 4LVSA 4IQTA 5J0SA 3M9MB 2W8KA 4ECTA 1CEZA 1MC8A 4YFKA 3C5GA 4B9VA 3N97B 3TAPA 4KN4A 4QZ8A 1XSNA 3OHBA 4F4XA 4KLFA 2BQ3A 4KLIA 3G6YA 4I29A 4QZFA 2HHWA 5KG0A 4R8UB 3HW8A 2KZMA 2Q0ZX 5L1IA 5DGBA 4J9PA 9ICVA 2ALZA 3C21A 4I2IA 1BPZA 4DWIA 3UXPA 4X5VA 2P6RA 7ICFA 5IILA 4FS2A 4RQ7A 9ICIA 1ZQWA 2R8KA 2ZUBA 4O9MA 1KRPA 4TUPA 4NLGA 1ZQLA 8ICQA 2WTFA 2Y1IA 2H5XA 3PV8A 1ZQKA 3V6HA 2AQ0A 3PW2A 1U9LA 9ICBA 4KLTA 3SZ2A 1ZQGA 4JV2A 5KG7A 5DLGA 1ZJMA 3MFIA 4DLEA 1RZTA 2IHNA 4DQRA 4JWMA 4QWDA 3LK9A 4F8RA 4NM1A 2BKEA 1N56A 3PO5A 2ZUCA 3T5KA 5KT5A 4QZBA 4B9MA 3FYHA 8ICRA 1BGXT 1T8EA 2VA2A 4CCHA 2NRVA 4DS4A 3RH5A 4QZAA 4KLQA 2VA8A 3V7KA 3C1ZA 2R8IA 4DL6A 5DG7A 2BR0A 3Q8PB 3PMNA 4IRKA 3HP6A 3LWMA 5IIOA 2ASLA 2C28A 5DBCA 4M6WA 4RQ1A 1ZQSA 3RJEA 3RBDA 7ICSA 1B43A 3PMLA 5IIMA 4K4HA 3OHAA 5IINA 5KFBA 3GQCA 4RQ8A 3Q8LA 1ZQCA 4UAZA 1DOQA 8ICHA 3MBYA 3C2LA 4PHAA 5J2GA 9ICUA 1SKWA 5KT6A 1S0MA 5KFSA 5CHGA 3M9OB 5KG2A 2HVHA 4UB4A 4NXZA 5HHIA 1IXRA 1U47A 2R8JA 2HW3A 2RDJA 2VANA 4RU9A 2IA6A 7ICGA 2AGPA 1Z3EB 3GFKB 3EPGA 1QLNA 2UVVA 4ECVA 2DPIA 1QSYA 5DG9A 2ZJ8A 4IQVA 3NGDA 1U48A 3NTUA 2FPMA 3ZDEA 4ECRA 4DQQA 1ZQRA 7ICOA 1XWLA 4M47A 1AROP 2PFQA 5TZVA 4DSIA 1ZQXA 4JV0A 4DS5A 8ICYA 2BCSA 8ICXA 1LB2B 1TK8A 4BWMA 4YMMA 4PHEA 4NLNA 4M04A 4QWEA 3BQ1A 1BPDA 3RR8A 4PPXA 3RJFA 1ZQQA 4ECSA 2W9AA 3UPQA 2PFPA 3RJJA 4O3SA 3Q8RB 1XO1A 4PGQA 3MDAA 4DQPA 3B0XA 1KDHA 7ICEA 4DOBA 5DB6A 4ZH4A 1JX4A 5KFNA 3QZ8A 4F5OA 4M6WB 5DG8A 1ZJNA 1EXNA 4XA5A 3PR5B 2BGWA 5DQHA 1NKBA 4F2RA 2PFNA 4ECUA 1RPLA 1UA1A 1N48A 7ICIA 2KFNA 4RPXA 3H40A 1X9WA 1Z00A 4QZIA 5BPCA 3ZDBA 8ICCA 3C2KA 4PHPA 4R65A 2IHMA 4Q45A 3JPQA 3GV5B 3THVA 4F3OA 4ELTA 2BQUA 4IQUA 5KFIA 5J2HA 4P4MA 4MFCA 5EWEA 4JWNA 4RQ0A 2FMPA 5HP4A 4QW9A 1NK0A 4RQ3A 5HMLA 3TARA 1ZQPA 5KG1A 5KG3A 2DFLA 7ICJA 2PXIA 2A1JA 8ICSA 1Y88A 5DKWA 4NM2A 2FPKA 4UB2A 4F5PA 1NK5A 5DB9A 9ICLA 3EWAA 1MQ3A 5KTQA 1RYRA 2I9GA 5J2DA 3SV3A 3JPRA 4FBUA 1S76D 3ZD8A 4KLEA 3TFSA 3ORYA 1JMSA 2RDIA 5KFPA 4LZDA 5J29A 3GILA 5CWRA 3TFRA 5CP2A 4C8MA 1NK8A 8ICUA 4J9NA 4FBTA 3OJUA 3PW7A 3MR6A 1PZNA 3V6JA 4KLGA 1HUOA 3MR3A 4YR2A 4PGXA 1RXWA 1S97A 3RAQA 4TQRA 3V7JA 4XUSA 3KTQA 1TFRA 4DL2A 1KFTA 1Z00B 3BQTA 3Q8SB 4DL5A 1ZQMA 8ICWA 1SL0A 4BWJA 1D9DA 4JK1A 1XC9A 4C8KA 1U45A 2JZBB 2ZTCA 2XGQA 5KFHA 5DGAA 5HNKA 4Z6CA 1D8YA 5J0TA 4M9HA 8ICJA 9ICJA 1SL1A 4M0AA 2XC9A 4P4PA 3GDXA 1KFSA 8ICKA 7ICTA 4ELUA 8ICMA 4UB5A 2R8GA 2ATLA 5KT3A 2XCPA 3HPOA 5KFRA 9ICSA 4FO6A 2A1JB 4XQ8A 5KFGA 4F4WA 4DF8A 3H4BA 4BDPA 9ICGA 4TQSA 8ICNA 4I27A 4KLHA 1S0OA 4Q43A 7ICNA 1L3VA
chains in the Genus database with same CATH superfamily
5JMVA 1NK4A 2EZZA 4CZJA 1S72N 4GFJA 5CZ1A 3MGIA 3VQEA 1N32K 3T5LA 1NK7A 4I2BA 4FZNA 4CEFA 4DR4K 2HHSA 2A1AA 4N5SA 3OY9A 3AMZA 1V85A 4Q44A 4C23A 3M7DA 4IQWA 1UAXA 1W0HA 2BUPA 1DXSA 5JLHA 4DOAA 2QWPA 3I0RA 4NO7A 3ZCMA 1TYQA 2F1JA 3MFHA 5CJ7A 5DM6L 4B9LA 4QNLA 3SMPA 2ZUDA 1RXVA 4AHCA 4NV0A 3SNNA 4M9LA 2K8BB 4RW7A 4US9A 3ATVA 4RNOA 2E20A 4DR7K 4ECZA 4ED6A 5C12A 4LFAK 4DR1K 4DOCA 1C6VA 3F73A 4O3QA 8ICVA 3HSTB 4B1UB 5GIPA 2ODGA 2RF2A 4E1NA 3MR5A 5GTIU 2W8LA 4QZHA 2Y0SC 4JKGA 4DL7A 3AEVA 3RJHA 4R63A 2JLEA 2OXOA 5LMUK 3RMBA 4YD1A 1PK1A 5AQVA 3CD6N 3DYAA 3KZBA 5KFTA 3C6HA 3CJ7A 4RG8A 2C22A 4O5CA 2HHTA 4FM2A 2QARB 1FW6A 3VQ5A 1EETA 1HYVA 4RT2A 3OJSA 4MF2A 2IVOA 2CPRA 3KK2A 3PO4A 3ZEUB 2D0PA 4XH4A 4WCEL 4CJUA 4UY8O 2O8FA 2R8HA 1Y64A 2FSJA 4CNQA 2GWKA 3KKRA 4EP5A 2VQFK 2MAXA 3NRZA 1E3MA 3ASMA 4KTQA 4AHTA 5I9EB 5C5JA 5KFXA 1DRGA 4J9MA 4RQ2A 1NGJA 3H3OB 2OTJN 1IBLK 4PKHA 4RW8A 1GLCG 4EAHD 3K58A 3SQ4A 3SUPA 2PFOA 4IXCA 3RMDA 3BS7A 4B9SA 2E88A 3J7ZO 4J9LA 4IS7A 2YNFA 5FLXO 4BGDA 4BC2A 5C24A 1RYUA 3HOTA 4DUZK 5ALTA 4QWAA 3I55N 2RP5A 5KAIU 2XHBA 3VEWA 1YJWN 3D6JA 3CM5A 1LKYA 4FE3A 4CD1A 2DUYA 4E7LA 1WWUA 4GC6A 5KFDA 2BCRA 1MSWD 1JL2A 1X9JA 1CXQA 1ASUA 4UAVA 9ICMA 4BRKA 2LYHA 3UMCA 3NUQA 3PW5A 1DTQA 2QB0A 2JXJA 2E5LK 3PSTA 3SV4A 3ITHA 1REVA 5J0PA 4F92B 3Q8KA 1K9MO 5J0WA 5ALPA 3BZCA 3WK6A 4PL1A 3KHGA 2FLOA 4Z4CA 4M3TA 3K59A 2P5GA 3BY5A 3GIIA 4NCBA 4F91B 3AUOA 1Q3UA 1JCGA 1UQVA 4ELVA 4RQNA 3RH6A 2ES6A 1MU2A 1WCLA 3RAXA 3KZXA 4FOEA 4CBUA 1JRPA 3H4DA 1NKEA 9ICOA 2O6KA 4BE0A 3JPOA 1FO4A 3QB0A 3I8DA 1UT8A 4JMUA 3PX4A 2XY8A 2ZIUA 1MDUB 1S5JA 1VQ7N 2YX8A 5KFWA 4K8XA 2VYPA 3CERA 1YZ7A 3LP2A 5J1EA 4GVMA 1KKXA 3QU5A 4YVZA 4Y2RA 2FMQA 5KRSA 3OYAA 3RB4A 1V38A 3FC4A 1CRXA 4FWOA 3MEDA 5AHXA 1D5AA 1KEJA 5AKJA 4OJPA 2YV0X 5KFEA 3I56N 2B4JA 3DRRA 2P9NB 3M3ZA 1U04A 3F9KA 4CHZA 1ZQZA 4M7XA 3ZT4A 1SV0A 2JEFA 2QXLA 3H8SA 1JXLA 4OVLA 1NK6A 5FP0A 3TPQA 1SL2A 3QO9A 2FLPA 3Q8QB 3V81A 3A5MC 4FK2A 4DL4A 1ZQIA 4OGEA 1D9FA 4CJTA 1ZBFA 5J8YA 3WK5A 2QM1A 3PUFA 4J9RA 1CI4A 5AKIA 4M7YA 4CHPA 5JVGL 3P4IA 3HJEA 3WU2U 1ZQFA 4Z6FA 1VSFA 2FSKA 4F9OA 2EZYA 4GC7A 3R1XA 4UB1A 3AN1A 1Q81O 1ZC6A 4FJIA 3THYA 2H3ZA 3HBTA 3M6ZA 5ALOA 2IBKA 4KLSA 4IOXA 2UUCK 2YMQA 2YI1A 3AVJA 3LAMA 4Z4EA 3LVVA 3L4QA 2W9BB 1Z05A 2CH6A 3AO2A 1X9SA 9ICQA 2NLXA 5H1SQ 1DT9A 1QSLA 3JYTA 3C5FA 5J2KA 2A5XA 4Y2SA 1WG8A 3TTCA 2RLTA 1YJ9N 1U49A 2JEIA 2X6NA 2CN1A 2W9CB 5D49A 4IFYA 4EYHB 4CF4A 2RQ5A 2UVRA 1ZQOA 3EE8A 3RJGA 3VEVA 1ATRA 3O9TA 5AQZA 4A5AA 7ICLA 3M6GA 2OYYA 4RWTA 1BI4B 4UBBA 4RNNA 4ECWA 5DQIA 1B0XA 1RDBA 4GW6A 4P0PA 1C1AA 1S9EA 2FXUA 4M2YA 4BG8A 1ASWA 3HO1A 2V4QA 3CMEN 3FFKB 1MA7A 1BWFO 2W3RA 1HX1A 3T1HK 1X1PA 3JPSA 3K0SA 1FFVA 3UB5A 4YOYA 4RQ5A 1HPZA 4KHNA 2W43A 2GLEA 4A2AA 4YQWA 3P38A 3DJCA 2HHUA 1NU0A 3RTVA 4CZGA 5DBBA 1IKWA 5J0OA 3B6PA 4YXMA 4FK4A 2F7TA 1TAQA 1V4TA 5AFUH 1RFQA 4CZHA 7ICMA 3N4PA 3EPIA 3QMLA 1KLNA 4XH1A 3F2KA 3WXKA 3QNMA 3AVNA 2A3ZA 1N33K 4RT3A 1CLQA 4DV6K 4BDYA 1ZQNA 2KE7A 3E0FA 4JRPA 3GU3A 2NRWA 5AQNA 3MDCA 2P9LA 5F9NA 3WK9A 4M45A 5C10A 5F1XA 4EEKA 5KGWA 4RUAA 4C4SA 2ZXHA 3QNOA 3TAFA 4DL3A 2G8WA 5L9XA 3GIMA 1CZAN 4E1MA 1L3SA 4JKHA 1NJYA 1I39A 3CQYA 4KLUA 4I9QA 4O5EA 1VLBA 3C6TA 3OGUA 1OH7A 2KNJA 3D2FB 5CE3A 2O8BA 4Q8FA 1Z26A 5G5GA 1RBVA 5DDMA 4CJRA 2LHTA 3I0SA 4DO9A 4ED0A 2EZXA 2ZIXB 1RTHA 1PUZA 2YY6A 2ZTDA 2I5JA 1RBSA 3O4WA 4ILHA 3RRHA 1UCVA 5D46A 1T3NA 4NY8A 2E2OA 5ADXA 4QZGA 4MEXA 4B9TA 1LWCA 1OVQA 3ID6A 3RVCA 3BQ2A 4U7CA 2IC3A 3HPHA 3MN5A 2BCQA 4PL8A 3OW2M 3ALRA 4K8ZA 1J5EK 4EZ9A 1SWVA 1KVCA 2NUBA 1NOYA 3KWGA 1P8ZA 2KVCA 3UQ2A 2DF4B 2W6KA 1QTMA 2B6GA 1UPHA 2GOLA 4WFBL 4WQ5C 4ISGA 3AO3A 4G9ZA 4F5NA 1YI2N 3O6WA 1JLCA 5HRNA 3L2RA 1L5UA 4KTZA 3VF6A 5C42A 3DOLA 4DSEA 3QIPA 3U9DA 5J2FA 4F3TA 2BPFA 4YR0A 1COOA 2KSOB 3UKUB 4CJWA 3HRDD 1ZBSA 4IG3A 1L3UA 4AHVA 5AI6A 1RDFA 5CYQA 2Z1IA 2AHOB 3R9KA 4ICAA 3D7EO 3OA9A 5CA7A 1KC8O 4DV2K 5ALXA 1K8KA 3H8MA 4PZNA 3MN7A 4YFKA 4QZ8A 1XSNA 4BRIA 5AIAA 3OHBA 5AZIB 2BQ3A 1HJOA 4DTMA 1W97L 3WKBA 4HHTA 2RHKA 1FEZA 3QERA 3TABA 5KG0A 1JCFA 4KAZA 2ZIWA 3HW8A 3KKSA 2KZMA 2Q0ZX 5DGBA 4J9PA 2GTDA 1ATNA 3IFRA 4MDAA 3VQ8A 3HJFA 4K43A 4X5VA 2P6RA 4H5TA 1XHXA 1B4FA 4RQ7A 1BQMA 3SBTA 4O9MA 4FJMA 4YHHK 4CZKA 4NLGA 2XVTA 1RBUA 3PV8A 5FDLA 3OYLA 2A19A 4DB3A 2AQ0A 3CFPA 1U9LA 2O8CB 3LANA 1GLJO 2JRZA 3SZ2A 1ZJMA 3B8AX 4NB4A 2ASPA 2B6AA 3AQEA 4FJ7A 2BKEA 3K1ZA 3L2VA 4LSNA 2D3DA 4CD3A 4DTPA 4QZBA 8ICRA 3TTDA 1Z25A 3V9XA 2VA2A 2P9UA 2NRVA 4EX6A 4QZAA 3QEPA 3V7KA 2LPEA 3VETA 2F77X 2WF6A 4DL6A 1FK9A 2YKMA 4PKGA 3MEGA 3PMNA 1DLOA 4FJLA 1G15A 3IDWA 2ASLA 2C28A 3WXLA 4WQ5A 4JI8K 3CCUN 2KKVA 3RJEA 1WBBA 1B43A 2A3VA 2OHFA 1SXEA 4JK7A 4GV3A 4RQ8A 3CHWA 3NMUA 3DLLL 8ICHA 2O8EA 2O4IA 5M1OA 1RM6C 4H5RA 1SKWA 5KT6A 1S0MA 4H5VA 2IOFK 5IT9O 5AIBA 5KG2A 5J2PA 2A41A 4ISEA 5LJVA 1IXRA 4IOCL 4KI6A 1NGAA 2LM4A 7ICGA 5TKYA 3V9WA 3GFKB 2FBTA 2UVVA 2PYLA 4ECVA 2ZJ8A 4IQVA 3NGDA 1VQPN 3IV6A 4GV9A 7ICOA 1GLLO 2ETJA 4M47A 5AK5A 2PFQA 4FJHA 1VSKA 1Q8KA 8ICYA 3CCVN 1TK8A 1N63A 2QK9A 3BQ1A 2IGIA 4IFVA 3RJFA 3SUNA 4L3QA 4BJQA 4FL9A 4PGQA 4H0OA 5AK3A 3QU4A 4DQPA 7ICEA 3U4LA 3F9MA 5DB6A 5EE0A 3IRXA 3VQ9A 4F5OA 4CIGA 1VQMN 4M6WB 1C0FA 1JLEA 1T6DA 1ZJNA 2KHOA 3KLIA 1ZRMA 3G25A 2BGWA 4DUYK 4J2AA 1QCKA 3H1QA 5CR4A 1XMOK 4F2RA 4BRGA 3DLRA 1SS6A 4DV0K 1NZBA 2KFNA 4RPXA 3VCBA 2YMPA 4QZIA 3ZDBA 2D6FC 3K9JA 1JROA 1VJ5A 3C2KA 2A1RA 4Q45A 2YMMA 4JKEA 3THVA 4F3OA 3NHGA 3KK7A 4ELTA 3MK6A 5J2HA 4O55A 1WUDA 5AQMA 1FIQA 2ITMA 3NS1A 5M1FA 1RT5A 4RQ3A 1K6YA 4G1QA 2EQYA 2DFLA 4C7YA 3C7NA 1Q7YO 5AK6A 1L7MA 2G5HB 2HF3A 4Z94A 8ICSA 4BDZA 1K73O 4UB2A 3TTFA 1YITN 3EWAA 1RYRA 5GINA 3LPUA 3ORYA 4WJ3B 3CJAA 3NH2A 3AVBA 1K8AO 5KFPA 3TFRA 3R9PA 5ALJA 5CP2A 2KJ8A 1TL3A 3PW7A 3E9LA 3CQXA 3O0FA 4YR2A 2EWSA 3ZX2A 3TU5A 2Q3SA 3RAQA 5M1PA 2HMXA 3ED5A 3V7JA 3C28A 2OANA 5FPMA 3TAEA 1YUWA 4DL2A 3BGRA 1Z00B 3BQTA 1ZQMA 3AVKA 4A2BA 1NZPA 1SL0A 1ITGA 4DV3K 4JK1A 3CYMA 3K57A 2JZBB 2P9SA 5J0TA 4M9HA 1VHXA 2H3GX 3ZETB 4FLTA 2ATQA 4DV7K 3CIPA 1A0PA 3DRSA 5KT3A 3HPOA 4FO6A 5AM0A 1O13A 4BDPA 4F4WA 4BROA 2H3IA 4PJ0U 3F2BA 4HUEA 4LC9B 5EE3A 4WF9L 1S0OA 4BGBA 2V52B 3QETA 2QWQA 4GV6A 7ICNA 1X2IA 4I2HA 3HPGA 5SWMA 4CJEA 3RMAA 4BR4A 4I2AA 1J9AA 2DY4A 5KPTA 1ZQJA 3IUCA 2G8KA 4KX5A 2X78A 3DMJA 3C6UA 3IDHA 2IAJA 4C80A 2E4LA 4CEAA 2EHGA 2DPJA 5M1QA 2KG5A 2N1RA 4O3NA 4DFKA 1BPBA 1TE2A 2HI0A 4DFJA 3QUTA 3ZDDA 5HRSA 1D4XA 3KHHA 4KLMA 1TGOA 2VJ4A 2CGLA 4Y0WA 4DV4K 3F2DA 1OXJA 3KBBA 4OPHA 4OGCA 5AI9A 3AQFA 3RH4A 4E0DA 4FPBA 2W42A 1ZOLA 4RZRA 2BTFA 2BDUA 2OZMA 2F8KA 3UKRB 3RSEA 1TAUA 4BRPA 5BREA 4YCXA 1LOTB 1VQON 4KH4A 3NVWA 3SENA 2MU2A 8ICTA 1XSPA 1BA1A 2LM1A 4B1XB 3ISCA 1A77A 1MQ2A 4FJ5A 3SUOA 3RFAA 3UXNA 3K5NA 4PH5A 5HRRA 3SI6A 5KL1B 2JEJA 2EX3A 4LF6K 3AVCA 2KW4A 1LVHA 1HQEA 4FK0A 2O4GA 4FJ8A 1JALA 2XIDA 4FLUA 2P66A 2XRIA 4YDUC 1KL9A 4EP4A 3THXA 5JU5A 4O8KA 3V1RA 4F5QA 3KLFA 3IAYA 4DQSA 1XU4A 2F1IA 2QWNA 2QWOA 3QIOA 4IR1A 2W54A 1XC3A 4ICLA 2NV3A 8ICGA 4P2HA 1S10A 4BRMA 3L5KA 2NO5A 3ZSZA 4QWCA 4USAA 1TYQB 2PMZF 4DF4A 1CUKA 4XRHA 4I2DA 2AA4A 4DR6K 4Y2JA 2W9MA 2AQ4A 4CFDA 5DDYA 3BZKA 3KD5E 3JAMO 1FXXA 5AQIA 4FYDA 4I2GA 2NRHA 2FPLA 4B6JA 1HNIA 2VWBA 4CJPA 2V51B 2YJFA 5ALYA 2Y1JA 4GNIA 2KD1A 4DQIA 4QOZB 1RTIA 4CERA 4RPYA 3MGHA 4NXNK 1VQ4N 1PK1B 5J2IA 4DCHA 1NNLA 2WHEA 1S9FA 4N47A 2OPPA 4CEQA 4PUOA 3CJBA 3MECA 3U8XA 2I6XA 4ILJA 3KFUF 4FLYA 4KREA 1EQYA 5SZTA 5KFKA 4R64A 4BXOA 3V7LA 5HL7L 5KAFU 2O8FB 1RGIA 4JKAA 1RBTA 3MC1A 3H7IA 5GAEP 4Y2QA 4CF2A 1YTUA 1BPYA 2HMPA 4KO0A 1KSPA 4BR9A 3SI8A 3C65A 4I6MA 2FBVA 3AAPA 5F9LA 3QUQA 3AA2A 2ZQBA 4I28A 3U9ZA 3Q7CA 2BDPA 2FMSA 2OCEA 2KTQA 3CMAN 2P1JA 4C8LA 3RB3A 3N7SC 3C95A 3PSPA 1GLEG 2EH9A 3U3GA 4YDUA 5AM2A 2I7PA 4E7JA 3O3FA 4J9KA 1P90A 4KMUA 4IZ9A 4IOAL 3CG7A 3TAQA 4FWRA 4QJFB 2BPCA 3DXMA 2DWQA 3PY8A 4BUGA 3VF2A 2KP7A 5ALMA 8ICZA 4YFUA 1MWKA 2KIWA 1HRHA 2P5OA 2NNWA 1S1XA 5IIKA 5J2CA 1X9MA 3AGKA 3ZSQA 5AI8A 4K4IA 4QS9A 3A0BU 1RG6A 5J0XA 1BNPA 5LMNK 1WSHA 3SYZA 1DGSA 4JI0K 4BC4A 3DLHA 4KHPK 4DMNA 2W41A 3UMBA 5J2BA 2WF8A 4CJFA 4U6PA 4G3IA 2BE2A 2ZIUB 2WF7A 2C2DA 1S22A 4JHDB 4FJGA 5DK5A 3NH0A 3B6OA 1ZQUA 5EE1A 4QIWF 4FJ9A 2F4VK 1U2VA 4QZEA 5AKYA 4J9OA 2LI6A 3O3HA 3AAQA 1T4GA 3OTQA 5L1KA 2UXDK 1X3MA 1BPEA 2HF4A 2AXTU 3O9SA 4JEPA 4WQ4C 5AQPA 3SMSA 5C15A 1ZBHA 3ENHA 3A2FA 3UXOA 2WB1C 3WNFA 4XIUA 4GKKK 1XNSA 3ZD9A 3KK3A 4DLGA 5J2MA 1RTDA 2KVSA 3RWUA 5B5EU 3GIKA 1RTJA 5KG4A 2YB4A 4Q0BA 1I3AA 7ICKA 4NXMK 3SJJA 3NVVA 3FDSA 4HAIA 3DXKA 5HRPA 2W7PA 2P9IA 3JXUA 3H8JA 2NZTA 1A5WA 4FWPA 3FE1A 5E41A 3TSUA 2RHFA 1XSLA 3TI0A 3WXIA 3G4SN 7ICHA 4CW7B 1VSJA 4CZEA 1LW2A 1RCHA 2QA4N 4FLZA 1WYGA 5ELZA 2KOBA 2AH5A 5C2DA 3S3OA 1XNRK 1NI3A 3VQDA 5AQQA 1Q18A 4YG2A 1U4BA 4RCHA 1JLGA 4W5QA 8ICBA 3DLBA 5DQGA 1BUPA 1YVNA 3ICXA 3O80A 2JWKA 1ZQVA 4O5BA 2UUBK 3IP4B 2IOFA 2KICA 3SCXA 4PY5A 3G71N 4KN7A 3RRGA 4HTUA 3ZT3A 4F2SA 2OWOA 3MX2A 4JV5K 5JS1A 3VENA 4EBEA 2HHVA 4A5BA 3EW9A 3HVTA 4FVMA 4IBNA 4UQGA 1RT2A 2WBNA 3MR2A 3VGKA 4CGIA 3TWHA 1PK3A 1K1QA 9ICWA 2UU9K 3ZT2A 2OM6A 2MUTA 2ASMA 3WXMB 2DFEA 3T69A 5KQDA 2D5RA 3D2NA 2EAMA 3AY9A 5AQXA 2G8UA 2QKBA 4CEDA 2AGOA 2EAPA 2KMDA 1KAYA 4FZZA 3EL2A 1ZD3A 4O3RA 3FZLA 4CGDA 3I1YA 2J6SA 1QVFM 3MEEA 4OJ6A 1ZQEA 1VQKN 3DLKA 4CE6A 2ZIVB 2C2EA 3IG1A 4B9NA 8ICPA 1ZBUA 3IHQB 2GUPA 4P0PB 1J53A 4M3YA 3BQ7A 7ICRA 4B8AB 4OLAA 4AH9A 1KTQA 2WAQC 3BS5A 3K5OA 4JKDA 4WQ4A 5KRTA 3VTHA 5KFOA 3FGUA 1WLJA 2IDOA 4DFMA 4MEYA 5KFCA 3BJYA 1YXQA 1MN8A 1LV5A 2E6LA 4GMJB 3ZDCA 1VQ8N 3CJ1A 5D3GA 3NGZA 3JPNA 5AQKA 4M3WA 2EANA 3ZT0A 2VA3A 1N61A 5KG5A 1HIWA 3VESA 2HHXA 3LDAA 1NGHA 8ICOA 3QX7A 3KD3A 4EEYA 3QEBZ 9ICCA 3SAFA 1WAFA 3LDPA 1NGEA 1UHUA 4OCZA 3BUZB 4H8KA 3CCQN 3PW4A 2DKZA 3CI5A 3V1OA 3VPZA 5E79U 1TVAA 1V97A 3TACB 2F9TA 2P9LB 4CGHA 5A2QO 1LAVA 2PI5A 4CBXA 2X74A 5AZJA 2WC9A 2MA1A 3NDKA 2F76X 2GELA 4UARA 4MO5A 3H0RB 3ZI4A 3V72A 1O1WA 1GOBA 3PR4A 2AP1A 4K42A 5BRDA 4FZLA 2GBZA 3AO4A 1EP4A 3QZ7A 2F8LA 4HYKA 1KN5A 4YOWA 4ED3A 5AK4A 3EZ5A 2HBLA 4DG1A 5AM5A 1S77D 1XHZA 2VIXA 1IH7A 1NLVA 1IJJA 3I28A 2ISPA 3EO3A 4JI6K 1BISA 3Q8MA 4AYBF 4IQTA 2W8KA 4PZOA 1CEZA 4K25A 4B9VA 3H08A 4BC3A 1LAWA 2HCFA 4KN4A 3HM8A 4JN4A 2BH1A 3NBPA 4R8UB 4NWIA 3FFIA 2ALZA 3C21A 1C0TA 4I2IA 4BVOA 2IVPA 4QS7A 3WKAA 1KLMA 1OH6A 3UXPA 7ICFA 3W3DA 4RTFD 5IILA 2HBMA 1C20A 3LAKA 4TUPA 1HNVA 4CF0A 1TUUA 4JKCA 4JYAK 1ZQLA 2Y1IA 2ZF5O 1OVYA 5EVZA 4IJAA 1Z1VA 3TSPA 3E9PA 1Q9YA 3OS2A 3LP0A 4DR2K 1JI7A 4CESA 2MRLA 1F44A 4CGGA 3QEXA 4FZXC 1RZTA 3NVKA 2KIVA 2JWLA 1ATSA 1T05A 5A0LA 1DK3A 4YOVA 2ZUCA 4AM6A 5KT5A 3L2UA 1O03A 2OYQA 2FI1A 2KV2A 4CCHA 3SAHA 3RH5A 1K8KB 2GX9A 3TAMA 3OYIA 5ALZA 4JRQA 4YNQA 5DG7A 2BR0A 3NGIA 1BDGA 5ADXH 3OS1A 4LH4A 4IRKA 3VQCA 2ZJRL 4EHUA 2F44A 1BQNA 1ZQSA 3Q7BA 4BVPA 4B3MK 3PMLA 1T3QA 2DPNA 1HLUA 3OHAA 2Y9TA 5IINA 3EZWA 4BREA 5CYMA 5KFBA 3GQCA 5B8HA 1ZQCA 2DKXA 4NYFA 1URJA 3PLAA 2VKQA 4H0YB 3AL0B 3M9OB 2HVHA 1N2XA 1N5YA 4NXZA 3LDSA 3L8BA 4CK1A 2HW3A 1N60A 2UYTA 1YF5L 4CBWA 1W7AA 3VEXA 4Z0UA 3EPGA 1QLNA 2DPIA 1S5LU 3VGMA 3NTUA 4JK8A 4C1NI 4BGAA 1XWLA 2G8FA 4EENA 5TZVA 2E1EA 1ZQXA 2G07A 4JV0A 4DS5A 2ASOA 3SLCA 4YMMA 3TAGA 4QWEA 2P9UB 3C0BA 4DU4A 1BPDA 4PPXA 4KTWA 4JI5K 4ECSA 4W5OA 1TKTA 3VN5A 1KDHA 2HOEA 3K5MA 4DU1A 1VQ6N 1WOQA 4EIAA 5KI6A 3KWIA 3KLHA 3MXMA 1RT3A 2PFNA 2YMLA 1RPLA 1UA1A 3HKZF 3FLCO 5ALGA 3H40A 2KK0A 5AKEA 3KJVA 1VSLA 2ZE2A 3M8PA 3BP8A 4FVUA 2OPSA 1LWFA 4N41A 4PHPA 2IHMA 1HUXA 2QW9A 3GV5B 3GDQA 5MLCQ 3MXIA 1OH8A 4H5WA 4CIFA 3WEEB 2Q2RA 1Q8IA 3P83D 3J80O 1FFUA 4RQMA 5CY4A 4JWNA 3CCLN 5AM4A 1IKXA 1EXQA 3KLEA 1ZQPA 2D0CA 2G08A 2W6LA 5KG1A 7ICJA 2PXIA 4FFDA 3HRGA 1KCFA 2A1JA 2WUSA 2E8PA 5JS2A 1YVUA 5K14A 3C94A 4BX9C 5DB9A 4H4MA 4FBUA 3K5LA 5J2DA 3SV3A 1S76D 2WFAA 2PY5A 3FAHA 4AHSA 4AILC 3HI0A 4B1VA 1JMSA 5J29A 1NK8A 8ICUA 4CF5A 1C1BA 1FKOA 2Q31A 3IKMA 3OYKA 3OJUA 2KQ2A 3MR6A 1X9XA 3JSMA 4KLGA 3THWB 4PGXA 4FWNA 1RDUA 4GY2B 1BHLA 4FM0A 3VQAA 1RDCA 1SIJA 4ZHRA 4XUSA 3KTQA 1KFTA 8ICWA 4FW2A 1EWQA 1XC9A 4C8KA 1U45A 2ZTCA 3NASA 5KFHA 5L1MA 2WOMA 3LDQA 4Z6CA 1D8YA 8ICJA 7ICPA 2A42A 7ICTA 1GO3F 3UM9A 1KFSA 3M5RA 5AFUA 8ICMA 4FZYA 2ATLA 4KHYA 4Z4HA 5KFRA 3C7NB 1JXBA 2HDOA 3CC7N 3H4BA 1SZHA 5ALSA 4TQSA 1IBKK 4KLHA 4DHYA 3O9UA 3LDLA 3LDNA 4ZTJA 3CFOA 1L3VA 4DFPA 9ICRA 1RNHA 4W5TA 8ICIA 3IN5A 4KX3A 4BQZA 4UW9A 3OVNA 4KH5A 5CB1A 2HMIA 4LJXA 4H4OA 3ETRA 2ZJAA 2YNHA 5KG6A 3QEIA 3MABA 3G0ZA 1TKDA 2IVNA 2I5HA 3RJIA 1N34K 5AQUA 2W04A 2G0AA 4U7BA 1TV9A 5F3XB 2KJ5A 1VRTA 1ZQYA 1OW5A 4RQ4A 4A62A 2FF6A 3KVGA 5J2EA 3G10A 2P9SB 4DSLA 5AI5A 5EWGA 5GIOA 5HR6A 4OKJA 1HMVA 4CGFA 4O4GA 4CF8A 4E3SA 5JUMA 4RQ6A 2GH1A 4Z4FA 3GIJA 1DK2A 8ICEA 4I2PA 2XICA 3KKAC 3OYHA 1NJIO 1NMDA 4E89A 2QKQA 3C6AA 3PX0A 3FZKA 1WN7A 5GAGP 4X64K 3WK8A 1GLAG 3S3MA 3A0HU 4I7FA 1QVGM 4DTJA 4CJLA 3DWLA 4FPAA 2XY6A 1NJXA 1X40A 4OJLA 3OSNA 4M9NA 4EZ6A 2UVUA 2R18A 2W11A 4IO8A 2O8DA 2M9NA 3BF1A 3QEVA 2F8TA 2BCUA 3IMXA 3PIPL 4JK9A 3ZYYX 1S8OA 2P6UA 5ALNA 1V4SA 3CJCA 4JD2B 3UE5A 5BPMA 3NAEA 3D6RA 4EBCA 1X6JA 5BPLA 4YN4A 1BVSA 3GZFA 1CXUA 4TURA 3U26A 4B9UA 3KLGA 4LFCK 3TADC 4I9LA 3J7YP 1ZQTA 3V6KA 4FJXA 1HQUA 2CXYA 3ENBA 5KFZA 3VEYA 2I1QA 1N8RO 4Y2YA 1S9GA 4PWDA 1W9HA 3RSEB 1C0MA 4Z6EA 1XS9D 2HOQA 4KITB 4F5RA 3QEAZ 4US8A 4Y2PA 3SD7A 1DGKN 2V4RA 4IFEA 3I8BA 3VA3A 2IOHA 5AQOA 1UWBA 4PL2A 3WK4A 2YHAA 2XY5A 4N56A 5IIJA 1WAJA 3OBWA 4DEZA 3N4MB 3LWLA 3AU6A 4KKOA 5BN9A 1RT7A 3TSQA 3FZHA 3OYEA 1ZXOA 4ZTFA 4HUGA 1NK9A 2QXFA 3THXB 5EY4A 3ZLJA 4C4RA 3J81j 5B66U 4PGYA 4YORA 2NRRA 2Q4TA 1A5XA 3CXCM 3QEWA 3BDPA 4X65K 3QFPA 5J0UA 1QQOA 4YP3A 3QINA 7ICQA 3CC4N 3TANA 1MWMA 9ICEA 1S0NA 3O8MA 4J9SA 4W5RA 4OPAA 4F4YA 3ZDAA 2P9PA 1B9FA 5AKXA 4LF4K 3HX0A 2KJ9A 1WBDA 4CGJA 3V9SA 4O0JA 5AQJA 4CJVA 1NNEA 5AZIA 3F5TA 1KVAA 4Z4GA 3AVIA 4EHTA 3O3GA 3D2EB 4QCLA 4CE9A 2C2RA 5J2QA 2BANA 1ZQHA 2NO4A 3BQ0A 4F4ZA 2NRXA 1F5SA 4TUSA 3OYNA 2KKPA 1HNZK 2W03A 3GV7B 1PVQA 1T3VA 3T79A 4DSKA 4C8OA 4CHNA 3OS0A 2VGNA 1JUDA 4KLOA 1KQQA 3K9KA 3L4IA 4BC5A 2E2QA 4DCCA 3AO5A 4GLXA 3WNHA 4U67L 1DEJA 4JKBA 4I2JA 3F5EA 4DV5K 4MHVA 3TADA 2W3SA 3MX5A 5BRFA 2CGKA 5J0YA 2YHYA 4J2BA 4PKIA 4LF7K 3QU7A 4UB3A 2FLNA 5TISU 4CEOA 3VQ4A 3S9HA 4YMNA 3VQ6A 3WNGA 5EOYA 4CJQA 4CF3A 5DB8A 3OHRA 4ECQA 3PW0A 4YOTA 3SQ2A 2KHVA 3E66A 3OYFA 8ICFA 5KFYA 4UASA 1IBMK 4I6MB 5EXWA 1X6IA 2DFHA 5HR7A 1KFDA 2FJ6A 3ENOA 3QUBA 3U6FA 1NMNA 2FBXA 3L6QA 4F71A 1JXEA 4X66K 4B1YB 4IKFA 2PI4A 4NCAA 3WQUA 2UVWA 3J8AA 3AU2A 3TR8A 4BE1A 1XI1A 5EWFA 1VQ9N 1NGDA 3AA3A 2OEHA 1L3TA 1HPMA 4WE1A 3DXMB 2DGZA 4DR3K 2XO7A 3ID8A 4IWVA 4YMOA 5AJ3K 2QEXN 4CHYA 4DTRA 1TUYA 5GAHP 3M1FA 2HOFA 4NLKA 3QXGA 1NOMA 3OTOK 1HKBA 1YZ6A 2KZZA 3SMVA 1JL1A 3VQPA 1QSSA 4C1NK 5KFLA 1RDDA 5M1NA 2RE2A 4LF5K 5FRMA 1ZETA 4DSJA 3ZSRA 2EDUA 4L8RB 1Q9XA 3JPTA 3E2EA 1M6YA 3LL3A 2AU0A 1T6CA 2G8VA 4YOUA 4UB8U 5HOOA 4ISFA 4ECYA 3I33A 1H38A 1BOTO 5EOZA 4I2CA 4B3RK 1RILA 1F0MA 5JTIA 4DV1K 9ICXA 3O9RA 1NJZA 3R8EA 4OO1J 4FJKA 4A57A 4FS1A 4J8FA 3NF6A 5F2RA 2J6TA 1T7PA 4PA1A 4FWKA 5HHHA 4EFHA 4B3OA 1HJRA 5JLFA 1TV6A 2KN7A 1E4FT 3DXKB 4H0XB 8ICAA 3M6KA 4KFBA 3GE1A 4ECXA 1QQNA 1XMQK 4JI3K 4UAWA 4JKGB 4DTXA 3L2QA 1BIZA 5ALIA 3MDQA 4RPZA 3A5NC 3HYFA 3LALA 1COKA 1NGFA 1JCEA 2GWSA 4ID5A 3UIQA 3PX6A 1E4GT 5HMMA 4BG9A 5BR8K 3DI6A 5FPDA 1XNQK 3PVXA 4IEIA 4JI1K 1OUQA 2HVIA 3M8SA 3OSPA 1KXPA 4YY3K 2F96A 1Z19A 1WSGA 3KHYA 3KHRA 5FPEA 1QS4A 3SK3A 4M9JA 1C0UA 3P5JA 3H0MB 3BF3A 3CPEA 2OTLN 1BPXA 1SV4A 1IM4A 4MO4A 3T19A 2FLLA 5KL8B 3GV8B 2JZBA 4CGZA 2MUTB 5KFQA 4IDKA 4MQ3A 2VCPA 5F0XA 5LJWA 2Z1JA 3DDHA 4IRDA 5L1LA 1N62A 3VA0A 2IIRA 3WQTA 4FJNA 3K75D 4DTNA 4HTLA 3IRUA 2J6UA 5E26A 3WXJA 2GWJA 1LKYB 4C4TA 4NYNA 1SZPA 3TQ1A 3K4GA 3EYZA 4KLLA 3ULEA 5AKZA 3QICA 4JLHA 1KD1O 3ZSOA 1VSHA 3LVWA 5KFFA 4ED8A 3OPXA 4LY7A 2QB0B 3LP3A 3BEXA 4DSFA 2QWMA 3DAWA 4KHWA 3BS5B 5GADP 4O0IA 3M8RA 2WTUA 2PAVA 4TSXA 4BR2A 4QW8A 5C0YA 1DGJA 1ZQAA 1PVRA 1QH9A 3KHLA 3HWTA 3O4QA 8ICLA 3H8WA 1QHAA 9ICTA 3V1QA 4EX7A 2KHQA 5BOLA 3RB6A 4O5KA 1BL3A 3LP1A 1HNXK 5JVHL 2VWKA 3CCEN 1VSDA 4ECTA 1MC8A 3H46O 3EKSA 4HWIA 4MLEA 3EUB2 1WNSA 3QDKA 4LF8K 1GOAA 1LWEA 1TAMA 4KRFA 2CRXA 1RT1A 2H3QA 4CK2A 3RMCA 4BR7A 5L1IA 3R6MA 1S1WA 5DMRA 2XI9A 9ICVA 2DFFA 2RN2A 1BPZA 3NE6A 4KHSA 4DWIA 3CCMN 3O1BA 3SAGA 1N6QA 4FS2A 9ICIA 4Y1DA 2ZUBA 5AZJB 1KRPA 1WSFA 3EKUA 3G6EN 1BO5O 3OYJA 2H5XA 3V6HA 3PW2A 9ICBA 1NGGA 3GBTA 1ZQGA 4JV2A 2VG6A 4JWMA 3N4QA 1IG8A 3LK9A 4F8RA 3L3FX 3PO5A 2W40A 4JB3A 2OZSA 3T5KA 3DOKA 2Z1HA 4E7HA 2E2PA 1ZD2P 1RQNA 1BGXT 2G06A 1T8EA 4DS4A 4KLQA 2P51A 4O8UA 2VA8A 3D2QA 1BCOA 5HP1A 3C1ZA 2R8IA 4HCCA 3Q8PB 3HP6A 3LWMA 4AM7A 4XH5A 1Q82O 3HK2A 3O9QA 2ZJPL 5DBCA 3L4PA 3RBDA 1T94A 7ICSA 4CDGA 4AHUA 2PZSA 1NGCA 3AARA 3QU2A 3ZT1A 4KMOB 3Q8LA 4N76A 3THYB 3V6DA 4FLWA 3CFRA 1DOQA 1T44A 4PHAA 4Q5VA 5J2GA 4NL9C 9ICUA 4B1WB 5CHGA 1QQMA 2YKNA 4UB4A 3J81O 1KAXA 3IG8A 2YJEA 2P9KA 4JAXA 4IJNA 5HHIA 1U47A 2R8JA 2I7NA 1ZRNA 4MLHA 1S6PA 2IA6A 3MWPA 4P0QA 2AGPA 1SAZA 1D8BA 3CF5L 1QSYA 3PSFA 5DG9A 1U48A 5KQ8A 4BRQA 3FM9A 4ECRA 1NOZA 1AROP 4DSIA 3SPZA 5AQFA 1KQSM 2HBKA 4ACOA 2HB5A 8ICXA 5AICA 4NLNA 3EEQA 4C7ZA 1ZBLA 2WF5A 2PFPA 1C0GA 3Q8RB 1XO1A 1IKVA 1SV0C 1XUPO 3MDAA 2ZWHA 2LYBA 5ALUA 1JX4A 4ZH4A 2Q36A 3NCIA 3QZ8A 2VQEK 3QFUA 3WK7A 5DG8A 2ZGZA 1EXNA 3PR5B 3V9ZA 1NKBA 1QQ6A 4V19S 1WSIA 3LZIA 3QBXA 4ECUA 7ICIA 5CZ2A 4BRNA 5AKKA 3CCJN 2YQEA 1YHQN 5BPCA 5J8YC 1BNOA 8ICCA 4CJ4A 1G99A 4KH6A 3A8YA 3JPQA 2E2NA 1M1KO 4IQUA 4CFAA 5KFIA 4CJ3A 3ALYA 4P4MA 5EWEA 2QB1A 4RQ0A 2FMPA 1VQLN 5HP4A 1ZXIA 5HMLA 3L3VA 4BE2A 5KG3A 1C1CA 3FZMA 5AQYA 4M41A 4RW6A 2UXCK 1L6NA 3AA5X 5DKWA 1ZD5A 1A5VA 1NK5A 9ICLA 1MQ3A 2I9GA 5KTQA 3CQ8A 1Q3VA 3LYSA 4KLEA 1QQ5A 1WSEA 4JI2K 3GILA 4LZDA 2K4EA 2X6SA 4NL9A 3VEZA 3F2CA 1IKYA 2HNDA 3VERA 1WUAA 4FBTA 4JHDA 4LD0A 1HUOA 1J2MA 5ALVA 1HNWK 4DTUA 1VK0A 1L7OA 2O8BB 4TQRA 1TFRA 5AM3A 1I94K 4DL5A 2HBJA 2IS3A 4BWJA 3SPYA 3AO1A 1W2BM 1QZ6A 3WKEA 2XGQA 3NVZA 2F9WA 3LPTA 4FW1A 5HNKA 5IWAK 4MDBA 9ICJA 3ISNC 3GDXA 4P4PA 1ASVA 3AV9A 1OH5A 4R79A 3CNHA 4ELUA 1R0AA 3KD1E 2XCPA 9ICSA 2A1JB 2YN4A 4XQ8A 5T14A 4DF8A 9ICGA 3MMVA 4IL6U 4XEIA 3VOVA 4K0KK 3AVMA 2K8AA 3OYBA 4CFCA 3DV9A 5BRHA 4CJ5A 5KT7A 2QARA 2K4IA 3TKAA 2B5JA 2YHWA 2G8IA 1RT6A 3P1GA 2K4HA 3ZEUA 4JI7K 1F21A 4BACA 1WSJA 1Z1BA 4WYBA 3MXJA 1UOCA 4QZDA 1J2NA 5AQTA 3VF4A 1SKRA 3IG5A 3V4IA 4YD2A 4Q8EA 4ED1A 3NGYA 3M8QA 3DLEA 4CK3A 4EYIB 4RNMA 3CJ9A 2H3FA 1A6SA 2XCAA 3RB0A 4F4KA 5KFUA 4M3RA 4JNEA 2ZIWB 1HUZA 1NWKA 5ALEA 4KLDA 4FCYA 5FRNA 4PQUA 2NRZA 4CHOA 5AQHA 1X42A 2AGQA 1OKJA 3O5BA 5AQLA 5CR0A 3F5AA 3FZFA 4LH5A 4OJ5A 4GXIA 4J03A 4FOIA 1HKGA 2ZIVA 4I2EA 4IEEA 5D4BA 4CJ7A 5HBMA 2F1HA 2YTUA 1Z4OA 4FWQA 4IDHA 1SUQA 4GXKA 4CECA 4Y2TA 3P31A 4I2QA 3IM1A 1S3XA 2PMZC 3ZSYA 4GIBA 1MA9B 1KAZA 3LM9A 1J5OA 4J2EA 9ICFA 3B9JA 5ALKA 5ALWA 5IIIA 3C29A 1SZ2A 2PBDA 1K5OA 5AQSA 3AM9A 3JS6A 4P4OA 4FLXA 4CZLA 3CM6A 3C2MA 1RBRA 1VSEA 1SKSA 3D45A 4BQLA 1L8OA 2IMWP 4F93B 3WUHA 4Z6DA 4DFDA 2RPIA 5ALLA 4MFAA 4O3OA 5DBAA 1QZ5A 3KZIU 2E1ZA 1T03A 2O8EB 3JPPA 4TUQA 2MSNA 5AQGA 2VG7A 4UAYA 4QZ9A 3HT3A 3E01A 4M42A 4CEEA 3CW2C 3RBEA 5J2NA 2QI2A 3ETLA 5DLFA 3CCSN 3NRWA 2G8HA 4BY9C 4AQYK 4JS4A 2QKKA 4IO9L 1KVBA 2P9NA 5K4LA 2ITGA 4KV8A 2O8DB 2BPGA 1WWVA 4M9GA 1ZQDA 4DTSA 3AVAA 2HSTA 5EE9A 5AI4A 3RF9A 4F72A 1TKXA 4UBCA 3E1YA 3SJHA 3VGLA 1WB9A 4LFBK 5C25A 2BHNA 2F2AB 2A6AA 3ZSXA 2ESEA 3SQ1A 4ED2A 3SUQA 2RKIA 3NF9A 4A8EA 5J2AA 2FE9A 3CPWM 5FPNA 3N28A 2PKEA 1HJPA 2ZG6A 4EELA 3C23A 1DTTA 1PVPA 3QBWA 1IV0A 2XY7A 2M0NA 1IG6A 3MCAB 3NH1A 3HILA 4HUFA 2KFZA 4KB1A 5CEHA 1V9PA 3E58A 2RRDA 4R8UA 3A0IX 2D8CA 2E8AA 1LCUA 1SQKA 5DB7A 4CI6A 2DBYA 4E1JA 4FM1A 4KI4A 3HXMA 4M63C 2QWLA 2YHBA 2WFBA 1UA0A 9ICAA 1B22A 1R59O 4R5PA 4K4GA 2HSZA 1NGIA 1IV8A 4JI4K 2W9BA 3T5HA 2OPQA 4QWBA 4R66A 2HHHK 2JGUA 3SBGA 1SV5A 4OJOA 9ICHA 1EWRA 3VQ7A 1RDAA 2E8MA 3G6XA 5ALFA 3P39A 5ALQA 4C8NA 2W9CA 3EY1A 4HCBA 5BN8A 3MN9A 2ISOA 2GEMA 4OJRA 4A59A 2JHDA 1ZD4A 3WKDA 1ZYQA 1CZ9A 5AQRA 2L5YA 2NYVA 5AKGA 2BQRA 2KKZA 1BI4A 1RT4A 2Z1GA 2ZXIA 7ICUA 2LYAA 1J6ZA 2E6MA 5KFVA 3MN6A 3RJKA 2P9PB 4YR3A 4QIWC 1SGGA 3H1VX 4KBOA 3PSIA 1Y97A 1Z4NA 1QQ7A 2E8OA 4C0ZA 4J9QA 3M9NB 4B1ZA 2VWJA 1BIUA 4DU3A 2AJQA 3CETA 4B9QA 1NJWA 2VJ5A 2JEGA 4KLJA 1S0VA 3WKCA 1TL1A 2E1YA 3H6EA 3QE9Y 9ICNA 1H1VA 2BCVA 2Q97A 3PIOL 4JUZA 3QYPA 3GL1A 4IG0A 4MF8A 4CRXA 4CFBA 3D0PA 1BU6O 2YHXA 4KHUA 3VEOA 3O1WA 4LZGA 2LBOA 1K1SA 5KT4A 5HLFA 1YAGA 2E1FA 2WB1F 3HZ6A 3LM2A 4HVJA 1HR0K 5KT2A 3KOOA 4MFFA 1YTAA 2HOIA 5I42A 4LF9K 2VGMA 3F53A 4QS8A 3VMFB 1M90O 4KHQA 2FDRA 4FWMA 4H03B 2D0BA 1L7PA 1VDVA 2ZTEA 1SB3C 2Y0SF 4UB6U 2GV9A 3O4NA 1IO2A 4ID1A 4BRLA 5LY3A 2OPRA 4EBDA 2JR5A 9ICKA 1BA0A 1ZBIA 4O3PA 3LDOA 4AP9A 2F3NA 4CZFA 3LZJA 4ILGB 5CRXA 2JH1A 3QNNA 3ZX0A 3VTIA 1NM1A 1KBUA 3J7AP 2ASDA 3GOIA 1X66A 1ZQ1C 4K41A 1C7YA 3MGVA 2GO7A 3FR0A 2KZ3A 1XQSC 4GXJA 3D2FA 2FBYA 4IR9A 1VQNN 1XO0A 4OD0A 3EN9A 4FSVA 2HNYA 4RW4A 3NF8A 5L1JA 2B21A 2ZIXA 5BOMA 1J97A 3SEIA 3AVLA 3H3NO 2YNGA 3WEEA 1BG3A 5J0QA 5J2JA 1SXDA 2KEYA 5KFJA 2W55A 4H0VB 5AQWA 3OYGA 3EE9A 1WCNA 7ICVA 1JIHA 4RW9A 5ALHA 5KFAA 3HM9A 2V9WA 4I2FA 3ISDA 2QLTA 1EX4A 1P7DA 2FC0A 5J0RA 1S1TA 4G9BA 3PNCA 1GLBG 2WONA 2D0AA 4O5FA 4CIEA 5TKWA 4ED7A 3HVRA 1NKCA 3KIOA 2ZGYA 3N7RC 3M1YA 5EU7A 1VQ5N 4X62K 2K89A 2J4RA 3UKUA 2KSOA 1TK5A 4UATA 3THWA 2VG5A 2UXBK 1JN3A 2BZFA 4QZCA 2CH5A 3W0LA 2WAQF 3E9OA 2XGPA 2YNIA 4JV1A 1YJNN 5DM7L 1TK0A 4M3ZA 2E5SA 2NRTA 2ZJ5A 3UQ0A 3RR7A 2A40A 2FF3B 4H5NA 2LMRA 3KKAA 4RUCA 4CF9A 4E19A 4DKWA 3OYCA 5T7BA 4F50A 1GLFO 1D8LA 3T3FA 3OBYA 3R3LA 1IG9A 4PHDA 1L8LA 5KFMA 5KNIA 1YIJN 3G6VA 1S1UA 4J2DA 3QESA 3OYDA 2HHQA 1UT5A 3T1AA 4BRAA 4FXDA 3O08A 9ICPA 1A76A 5ALRA 3T5JA 3HSCA 2QTDA 4CZMA 4NLZA 1LW0A 2IOCA 5GTHU 1O08A 3C1YA 3B0YA 4O44A 2OA8A 3MWTA 2JV3A 1HEKA 5I3UA 4DQ8A 4YOXA 2EAOA 2JGAA 4IC9A 2ASJA 4GKJK 2O8CA 4BXOB 2G5IB 3U3YA 4JKFA 5AKLA 1JJ2M 1JLQA 3L2WA 4IRCA 1RYSA 1NBWA 4AYBC 1QE1A 1S1VA 2CGJA 4YXJA 4NLBA 4BRFA 4Y2UA 2Q0UA 4E7KA 3ISBA 5E84A 2F8SA 4H0TB 1ZQBA 2UUAK 4LVSA 5J0SA 1N5WA 3M9MB 3A5OC 3HOSA 3C5GA 1BCMA 5H2FU 3N97B 3TAPA 1B92A 2W7OA 3NVMA 2DL0A 4F4XA 4KLFA 4FWSA 4KLIA 4AF1A 3G6YA 4I29A 4QZFA 2HHWA 3HTVA 1TVRA 2A1SA 2G09A 4AHRA 4PHTX 2E3TA 2LSNA 3ZSVA 3H0LB 3ULEB 1VAZA 1U6ZA 1ZQWA 2R8KA 2DTUA 2Q0RA 3CP8A 4OKEA 8ICQA 1FKPA 2WTFA 4ZOHC 4CJSA 1S6QA 1ZQKA 1JLBA 5AR0A 2V7ZA 4KLTA 3WNEA 5KG7A 5DLGA 1YT3A 3MFIA 2GUIA 4DLEA 1JLAA 2IHNA 4DQRA 5HROA 4QWDA 3MAQA 4NM1A 4JD2A 1N56A 4UAUA 5AI0A 5EX5A 2ZD1A 3CRXA 5ALDA 2YCHA 4BR5A 2HNZA 1GOCA 5C2FA 3AVGA 3AGRA 4B9MA 3FYHA 3OYMA 1Q46A 4QAGA 1JKHA 1HYSA 1KW4A 4FLVA 2R7YA 3T7ZA 1EKEA 3AVHA 1Q86O 1J54A 1DKGD 1VRUA 3DRPA 5IIOA 2JH7A 4M6WA 4RQ1A 4FWLA 3WT0A 1IIPA 5IIMA 1U2VB 4K4HA 3ULDA 2YX6A 3QLHA 4H0PA 2D4WA 3GG4A 4WFAL 3DLGA 4UAZA 2OH2A 5BR9A 3MBYA 3C2LA 3KK1A 1VSMA 5KFSA 4WFNL 3HL8A 1NGBA 3T1YK 1TKZA 4GVEA 4CEZA 4M3UA 3S3NA 2RDJA 2VANA 4RU9A 1Z3EB 1QQCA 2P9IB 4DTOA 4FJJA 1JLFA 4BRDA 2FPMA 3ZDEA 4DQQA 1ZQRA 2V7YA 4KPYA 1GLDG 3VQBA 4BRHA 2LKYA 3K2PA 5G5HA 2BCSA 3S41A 5AM1A 1LB2B 4BWMA 1ESVA 4PHEA 4CHQA 4CZIA 1N5XA 4M04A 4OLBA 3RR8A 1ZQQA 2W9AA 3UPQA 3RJJA 4O3SA 3NF7A 4BR0A 4OPKA 1ILYA 3CCRN 3B0XA 3HKZC 1L7NA 4DOBA 2P35A 4Y1CA 4M3XA 5KFNA 1RDWX 3A5LC 3D2EA 5KPZA 4XA5A 1X3NA 2KLAA 4B3TK 5DQHA 2Z7JA 4CVNE 4PL7A 3NVYA 1N48A 1ECWA 4E7IA 5BPNA 1X9WA 3ZX3A 2DQNB 1Z00A 3AVFA 4B3SK 4Z4IA 2B0CA 2QWRA 4R65A 1VSIA 5CHIA 2K60A 2BQUA 2P9KB 2H3VA 3VC8A 3ZETA 4MFCA 1ED1A 4P0QB 3V9UA 3ZSWA 1EO1A 2K8CB 4OKKA 4QW9A 1HYZA 5M1KA 1NK0A 2K4PA 4Y2VA 3TARA 4BRCA 1RQLA 4NLCA 4FO0A 4CJKA 2Y9UA 1Y88A 4NM2A 2FPKA 3K1RB 2JMGA 4Y2XA 4F5PA 2D1KA 3MCPA 4JS5A 2BGGA 4DR5K 4NJ8A 3JPRA 3AA4A 3ZD8A 3TFSA 3S6JA 3SQ0A 3PZPA 3QU9A 4CEBA 2RDIA 4KB0A 5CWRA 5JRTA 3VQQA 3H45C 4C8MA 1NG9A 5KPRA 4J9NA 4CF1A 3CC2N 3NFAA 4W5NA 1PZNA 3I76A 3V6JA 3L3UA 3SR6A 3ONNA 3MR3A 1RXWA 1S97A 4LSLA 1AQ6A 4A61A 4B08A 3Q8SB 3QUCA 5KGXA 1D9DA 3ATUA 3IS9A 2ZM6K 2PYJA 1FJGK 5AKHA 1SWWA 4FZMA 5DGAA 3D2SA 3SQIA 2WF9A 3N7PD 4O3MA 4MFBA 3HP9A 2YB1A 1SL1A 4M0AA 2XC9A 1B9DA 2PFUA 8ICKA 5FROA 3UKRA 3UMGA 2FSNA 4OPJA 4UB5A 3DM2A 2R8GA 3L0QA 2Q1NA 1CZBA 1N36K 2E8NA 1HKCA 2D0OA 4NCGA 5KFGA 5JICA 1QHTA 4B8CA 8ICNA 3DEEA 4I27A 2ZJQL 4OX9K 4Q43A 1Z6RA 5LL6Z
chains in the Genus database with same CATH topology
5JMVA 1NK4A 1S72N 4CZJA 3MGIA 3T5LA 1NK7A 4I2BA 2HHSA 4Q44A 4C23A 4IQWA 5JLHA 2BUPA 4DOAA 2QWPA 4NO7A 1TYQA 2F1JA 3MFHA 5CJ7A 5DM6L 4B9LA 3SMPA 2ZUDA 1RXVA 4M9LA 3ATVA 4RNOA 2E20A 4ECZA 4ED6A 5C12A 4DOCA 4O3QA 8ICVA 4B1UB 5GIPA 3MR5A 2W8LA 4QZHA 4JKGA 4DL7A 3RJHA 4R63A 3CD6N 4YD1A 5AQVA 3KZBA 5KFTA 3C6HA 3CJ7A 2C22A 4O5CA 2HHTA 4RT2A 3OJSA 4MF2A 2IVOA 3PO4A 3ZEUB 2D0PA 4XH4A 4WCEL 4UY8O 2R8HA 1Y64A 2FSJA 2GWKA 2MAXA 4KTQA 5I9EB 5C5JA 5KFXA 4J9MA 4RQ2A 1NGJA 3H3OB 2OTJN 4PKHA 1GLCG 4EAHD 2PFOA 4IXCA 2E88A 4B9SA 3J7ZO 4J9LA 4BGDA 4BC2A 3HOTA 4QWAA 3I55N 3VEWA 1YJWN 4CD1A 1MSWD 4GC6A 5KFDA 2BCRA 1X9JA 9ICMA 4BRKA 2LYHA 3PW5A 3SV4A 5J0PA 4F92B 3Q8KA 1K9MO 5J0WA 3KHGA 2FLOA 3GIIA 4F91B 3AUOA 1JCGA 4ELVA 3RH6A 1WCLA 3RAXA 4FOEA 4CBUA 1NKEA 3H4DA 9ICOA 3JPOA 3QB0A 1UT8A 3PX4A 1MDUB 1VQ7N 5KFWA 2VYPA 3CERA 4YVZA 2FMQA 3RB4A 4FWOA 1KEJA 5KFEA 3I56N 3M3ZA 2P9NB 1ZQZA 4M7XA 2JEFA 2QXLA 3H8SA 1JXLA 1NK6A 3TPQA 1SL2A 2FLPA 3Q8QB 3A5MC 4DL4A 1ZQIA 1D9FA 2QM1A 4J9RA 4M7YA 5JVGL 3P4IA 1ZQFA 4Z6FA 2FSKA 4F9OA 4GC7A 3R1XA 4UB1A 1ZC6A 3HBTA 2IBKA 4KLSA 4IOXA 2YI1A 3L4QA 2W9BB 1Z05A 2CH6A 1X9SA 9ICQA 2NLXA 5H1SQ 1DT9A 1QSLA 3C5FA 5J2KA 2A5XA 3TTCA 1YJ9N 1U49A 2JEIA 2W9CB 5D49A 4EYHB 2UVRA 1ZQOA 3EE8A 3RJGA 3VEVA 1ATRA 3O9TA 5AQZA 4A5AA 7ICLA 3M6GA 4RWTA 4RNNA 4UBBA 4ECWA 5DQIA 2FXUA 4M2YA 4BG8A 2V4QA 3CMEN 3FFKB 1BWFO 1HX1A 3JPSA 3UB5A 4YOYA 4RQ5A 4A2AA 4YQWA 3P38A 3DJCA 2HHUA 3RTVA 4CZGA 5DBBA 5J0OA 4YXMA 2F7TA 1TAQA 1V4TA 5AFUH 1RFQA 4CZHA 7ICMA 3N4PA 3EPIA 3QMLA 1KLNA 4XH1A 3F2KA 3WXKA 2A3ZA 4RT3A 1ZQNA 2NRWA 5AQNA 3MDCA 2P9LA 5F9NA 5C10A 5F1XA 4RUAA 4DL3A 5L9XA 3GIMA 1CZAN 1L3SA 4JKHA 1NJYA 3CQYA 4KLUA 4O5EA 3OGUA 3D2FB 5CE3A 4Q8FA 5DDMA 4DO9A 4ED0A 2ZTDA 3O4WA 4ILHA 3RRHA 5D46A 1T3NA 4NY8A 2E2OA 5ADXA 4QZGA 4MEXA 4B9TA 3ID6A 3RVCA 1Q81O 3OW2M 3BQ2A 1QVGM 3MN5A 2BCQA 4PL8A 4EZ9A 3KWGA 1P8ZA 3UQ2A 1QTMA 4WFBL 4WQ5C 4ISGA 4G9ZA 4F5NA 1YI2N 3O6WA 1L5UA 3VF6A 4DSEA 3U9DA 5J2FA 2BPFA 4YR0A 1COOA 3UKUB 1ZBSA 1L3UA 1KC8O 3D7EO 3OA9A 5CA7A 1K8KA 3MN7A 4YFKA 4QZ8A 1XSNA 4BRIA 3OHBA 5AZIB 2BQ3A 1HJOA 1W97L 2RHKA 5KG0A 1JCFA 3HW8A 2KZMA 2Q0ZX 5DGBA 4J9PA 2GTDA 1ATNA 3IFRA 4MDAA 4K43A 4X5VA 2P6RA 4H5TA 4RQ7A 3SBTA 4O9MA 4CZKA 4NLGA 3PV8A 4DB3A 2AQ0A 1U9LA 1GLJO 3SZ2A 1ZJMA 3B8AX 4NB4A 2ASPA 2BKEA 4CD3A 4QZBA 8ICRA 3TTDA 2VA2A 2P9UA 2NRVA 4QZAA 3V7KA 3VETA 4DL6A 4PKGA 3PMNA 2C28A 2ASLA 3WXLA 4WQ5A 3CCUN 3RJEA 1B43A 4JK7A 4GV3A 4RQ8A 3CHWA 3NMUA 3DLLL 8ICHA 5M1OA 4H5RA 1SKWA 5KT6A 1S0MA 4H5VA 5KG2A 2A41A 4ISEA 5LJVA 1IXRA 4IOCL 1NGAA 5TKYA 7ICGA 3GFKB 2UVVA 4ECVA 2ZJ8A 4IQVA 3NGDA 1VQPN 4GV9A 7ICOA 1GLLO 4M47A 2PFQA 8ICYA 3CCVN 1TK8A 3BQ1A 3RJFA 4L3QA 4FL9A 4PGQA 4H0OA 4DQPA 7ICEA 3U4LA 3F9MA 5DB6A 1VQMN 4F5OA 4M6WB 1C0FA 1T6DA 2KHOA 1ZJNA 3G25A 2BGWA 3H1QA 5CR4A 4F2RA 4BRGA 1SS6A 2KFNA 4RPXA 4QZIA 3ZDBA 3K9JA 3C2KA 4Q45A 4JKEA 3THVA 4F3OA 3KK7A 4ELTA 3MK6A 5J2HA 5AQMA 2ITMA 5M1FA 4RQ3A 1Q7YO 2DFLA 3C7NA 2HF3A 4Z94A 8ICSA 1K73O 4UB2A 3TTFA 1YITN 3EWAA 1RYRA 5GINA 3ORYA 3CJAA 1K8AO 5KFPA 3TFRA 3R9PA 5CP2A 3PW7A 3E9LA 3CQXA 4YR2A 2EWSA 3ZX2A 3TU5A 3RAQA 5M1PA 3V7JA 2OANA 5FPMA 1YUWA 4DL2A 1Z00B 3BQTA 1ZQMA 4A2BA 1SL0A 4JK1A 2JZBB 2P9SA 5J0TA 4M9HA 2H3GX 3ZETB 3CIPA 5KT3A 3HPOA 4FO6A 1O13A 4BDPA 4F4WA 4BROA 4LC9B 4WF9L 1S0OA 4BGBA 2V52B 2QWQA 4GV6A 7ICNA 1X2IA 4I2HA 4BR4A 4I2AA 5KPTA 1ZQJA 3IUCA 3IDHA 2DPJA 5M1QA 4O3NA 4DFKA 1BPBA 4DFJA 3ZDDA 1D4XA 3KHHA 4KLMA 4Y0WA 2CGLA 4OPHA 3RH4A 4E0DA 4FPBA 4RZRA 2BTFA 3UKRB 3RSEA 1TAUA 4BRPA 5BREA 4YCXA 1LOTB 1VQON 4KH4A 8ICTA 1XSPA 1BA1A 4B1XB 3ISCA 1A77A 1MQ2A 3UXNA 4PH5A 2JEJA 2P66A 4YDUC 4O8KA 4F5QA 4DQSA 1XU4A 2F1IA 2QWNA 2QWOA 4IR1A 1XC3A 8ICGA 4P2HA 1S10A 4BRMA 4QWCA 1TYQB 4DF4A 4XRHA 1CUKA 4I2DA 2AA4A 2W9MA 2AQ4A 5DDYA 5AQIA 4I2GA 2NRHA 2FPLA 2VWBA 2V51B 2YJFA 2Y1JA 4GNIA 4DQIA 4RPYA 3MGHA 1VQ4N 5J2IA 4DCHA 1S9FA 3CJBA 3U8XA 4ILJA 1EQYA 5KFKA 4R64A 4BXOA 3V7LA 5HL7L 1RGIA 4JKAA 3H7IA 5GAEP 1BPYA 2HMPA 1KSPA 4BR9A 3SI8A 3C65A 4I6MA 3AAPA 5F9LA 4I28A 3U9ZA 3Q7CA 2BDPA 2FMSA 2KTQA 3CMAN 4C8LA 3RB3A 1GLEG 4YDUA 2I7PA 4J9KA 1P90A 4KMUA 4IZ9A 4IOAL 3TAQA 4FWRA 2BPCA 3DXMA 3PY8A 3VF2A 8ICZA 1MWKA 2NNWA 5IIKA 5J2CA 1X9MA 3AGKA 4K4IA 4QS9A 5J0XA 3SYZA 1DGSA 4BC4A 2W41A 5J2BA 4G3IA 2C2DA 1S22A 4JHDB 1ZQUA 1U2VA 4QZEA 4J9OA 3AAQA 1T4GA 5L1KA 1X3MA 1BPEA 2HF4A 3O9SA 3SMSA 4JEPA 4WQ4C 5C15A 3ENHA 3UXOA 3ZD9A 4DLGA 3GIKA 5KG4A 7ICKA 3FDSA 3DXKA 2P9IA 3JXUA 3H8JA 2NZTA 4FWPA 3FE1A 3TSUA 1XSLA 3TI0A 3WXIA 3G4SN 7ICHA 4CZEA 2QA4N 5ELZA 5C2DA 5AQQA 1Q18A 4YG2A 1U4BA 4RCHA 8ICBA 5DQGA 1BUPA 1YVNA 3O80A 2JWKA 1ZQVA 3G71N 4KN7A 3RRGA 4F2SA 2OWOA 3MX2A 3VENA 4EBEA 2HHVA 4A5BA 3EW9A 4UQGA 3VGKA 2WBNA 3MR2A 1K1QA 9ICWA 2MUTA 2ASMA 3WXMB 3T69A 5KQDA 3AY9A 5AQXA 2AGOA 1KAYA 3EL2A 4O3RA 3FZLA 2J6SA 1QVFM 1VQKN 1ZQEA 2C2EA 4B9NA 8ICPA 3IHQB 2GUPA 7ICRA 1KTQA 4WQ4A 4JKDA 3VTHA 5KFOA 3FGUA 4DFMA 4MEYA 5KFCA 3BJYA 1YXQA 1LV5A 3ZDCA 1VQ8N 3CJ1A 3JPNA 5AQKA 2VA3A 5KG5A 3VESA 2HHXA 3LDAA 1NGHA 8ICOA 4EEYA 3QEBZ 9ICCA 3SAFA 3LDPA 1NGEA 3BUZB 3CCQN 3PW4A 3CI5A 3VPZA 1TVAA 2F9TA 2P9LB 2PI5A 4CBXA 5AZJA 2WC9A 2GELA 4MO5A 3V72A 4K42A 3PR4A 2AP1A 5BRDA 3QZ7A 4HYKA 4YOWA 4ED3A 3EZ5A 2HBLA 1S77D 1NLVA 1IJJA 3EO3A 2ISPA 3Q8MA 4K25A 4IQTA 2W8KA 1CEZA 4B9VA 4BC3A 4KN4A 3HM8A 4JN4A 2BH1A 4R8UB 2ALZA 3C21A 4I2IA 4BVOA 2IVPA 4QS7A 3UXPA 7ICFA 3W3DA 4RTFD 5IILA 2HBMA 4TUPA 1TUUA 4JKCA 1ZQLA 2Y1IA 2ZF5O 1OVYA 5EVZA 4IJAA 3TSPA 3E9PA 1RZTA 3NVKA 2JWLA 1ATSA 4YOVA 2ZUCA 5KT5A 4CCHA 3SAHA 3RH5A 1K8KB 2GX9A 5DG7A 2BR0A 1BDGA 5ADXH 4IRKA 2ZJRL 4EHUA 1ZQSA 3Q7BA 4BVPA 3PMLA 2DPNA 3EZWA 1HLUA 3OHAA 4BREA 5IINA 5KFBA 3GQCA 5B8HA 1ZQCA 3PLAA 4H0YB 3M9OB 2HVHA 4NXZA 2HW3A 2UYTA 1YF5L 4CBWA 3VEXA 3EPGA 1QLNA 2DPIA 3VGMA 3NTUA 4JK8A 4C1NI 4BGAA 1XWLA 5TZVA 1ZQXA 4JV0A 4DS5A 2ASOA 3SLCA 4YMMA 4QWEA 2P9UB 3C0BA 1BPDA 4PPXA 4ECSA 1KDHA 2HOEA 1VQ6N 1WOQA 4EIAA 3KWIA 2PFNA 1UA1A 1RPLA 3FLCO 3H40A 4FVUA 3BP8A 4PHPA 2IHMA 1HUXA 2QW9A 3GV5B 3GDQA 5MLCQ 4H5WA 3WEEB 2Q2RA 3CCLN 4JWNA 1ZQPA 5KG1A 7ICJA 2PXIA 3HRGA 2A1JA 2WUSA 5DB9A 4FBUA 5J2DA 3SV3A 1S76D 3HI0A 4B1VA 1JMSA 5J29A 1NK8A 8ICUA 2Q31A 3IKMA 3OJUA 3MR6A 4KLGA 4PGXA 4FWNA 1RDUA 4GY2B 4XUSA 3KTQA 1KFTA 8ICWA 1XC9A 4C8KA 1U45A 2ZTCA 5AQPA 5KFHA 3LDQA 2A42A 7ICPA 4Z6CA 1D8YA 8ICJA 7ICTA 1KFSA 3M5RA 5AFUA 8ICMA 2ATLA 5KFRA 3C7NB 3CC7N 3H4BA 4TQSA 4KLHA 4DHYA 3O9UA 3LDLA 3LDNA 1L3VA 4DFPA 9ICRA 8ICIA 4BQZA 4KH5A 5CB1A 2ZJAA 5KG6A 3MABA 1TKDA 2IVNA 3RJIA 5AQUA 4U7BA 1TV9A 1ZQYA 4RQ4A 4A62A 2FF6A 3KVGA 5J2EA 5GIOA 2P9SB 4DSLA 5EWGA 5JUMA 4RQ6A 3GIJA 8ICEA 1NJIO 1NMDA 3C6AA 3PX0A 3FZKA 5GAGP 1GLAG 3DWLA 4FPAA 2XY6A 1NJXA 3OSNA 4M9NA 4EZ6A 2UVUA 4IO8A 2M9NA 3BF1A 2BCUA 3IMXA 3PIPL 4JK9A 3ZYYX 2P6UA 3CJCA 1V4SA 3UE5A 4JD2B 5BPMA 3D6RA 4EBCA 5BPLA 4YN4A 1BVSA 4TURA 4B9UA 1ZQTA 3V6KA 3VEYA 3ENBA 5KFZA 2I1QA 1N8RO 3RSEB 4Z6EA 1XS9D 4KITB 4F5RA 3QEAZ 1DGKN 2V4RA 4IFEA 3I8BA 5AQOA 2XY5A 5IIJA 3OBWA 4DEZA 3N4MB 3LWLA 3AU6A 5BN9A 3TSQA 3FZHA 1ZXOA 1NK9A 5EY4A 4YORA 4PGYA 2NRRA 3CXCM 3BDPA 3QFPA 5J0UA 1QQOA 4YP3A 7ICQA 3CC4N 3TANA 1MWMA 9ICEA 1S0NA 3O8MA 4J9SA 4OPAA 4F4YA 3ZDAA 2P9PA 3HX0A 5AQJA 5AZIA 3F5TA 4EHTA 3D2EB 2C2RA 1ZQHA 3BQ0A 4F4ZA 2NRXA 4TUSA 3GV7B 1T3VA 4DSKA 4C8OA 2VGNA 4KLOA 3K9KA 3L4IA 4BC5A 2E2QA 4GLXA 4U67L 1DEJA 4JKBA 4I2JA 3MX5A 5BRFA 2CGKA 5J0YA 2YHYA 4PKIA 4UB3A 2FLNA 4YMNA 5EOYA 3OHRA 5DB8A 4ECQA 3PW0A 4YOTA 3E66A 8ICFA 5KFYA 4I6MB 5EXWA 1KFDA 3ENOA 3L6QA 1JXEA 4B1YB 2PI4A 3WQUA 2UVWA 3J8AA 3AU2A 5EWFA 1VQ9N 1NGDA 1L3TA 1HPMA 3DXMB 2XO7A 3ID8A 4IWVA 4YMOA 2QEXN 1TUYA 5GAHP 3M1FA 4NLKA 1NOMA 1HKBA 2KZZA 4C1NK 1QSSA 5KFLA 5M1NA 2RE2A 1ZETA 4DSJA 3JPTA 3E2EA 3LL3A 2AU0A 1T6CA 4YOUA 5HOOA 4ISFA 4ECYA 3I33A 1H38A 1BOTO 5EOZA 4I2CA 9ICXA 3O9RA 1NJZA 3R8EA 4OO1J 4A57A 4FS1A 4J8FA 5F2RA 2J6TA 1T7PA 4FWKA 5HHHA 4EFHA 5JLFA 2KN7A 1E4FT 3DXKB 4H0XB 8ICAA 3GE1A 4ECXA 1QQNA 4UAWA 4JKGB 3MDQA 4RPZA 3A5NC 1NGFA 1JCEA 2GWSA 3PX6A 1E4GT 5HMMA 4BG9A 5FPDA 3PVXA 4IEIA 2HVIA 3M8SA 3OSPA 1KXPA 3KHYA 3KHRA 5FPEA 3SK3A 4M9JA 3BF3A 3CPEA 2OTLN 1BPXA 1IM4A 4MO4A 2FLLA 3GV8B 2JZBA 2MUTB 5KFQA 2VCPA 5F0XA 5LJWA 4IRDA 5L1LA 2IIRA 3WQTA 3K75D 4HTLA 2J6UA 5E26A 3WXJA 2GWJA 1SZPA 3TQ1A 3K4GA 3EYZA 4KLLA 3ULEA 1KD1O 3QICA 5KFFA 4ED8A 3BEXA 4DSFA 2QWMA 3DAWA 5GADP 4O0IA 3M8RA 2PAVA 4BR2A 4QW8A 5C0YA 1ZQAA 3KHLA 3HWTA 8ICLA 3H8WA 1QHAA 9ICTA 3RB6A 5BOLA 3CCEN 4O5KA 5JVHL 4ECTA 1MC8A 3H46O 3EKSA 4HWIA 4MLEA 3QDKA 4BR7A 5L1IA 3R6MA 9ICVA 1BPZA 4DWIA 3CCMN 3O1BA 3SAGA 4FS2A 9ICIA 2ZUBA 5AZJB 1KRPA 3EKUA 3G6EN 1BO5O 2H5XA 3V6HA 3PW2A 9ICBA 1NGGA 3GBTA 1ZQGA 4JV2A 4JWMA 3N4QA 1IG8A 3LK9A 4F8RA 3PO5A 2W40A 3T5KA 2E2PA 1BGXT 1T8EA 4DS4A 4KLQA 4O8UA 2VA8A 3C1ZA 2R8IA 3Q8PB 3HP6A 3LWMA 4AM7A 4XH5A 1Q82O 3O9QA 2ZJPL 5DBCA 3RBDA 7ICSA 1NGCA 3AARA 3Q8LA 1DOQA 1T44A 4PHAA 5J2GA 9ICUA 4B1WB 5CHGA 1QQMA 4UB4A 1KAXA 2YJEA 4JAXA 2P9KA 3SJHA 4IJNA 5HHIA 1U47A 2R8JA 2I7NA 4MLHA 4AM6A 2IA6A 3MWPA 2AGPA 1SAZA 3CF5L 1QSYA 5DG9A 1U48A 5KQ8A 4BRQA 4ECRA 1AROP 4DSIA 5AQFA 1KQSM 2HBKA 8ICXA 4NLNA 2PFPA 1C0GA 3Q8RB 1XO1A 1XUPO 3MDAA 2ZWHA 1JX4A 2Q36A 4ZH4A 3QZ8A 3QFUA 5DG8A 2ZGZA 1EXNA 3PR5B 1NKBA 3QBXA 4ECUA 7ICIA 4BRNA 3CCJN 1YHQN 5BPCA 8ICCA 1G99A 4KH6A 3A8YA 3JPQA 2E2NA 1M1KO 4IQUA