2NRXA

Crystal structure of the c-terminal half of uvrc, in the presence of sulfate molecules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 75
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrxA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrxA01
3HT3A 3MR3A 4UAYA 4QZCA 5HMMA 7ICKA 3MGIA 4F5NA 1JXLA 2ZTCA 4B9VA 4KLIA 4KLTA 2HVHA 1D8LA 4UB5A 4DFPA 4F8RA 2R8IA 3Q8LA 5KT5A 1QSYA 3N97B 4F4XA 5KFLA 1KLNA 3TFRA 4R8UB 4DFMA 1NKBA 1SL2A 4UB3A 3OGUA 1N48A 3V7LA 3SV3A 2BGWA 3RJHA 5KFHA 2AGQA 4FS1A 9ICOA 4ECYA 4O5EA 5J2AA 1ZQRA 4JV2A 4JWMA 2BQ3A 9ICLA 4K4IA 2HHUA 1SZPA 1ZQEA 3PR5B 4QZBA 3PY8A 4O3OA 2HHVA 1ZQZA 1JIHA 5CJ7A 4UBBA 9ICIA 5D46A 4DFJA 4KLHA 8ICHA 3HX0A 4KN4A 2BKEA 5DQIA 4GC6A 1D9DA 4LZGA 4NLZA 8ICLA 2W9CB 3C65A 3M8SA 3M9OB 4M2YA 3GIKA 2W9BA 4XRHA 2BQRA 4R66A 3ZDAA 3BJYA 7ICJA 2J6UA 2ZTEA 4MF8A 7ICVA 4TQRA 4YD1A 5KG0A 4GXIA 3AUOA 9ICKA 1NOMA 1XS9D 4DS4A 4J9KA 5J0UA 5J2HA 4J9QA 3H8WA 2PFOA 2VA2A 4QZ8A 3TAQA 4GXJA 1U4BA 5J2FA 5KFXA 1NKCA 4NLNA 4I27A 1XU4A 3OHBA 4J9SA 2XO7A 2V4QA 2BQUA 4BXOA 5BOLA 1U9LA 4J9RA 1RZTA 1K1SA 4IQUA 5DBCA 2PFNA 3GDXA 3MR6A 5KFSA 3RH6A 4C8MA 5J0WA 4YR2A 5L1JA 1S0NA 5KFNA 2ASLA 4R8UA 2JEFA 4C8NA 2AGPA 2BCQA 5DG8A 3MBYA 4I2GA 4M0AA 3JPSA 3G6XA 4R65A 4DQRA 3SYZA 1NJYA 1NJXA 4DF4A 5CHGA 3RJIA 4BWMA 1DGSA 4PHDA 1RXVA 4KLLA 1XC9A 2ZJAA 3E2EA 4RU9A 4YXMA 1ZJMA 4K4HA 4KLSA 4ED7A 4F4ZA 3T5LA 1SL1A 1L5UA 1LB2B 4O5CA 5KG5A 4TQSA 3C2KA 4DLGA 2FMSA 1T4GA 1UT5A 5KG1A 1Z3EB 1CEZA 2JZBA 4HYKA 8ICBA 4EYIB 9ICSA 4ED1A 8ICRA 1S97A 4GXKA 4FBTA 5KFCA 4I29A 3PO5A 2HHXA 4XUSA 4QZFA 3TANA 5KFJA 4RNMA 5J2JA 5IIJA 5IILA 2W8LA 5J29A 7ICQA 2W9BB 1ZQGA 5KFFA 4I2JA 4FBUA 2JEJA 4EBCA 2DFLA 3AU2A 4FO6A 4I2BA 4RPXA 3B0XA 3H4BA 4LZDA 5L1KA 3PV8A 5CB1A 1TVAA 3BQ0A 4QWEA 2ASDA 4I2EA 2MUTA 3ETLA 4ECUA 2F1HA 8ICNA 4QZEA 4RUAA 1C7YA 1S0MA 1K1QA 5J0PA 4RNOA 4DQPA 2HHWA 4TUSA 3RJJA 2M9NA 4ELUA 5KT6A 3RAXA 4DSJA 4DQIA 2W8KA 4KLJA 4Q8FA 4KN7A 3PNCA 5KFPA 1SL0A 1ZQVA 1TAUA 1X2IA 4DEZA 5EWEA 4R64A 3BQ1A 4RT2A 1NJWA 9ICVA 2P66A 3V7JA 4YN4A 1S0VA 4QWCA 1H38A 4EEYA 1S0OA 8ICVA 5KFEA 9ICGA 1ZQUA 1V9PA 4G3IA 3ZDBA 4RQ1A 4UAZA 3N4MB 4M9NA 2LYHA 5DKWA 4QWBA 5IIIA 3G6YA 4M04A 5KFTA 1NKEA 4K4GA 1B22A 3ZDCA 4UQGA 3IM1A 4Z6FA 3HW8A 4DQSA 1KFSA 2ISOA 3AU6A 1X9WA 5HP4A 5CA7A 3TAPA 1BPYA 1IM4A 1ZQTA 3H8SA 4RQ2A 4DL2A 1Y88A 3PX0A 2XY7A 1BPXA 8ICUA 1KFTA 1TFRA 4F50A 3EWAA 2NRWA 1BPBA 2IBKA 4EBDA 3JPQA 1CUKA 3ISCA 5J2DA 1D9FA 2AU0A 5KFWA 2R8GA 2PI4A 4MEYA 4QWDA 4ED3A 4DL3A 4DFKA 1TKDA 4DWIA 2H5XA 3GV5B 4M6WA 5DQGA 7ICNA 1ZQCA 9ICMA 9ICHA 5HMLA 2R8JA 4QZIA 2XCPA 3RB4A 1ZQWA 3BQ2A 1ZQDA 4IRDA 4KLMA 5EOZA 7ICLA 4M6WB 1JN3A 2XC9A 3C5GA 3RJKA 3KTQA 3K75D 2IHNA 3RJGA 2KZZA 5KFMA 1HUZA 4KLUA 3RJFA 3RJEA 2FLPA 4P4OA 4F92B 4F5RA 5C5JA 3BQTA 8ICOA 9ICUA 3PW5A 1KTQA 2C22A 4PGYA 2AQ0A 2BPGA 8ICQA 5KT2A 1ZQSA 2ZUDA 4YVZA 4YG2A 3NGDA 3OHAA 1ZQNA 2R8HA 4Z6EA 3H40A 2XGQA 2FLLA 1ZQKA 1S77D 3RBDA 3UQ2A 3JPPA 1XSNA 4IRCA 4KLFA 4ED8A 4DSIA 4O3SA 5KFYA 3OSPA 2UVWA 2RDIA 2NRXA 8ICGA 4UB1A 4F93B 4XA5A 4B9NA 4ECZA 4NLGA 4O9MA 2F1IA 2B21A 4J9LA 2HW3A 5KFQA 3UXPA 1NK5A 4YCXA 3RAQA 3ORYA 5KG4A 9ICCA 3PW7A 2HHTA 2Y1IA 4UAWA 1NJZA 2P6UA 4F5OA 8ICKA 3MR2A 5F9LA 3V72A 1KEJA 1XSPA 3GV7B 9ICEA 1ZQHA 4ECRA 3PX4A 1SKWA 1EXNA 4F3OA 4RQ0A 4JV0A 3BDPA 3ZD9A 5J2BA 4EBEA 3C1YA 2W9CA 4DOBA 3TI0A 4B9UA 4DL6A 3FDSA 5KFKA 5J0TA 4RQ4A 1T3NA 3EPIA 1HUOA 3RH4A 7ICIA 5KFBA 4E0DA 4JV1A 4YR0A 3PX6A 4C8KA 1D8YA 7ICGA 2FPLA 4M47A 3QZ8A 4BGDA 2ZUCA 4ELTA 4J9PA 4DOAA 3QEAZ 3HPOA 4F4WA 1HJPA 5KFUA 2KN7A 4YFKA 3PW0A 3QEBZ 4DOCA 1S10A 1TK5A 4NM2A 4RQ5A 4QWAA 1TK8A 1ZQIA 1ZQFA 3M9NB 3RB6A 5HNKA 4QZ9A 5J2EA 3KHHA 1MQ3A 2BPFA 4C8LA 8ICSA 9ICNA 4KLOA 3Q8PB 5J0YA 4IQVA 9ICBA 3LK9A 3GILA 4M9JA 1L3SA 1QSSA 1UA1A 2KTQA 3KHGA 3UQ0A 3T5KA 5CWRA 4I2CA 3PMLA 4GC7A 2ISPA 2VANA 3RH5A 4MF2A 2MAXA 3EZ5A 2UVRA 2ATLA 4MFCA 4B9SA 4P4PA 4TUQA 2BDPA 4MEXA 1NK7A 3ZDDA 9ICWA 4ECTA 3C23A 4PHAA 4F2SA 1A77A 5KG3A 5DBAA 1NK4A 1COOA 4KLQA 2FPKA 5KT7A 2AQ4A 3JPOA 2C2RA 1ZYQA 7ICHA 5DGBA 2ZJ5A 1RXWA 4PGQA 5J2IA 7ICPA 5JUMA 4QW8A 7ICRA 3KHRA 3B0YA 3M9MB 4F5QA 1LV5A 3OJUA 3HWTA 4XQ8A 4I2AA 4Q43A 2HHQA 3GIJA 4PHPA 2GWSA 5KFZA 1MC8A 2V4RA 4O3NA 5KFIA 4YR3A 3LWLA 3KHLA 3T5JA 1RYRA 9ICJA 5KG2A 4F2RA 1B43A 4RQ3A 1JX4A 4R63A 3RR8A 1QSLA 1XO1A 3TFSA 4IR1A 1JMSA 1WCLA 5J0OA 4P2HA 4ZH4A 3PVXA 1BPZA 4F91B 3EYZA 4IQTA 4EYHB 2KZ3A 3RR7A 2FPMA 3PO4A 4NM1A 9ICPA 1NK0A 1BGXT 1L3UA 1ZQPA 1Z00A 3MGHA 9ICAA 4RQ7A 5BOMA 2J6SA 3FYHA 5DG9A 8ICCA 5DG7A 4YQWA 4DL4A 7ICSA 4QZDA 2A1JB 5CP2A 4RPYA 4DQQA 8ICJA 2DPJA 1UA0A 4F4KA 1WCNA 4KLEA 3MFHA 5TZVA 3RBEA 4ED2A 4DSLA 4YD2A 2C2DA 4ECSA 8ICXA 4RPZA 7ICOA 4JUZA 4Q8EA 3H8JA 3C21A 4YMNA 2RDJA 2JEGA 4NY8A 4QZAA 3PW4A 4O0IA 1KDHA 8ICZA 2BPCA 4RQ6A 4RQ8A 5CR0A 5HHIA 2UVVA 5DB7A 2P6RA 4YMMA 5IINA 4FS2A 2I9GA 3OSNA 2KFNA 5KFDA 1U49A 4EZ9A 4O5KA 3RB3A 1ZQYA 3TQ1A 5DB6A 8ICMA 3IHQB 4RZRA 5L1LA 2W9AA 1T8EA 5KT3A 4O3PA 5BPCA 4DL7A 5J0QA 2J6TA 5D49A 4P4MA 4QZHA 4BXOB 1SKSA 3Q8MA 3JPNA 3HP6A 4QZGA 2DPIA 3LWMA 4O3RA 2ZJ8A 2ZTDA 4YMOA 3LDAA 1ZETA 3TARA 3RTVA 4MFFA 4DF8A 1IXRA 4I2DA 1QLNA 3C1ZA 5IIKA 1TV9A 1ZQAA 2IHMA 2ZUBA 3UPQA 2HVIA 1QTMA 3GQCA 4ECXA 2KFZA 8ICYA 4KLDA 3K4GA 4NXZA 4DSFA 4KTQA 1ZQLA 2NRTA 1RYSA 5D4BA 2Y1JA 8ICIA 4J9NA 1BPEA 1ZJNA 1U45A 3T5HA 5DB9A 4ED6A 4RUCA 3PMNA 8ICWA 2ASJA 5KFAA 3ZD8A 4DLEA 4KITB 1S9FA 2AJQA 2BCRA 2UVUA 7ICTA 3GFKB 1KFDA 1PZNA 3V6JA 4JK1A 5DLGA 2AGOA 4IRKA 4YXJA 1RPLA 1L3VA 2A1JA 4B9MA 4ED0A 1U48A 2V9WA 2PFQA 2BHNA 1MSWD 2NRVA 3ISBA 3SV4A 3JPTA 4PPXA 1KSPA 9ICRA 3UXNA 3V7KA 4Z6DA 3GIIA 4M9LA 4M9GA 2PI5A 2JEIA 4PGXA 8ICEA 3Q8QB 9ICQA 4B9LA 4F4YA 8ICTA 5HHHA 4RNNA 3MABA 2IA6A 1JXEA 5DLFA 7ICMA 7ICUA 4F5PA 3PW2A 2FLNA 5DB8A 4M9HA 4KMUA 5DDMA 1Z00B 5EWFA 4O3QA 2ALZA 2KZMA 2IMWP 4I2HA 2BR0A 5DGAA 4BWJA 4TUPA 3GV8B 2C2EA 5KG7A 4B9TA 4C8OA 4DSKA 1L3TA 4NLKA 2VA8A 2W9MA 5DBBA 3OJSA 3SZ2A 3EW9A 3M8RA 4JWNA 3MDCA 3Q8KA 2VA3A 8ICPA 3ZDEA 3GIMA 2FMQA 4LVSA 5J2KA 3C2MA 7ICEA 5F9NA 4UB4A 1S76D 4KLGA 1UT8A 4TURA 1KRPA 4QW9A 1XSLA 2NRRA 5KTQA 5L9XA 1T7PA 2OWOA 3RRGA 3RB0A 2BCVA 4I2FA 5J0XA 4PH5A 5DDYA 4UB2A 3C2LA 3V6KA 2XY5A 3MR5A 1BVSA 3G6VA 3C5FA 2XY6A 3H4DA 4DS5A 4ECWA 9ICFA 4DO9A 5KFGA 4Z6CA 2R8KA 9ICXA 5EWGA 1TAQA 5L1IA 3MDAA 2HHSA 4DSEA 5J2GA 4ECQA 2C28A 3THVA 1ZQQA 3RRHA 4Q45A 5J2CA 4J9OA 5J0RA 5KFVA 3MFIA 1BPDA 4BDPA 5J0SA 2BCSA 5IIOA 7ICFA 3Q8SB 3ISDA 3Q8RB 3QE9Y 9ICTA 1ZQJA 3H7IA 2JZBB 2PXIA 4DL5A 3SI8A 1ZQXA 1ZQBA 2PFPA 8ICFA 1X9SA 1N56A 4EZ6A 3PR4A 3UXOA 4PHEA 3JPRA 4ECVA 1ZQMA 4IQWA 3QZ7A 3EPGA 5KFRA 5KG6A 1NK8A 4I2IA 1XWLA 1NK6A 5KT4A 2Q0ZX 3NTUA 2BCUA 5KFOA 1ZQOA 4ELVA 2XGPA 4IR9A 4I28A 4RT3A 4YP3A 2NRZA 4Q44A 4UBCA 4CCHA 2I1QA 2WTFA 1A76A 5DQHA 3T3FA 2XCAA 4X5VA 1X9MA 1U47A 8ICAA 1AROP 1TK0A 1SKRA 1NK9A 5IIMA 1DOQA 3V6HA 2FMPA 4GLXA 1MQ2A 4J9MA 2F1JA 2MUTB 4MFAA
chains in the Genus database with same CATH superfamily
2WFAA 3HT3A 3A0IX 3IFRA 3MR3A 3A5NC 4NXMK 4DR2K 4F5NA 4KLIA 2ZTCA 1S6PA 2HVHA 3KIOA 4UB5A 4DFPA 4F8RA 1WSGA 2D0OA 3SJHA 5LJVA 1XNSA 3O0FA 2EAPA 2W43A 4BR7A 2X78A 3TFRA 1NKBA 1E4FT 3AQEA 3OGUA 3SV3A 2I7NA 3RJHA 4FJGA 4RW7A 3L3FX 5SZTA 2DQNB 3NH0A 3JSMA 5LMUK 1QCKA 3KLHA 3U3YA 2FSKA 4GNIA 1D8BA 5AQQA 3A0BU 1ZQEA 4QZBA 3NDKA 5ALMA 3IDHA 1XMOK 1ZQZA 1JIHA 3ITHA 3AL0B 2JXJA 4E7IA 4KN4A 5DQIA 1X3MA 8ICLA 2H3IA 3WNEA 5BN8A 3OYCA 4AF1A 3C65A 4X66K 3HSCA 4M2YA 4L3QA 4ICLA 3HPGA 4B6JA 2W9BA 4YFUA 3EEQA 3TAMA 1HLUA 3BJYA 3F9MA 2OA8A 3WNFA 3DLGA 4TQRA 2E2OA 2PFUA 2G09A 3VC8A 2XIDA 3DM2A 3T1HK 1XS9D 4FK4A 2K4HA 3MN5A 1OXJA 4B1ZA 4B8AB 1GOAA 4J9QA 1NNEA 2WF5A 3AVFA 3LAKA 3SBGA 4C1NI 2VA2A 2O4IA 5KFXA 4J9SA 4IXCA 2XO7A 4CFBA 1RQNA 3VQEA 2BQUA 1M90O 1IBMK 2E2PA 4J9RA 5AQFA 1WSEA 3MX5A 4XH1A 5C15A 3SUOA 5DBCA 2GV9A 3ID6A 4DV7K 2UXCK 2JHDA 1VQKN 4DR5K 4KO0A 4N41A 3RH6A 4AILC 3J8AA 3THYB 3P38A 5C2DA 1ED1A 4R8UA 3HXMA 4I2GA 3AGRA 1V38A 3AVJA 4R5PA 4US8A 4R65A 3L2RA 2P9NA 2LPEA 3SYZA 1F44A 1NJXA 1Q46A 3RJIA 4MDBA 3WKEA 4Z4IA 3S9HA 4KLSA 4YXMA 2HB5A 5T14A 4M45A 4ED7A 1MA9B 3QESA 5KNIA 3T5LA 4B1XB 1LB2B 4O5CA 3CCSN 4IOXA 1SV5A 3NVMA 1TUUA 1UT5A 1YT3A 2ZXHA 5KG1A 2JZBA 5JS2A 3OYBA 8ICBA 2R7YA 9ICSA 2G8UA 3PLAA 1S97A 1QQ7A 4GXKA 4FBTA 5GTIU 4CZGA 2A3VA 4XUSA 4KB0A 4GV6A 3Q7CA 1HYZA 1D4XA 5BR9A 4M42A 5IIJA 5IILA 2W8LA 4CGGA 2W9BB 3CJ1A 4GVEA 2B6GA 1ZQGA 3LPTA 4EBCA 5F2RA 2DFLA 3U9DA 5JS1A 4RPXA 1HKCA 1QHTA 5CB1A 2YY6A 3HL8A 4QWEA 2ES6A 3ZYYX 2W7OA 3EY1A 1I94K 2IDOA 8ICNA 4OPKA 1NBWA 1RBSA 2HHWA 2JWKA 3IDWA 5CZ2A 2FJ6A 3KKAC 4M41A 1ECWA 2M9NA 3RAXA 3RSEB 4DQIA 1NNLA 3HJEA 3L3UA 5IWAK 4Q8FA 1X3NA 3CM6A 4FLTA 4ZOHC 1ZQVA 4B9QA 3UMBA 4FM0A 3G25A 2HDOA 3LM2A 4DV0K 3R9PA 1N5WA 2IIRA 3V7JA 2VG7A 1EWQA 4Y2JA 4BRDA 4QWCA 5ALZA 3WKAA 1S0OA 4IEIA 4LFCK 9ICGA 5M1PA 5LL6Z 3TADC 4RTFD 3VQPA 4BG9A 1YJ9N 4UAZA 1OH5A 2LYHA 4OPAA 5DKWA 1UAXA 3G6YA 5EE9A 1HNXK 4KFBA 4DV1K 4UQGA 4Z6FA 3HW8A 4CIEA 3DLBA 3AU6A 5AIAA 5ALPA 5CA7A 3TAPA 3HP9A 2ZIWA 3RMAA 4DL2A 1R59O 2XY7A 4C1NK 3N28A 1TFRA 4YDUA 2JGUA 2E8NA 3F53A 2HSTA 2E5SA 4CGJA 1J6ZA 5EE1A 4JV5K 1D9FA 1VQON 3AAQA 4QS8A 3J7ZO 1ITGA 3CCMN 4MEYA 3LDSA 3V4IA 4E7HA 1N33K 4CZMA 5AKLA 3GV5B 3SD7A 9ICHA 4MLHA 1ATNA 5HMLA 3L2WA 4P0QA 2R8JA 4CEQA 1T03A 1ZQDA 4IRDA 3T1YK 4IKFA 4HTUA 2YHYA 3FAHA 1NJIO 2KZZA 5B8HA 2HNYA 2P5OA 5C5JA 2F4VK 2FBTA 4CZJA 3CJBA 1FIQA 2X6NA 1VQ5N 3G0ZA 3SQIA 8ICQA 1WSJA 2YV0X 1ZQSA 5AQJA 3D2FB 3VN5A 1V97A 4DV6K 4M63C 4LSNA 4F3TA 4O4GA 1ZQKA 1XSNA 4IRCA 2EZZA 4N56A 4ED8A 1YUWA 2K4EA 5KFYA 4O3MA 3CC2N 4BC5A 4E89A 2P9SB 1EX4A 8ICGA 4JKEA 1VSLA 2CGLA 3QMLA 4AQYK 1RT1A 2B21A 3ENHA 5AQUA 4GFJA 4YCXA 4PKHA 3SAFA 4J8FA 4JS4A 2HHTA 5AIBA 2Y1IA 2E5LK 2J4RA 5F9LA 4ECRA 3PX4A 4G1QA 4XIUA 3OYAA 4J2DA 4DV2K 1ASVA 4F3OA 4JV0A 3SJJA 1IIPA 4FJKA 3BDPA 2QW9A 5J2BA 3KK3A 3C1YA 1M1KO 3IV6A 1Z1BA 4CF0A 4DL6A 3FDSA 2QKQA 4CJUA 3EPIA 1HUOA 4OD0A 3ZEUB 4JV1A 4E0DA 2CGKA 4I2PA 3O9UA 3VEYA 3I28A 4H03B 2KG5A 4PL1A 2P9IB 2W41A 3AVGA 5AQIA 4BGDA 1N34K 4EELA 5EE0A 3CJ7A 4ELTA 4J9PA 1QZ5A 5ALLA 2VWBA 5FP0A 3HPOA 1HJPA 2KE7A 2KN7A 1N8RO 4YFKA 1S10A 3ONNA 4DOCA 1TK5A 1A5WA 3TTDA 4QWAA 4BDYA 4IWVA 3RB6A 3KHHA 2NO4A 4C8LA 8ICSA 4KLOA 2KKVA 4FJ8A 3ZSOA 9ICBA 2G08A 2G06A 3OA9A 3SENA 3K9KA 4ISEA 4PHTX 4BVPA 2HOFA 4CJ7A 2YX6A 2ZIUA 4Y2RA 3PMLA 1KBUA 4I2CA 2WBNA 3RH5A 2H3QA 1XO0A 3EZ5A 5J8YA 2HF3A 4E1MA 4B9SA 4AHCA 4AYBF 5AQZA 1J2MA 4DMNA 4MEXA 3ZDDA 3CFOA 3ICXA 4ECTA 1GLFO 5DBAA 5H1SQ 1COOA 1PVRA 3VGKA 1WUDA 7ICHA 1ZYQA 2WFBA 1JJ2M 5DGBA 2JR5A 2ZJ5A 5J2IA 1RXWA 2UU9K 3QINA 4FZZA 4QW8A 4OPJA 2IGIA 5JTIA 2KLAA 3LAMA 3OJUA 2GH1A 4PY5A 2P9LA 3L4IA 3DAWA 2WAQC 5K14A 3KHLA 3T5JA 9ICJA 1ZOLA 2DUYA 5AQYA 1HNWK 2MRLA 5KG2A 4RW9A 5HOOA 1NMDA 2Q2RA 4LC9B 4LF9K 5GAEP 3TFSA 4IR1A 1EQYA 3E58A 5ALWA 5E79U 2FBXA 4Z0UA 3OYMA 2BGGA 1YF5L 2G5IB 4F91B 3AO2A 5C12A 2FPMA 2G8HA 2RHFA 4HCCA 4Y2YA 3M3ZA 4LF7K 3AVIA 3RWUA 5C24A 2A19A 2F2AB 2ZE2A 1GLBG 1N2XA 4I6MA 3WUHA 4FJ9A 3ASMA 4DL4A 3L8BA 3OYFA 2E8PA 4BE1A 2A1JB 5CP2A 2QLTA 4US9A 4DQQA 2DPJA 1R0AA 5CYQA 1TKTA 3MFHA 1ATSA 1ASWA 3C7NB 1DTTA 5JMVA 4YD2A 2FF6A 2CPRA 5M1OA 4DV3K 1GLAG 3FZHA 2RDJA 1J53A 1BNPA 4NY8A 8ICZA 4QZAA 1KCFA 1P90A 2E8AA 2LBOA 4FLXA 2F8TA 5CR0A 5HHIA 1S1VA 2O8BB 4BX9C 5DB7A 2AA4A 1TKZA 3OSNA 3EN9A 2KFNA 5ALRA 3FFKB 3V1RA 2D1KA 3NGIA 3S3OA 4O5KA 1BHLA 5CYMA 2KP7A 1ZQYA 5EE3A 3CERA 1YZ7A 8ICMA 2JH1A 3VQQA 4Q5VA 1X6IA 4RZRA 2W9AA 3SMSA 2KICA 3ULEA 4DL7A 2DKZA 5J0QA 5D49A 3NRWA 3KZBA 4KRFA 4Y2PA 2XVTA 4BXOB 2F9WA 3B6PA 3DWLA 3H08A 3IKMA 3Q8MA 4AM6A 2ZM6K 4IOAL 2DPIA 5ALSA 3LWMA 3U26A 4FWNA 2KKPA 3TR8A 4BC4A 1ZETA 3AVHA 3O9RA 1HNVA 1LAVA 4K42A 4BJQA 5JU5A 3CCLN 2IHMA 2UUAK 1KAYA 3UPQA 4OJOA 1RTIA 1N61A 3GQCA 4OO1J 4O0JA 1JROA 1LVHA 4ID5A 3ZLJA 2KV2A 2L5YA 2Y1JA 1ZJNA 3VF4A 3T5HA 2E1YA 4CHOA 5DB9A 3HTVA 3I1YA 4O5BA 1FW6A 8ICWA 3OYHA 1RM6C 3QICA 2UVUA 2OM6A 3WKCA 1RGIA 1PZNA 5KPRA 3SPYA 4FWMA 4IRKA 3I76A 2A1JA 5FLXO 4FPBA 3AQFA 2V9WA 3WXKA 1ZXOA 4BRAA 1HPZA 4C4TA 3KK1A 4DR7K 2YJEA 5FPMA 9ICRA 3D2EA 3V7KA 4M9LA 1EXQA 2YNIA 4PGXA 3UB5A 3Q8QB 3K5MA 9ICQA 4FZNA 4F4YA 2QWRA 2W03A 1VHXA 5HHHA 1RDCA 1SGGA 4P0QB 3D6JA 3OYGA 4M9HA 3LP2A 1Z00B 5A2QO 2Q0RA 2KD1A 4O3QA 2HOQA 2QWLA 3PUFA 1DXSA 5KAFU 5DGAA 5AM0A 3GV8B 4KAZA 2HMXA 3MMVA 4FVMA 3ZT1A 3K1RB 3L6QA 4OPHA 3EW9A 3M8RA 3A5LC 3Q8KA 4ICAA 4M3WA 2VJ5A 4BUGA 4EENA 7ICEA 4CZLA 4UB4A 2IOFA 3SMVA 3VENA 4KLGA 4W5QA 1KRPA 3CJ9A 4ILGB 1XSLA 1KN5A 1XQSC 5AR0A 5L9XA 5JRTA 4BRCA 4U7CA 3RB0A 5J0XA 4G9ZA 3DDHA 9ICFA 3D2QA 4DO9A 4I6MB 2LHTA 5KFGA 4U7BA 2RE2A 3ZSRA 5EWGA 1TAQA 5L1IA 4FYDA 3MDAA 2HHSA 4FJNA 1HJOA 1ZQ1C 2QWMA 2WB1C 1YTUA 4LF6K 5ALQA 5T7BA 4J9OA 2CH5A 3CMAN 4KX5A 5ALFA 5KFVA 4JRQA 7ICFA 2BCSA 4E7JA 1JRPA 4F9OA 1C0GA 2K89A 5AM3A 2A1SA 3LM9A 2DKXA 3A5MC 1SV0C 2A41A 4DL5A 2E4LA 1ZQXA 1V85A 2PAVA 3QU7A 3JPRA 3VGMA 3EPGA 4CZIA 4I2IA 2YN4A 4DV5K 4IJAA 4OLBA 1C1CA 1ZRMA 3AA2A 2XGPA 3UMCA 4I28A 1JLCA 4RT3A 4WQ5C 4UBCA 1OUQA 4GV9A 1A76A 5DQHA 4X5VA 1X9MA 8ICAA 2ZIXA 4EP5A 5KGWA 1AROP 1QQ6A 2FF3B 2F3NA 3C6AA 3C6HA 5AQTA 4FLYA 3V6HA 2F9TA 4J9MA 2MUTB 4TSXA 2VKQA 4YOUA 4BROA 5HMMA 3HOTA 1JXLA 4B9VA 4KLTA 1T6DA 1OH6A 1D8LA 2HNZA 3DXKB 1X9XA 4IDKA 1WSIA 1SZ2A 1K73O 5KFLA 2YMPA 4B3SK 4HVJA 4R8UB 1VJ5A 5AQWA 3V7LA 3AO4A 4Y2XA 2VYPA 5KFHA 4N47A 4FS1A 4J03A 1GLEG 3WQUA 2DY4A 3WK5A 1UWBA 3M8QA 4ECYA 2EANA 3OS2A 2VCPA 1QQMA 1ZQRA 4JWMA 3SMPA 2BQ3A 4CZFA 3H1QA 4Z4CA 1S9EA 3K5NA 3ED5A 2HHVA 5CJ7A 4UBBA 4C0ZA 2PBDA 4DFJA 4KLHA 3E9OA 3HBTA 1JL1A 2DGZA 2AH5A 2LMRA 2P9PB 3UMGA 1IKWA 4H8KA 5KRSA 2GO7A 1C20A 3M8SA 1N6QA 3OPXA 1W97L 3GIKA 1K9MO 4XRHA 2BQRA 4R66A 3ZDAA 2ZGYA 3J7YP 3RMDA 1FJGK 3IMXA 3I8BA 5HL7L 1S22A 4YD1A 4JKCA 3MXMA 3VQDA 5AI4A 5KGXA 5KG0A 1HRHA 3SQ4A 3QEXA 5ALEA 3I8DA 1PK3A 1NOMA 4DS4A 5GAHP 4J9KA 3GL1A 1Q18A 2QK9A 3J7AP 2IVNA 1RTDA 3ZT0A 2PFOA 4AH9A 4QZ8A 1U4BA 4LH4A 5J2FA 4BRFA 3CFPA 4NLNA 2YMMA 2BE2A 4CJKA 4Y2TA 4I27A 4UATA 1KAXA 2P9SA 1NGDA 3L4QA 4RCHA 5BOLA 4BG8A 3SQ2A 1OH7A 3I0SA 1VQ4N 1K1SA 4CF3A 4BRQA 5AKKA 3NE6A 2JGAA 3GDXA 1PUZA 2WF6A 3MR6A 2OXOA 2RQ5A 4C8MA 5ALNA 4DTOA 1HYSA 5KFNA 2ASLA 4C8NA 3CCJN 3VA3A 1X9JA 2QM1A 1X42A 3J81O 1KLMA 2YNHA 3U6FA 4BWMA 3PZPA 4JKDA 4PHDA 2FSJA 2ZJAA 1S1XA 3E2EA 4KHUA 4JI5K 5B5EU 4OJRA 4Y1DA 4F4ZA 1L5UA 4JI7K 4ZTFA 2WONA 5KG5A 3OYJA 2FMSA 5C10A 1MN8A 4DTSA 2F96A 1CEZA 1KQQA 4OLAA 4EYIB 2LI6A 8ICRA 2E8OA 4BRGA 4I29A 2HHXA 3TANA 3DXMB 1T3VA 4RNMA 3O9SA 1FKPA 7ICQA 4CEDA 5AM1A 4FBUA 2V7YA 3JXUA 1T3QA 3M1FA 4DR3K 2G8FA 4K0KK 2DTUA 5ALTA 4CJPA 4F71A 2QTDA 1W7AA 5L1KA 5AM2A 1VSDA 4DTUA 5JICA 3PSTA 3BQ0A 4I2EA 4KHYA 5EXWA 3C0BA 2KSOA 3SEIA 4LSLA 3TSUA 1UQVA 3O1BA 3VEOA 5J0PA 4DQPA 4BRLA 5EVZA 1SXEA 1GLCG 4TUSA 3E9LA 4BE2A 4NWIA 1XI1A 5KFPA 3S3NA 5EWEA 3O9QA 4DU4A 4NCGA 1COKA 1WG8A 5AQHA 4RT2A 2E8MA 1NJWA 2P66A 5AKJA 4YN4A 5FRNA 8ICVA 4EEYA 3RSEA 4DTMA 4YNQA 1QQ5A 3ZDBA 2P9NB 2ZIVB 4CJVA 2Y9TA 1QHAA 2XHBA 3WK9A 2EZXA 4M04A 4JKGB 3BY5A 1WB9A 1B22A 3QU4A 2Y9UA 3D0PA 5HLFA 4KHSA 2ISOA 5HP4A 3K9JA 1ZQTA 1YXQA 3H8SA 2D0BA 3QUCA 1VRUA 4RQ2A 1KFTA 3PX0A 4FOEA 1BA1A 1YTAA 5TKYA 2ZF5O 3WXJA 3EWAA 1NMNA 3E1YA 3KK7A 2KSOB 3KD1E 4B8CA 4WFAL 3JPQA 3RF9A 3MECA 4E3SA 3ISCA 5J2DA 5HR7A 1GLLO 1NU0A 2PI4A 4DL3A 4ED3A 2H5XA 2A6AA 7ICNA 2B0CA 4BC2A 2XRIA 4Z94A 1EWRA 4KREA 2HBJA 4NJ8A 5EOZA 3U8XA 3FZFA 2WAQF 7ICLA 3HSTB 3CFRA 5JVGL 3RJKA 1JN3A 4H5NA 3KK2A 3K75D 4FM2A 1Z4OA 2D6FC 5ALGA 1HUZA 1FEZA 3RJFA 1CXQA 5KI6A 3TWHA 3RJEA 1C6VA 4P4OA 5HRRA 9ICUA 3N7RC 2C22A 3PW5A 2AQ0A 1SIJA 2X6SA 4FVUA 4HCBA 3OHAA 1ZQNA 3O8MA 1KL9A 5H2FU 3H40A 1KW4A 4OKJA 2IOFK 3G71N 3RBDA 3MEDA 3JPPA 5AK6A 1ZBSA 2I5JA 2LKYA 4KLFA 1Y97A 5ADXA 4CHPA 4NXNK 3WXLA 3MWPA 4CFCA 4UB1A 3TABA 1XHXA 4USAA 4XA5A 3HJFA 4CRXA 4NLGA 3R3LA 2F1IA 4CJSA 4J9LA 3M6ZA 1ZD2P 1SB3C 5HR6A 4H0PA 4W5TA 4JKHA 2P9KB 4M7YA 4UAWA 1NJZA 2P6UA 3ZI4A 3NS1A 1HKGA 1XSPA 3GV7B 3BF3A 3H1VX 1EXNA 1M6YA 3O9TA 1HEKA 4M3YA 3NVZA 5JLHA 5AJ3K 2WTUA 2D0PA 4H0VB 3ZSWA 2W3RA 3DRSA 1TKXA 4LH5A 5AICA 2B4JA 5J0TA 2FLOA 5AKXA 3DMJA 3QNOA 3RH4A 3VEWA 3VQBA 4M3RA 4YOXA 2XI9A 4C8KA 5AQMA 3FM9A 1D8YA 2GWJA 7ICGA 2FPLA 3QFUA 3R1XA 5M1NA 2WF9A 5MLCQ 1RILA 3UKRA 3QNNA 4F4WA 4QOZB 3A2FA 5KFUA 2V51B 3QEBZ 1LKYA 4FFDA 1TK8A 1ZQIA 2JEGA 2GLEA 5AZJA 1JCGA 2HBKA 2GWKA 5HNKA 1MQ3A 4OVLA 3VGLA 1ZBUA 3MN9A 3JAMO 3LK9A 4M9JA 5AM4A 1BI4A 2QXFA 4PKIA 5BPNA 1HNZK 1QSSA 1UA1A 1WOQA 5B66U 4NCAA 1V4SA 3KHGA 4OJ5A 4DCHA 3I55N 4K8ZA 4KV8A 3T5KA 4FLVA 4BRMA 3QNMA 2RP5A 4CJQA 5BRDA 4O8KA 3M6KA 5I3UA 2O8FB 4PZOA 4EX7A 2UVRA 4MFCA 3K57A 1VDVA 4P4PA 3H3OB 1N5YA 5GIOA 2OPPA 2E1ZA 1N63A 4FZYA 1BIZA 4C23A 9ICWA 3C23A 1A77A 5ALYA 5KG3A 1BUPA 2B5JA 1U04A 3B6OA 4MQ3A 2FPKA 1WYGA 4CF5A 4K8XA 4PGQA 5AKGA 5HBMA 5JUMA 1MA7A 4WF9L 3HRDD 1MWKA 2QKKA 2KJ8A 4CJFA 1L7OA 3F2DA 1MWMA 3K59A 2WOMA 4CK3A 2UXBK 1RDFA 1VQ8N 4JK8A 3QIPA 4MDAA 3TPQA 1BCMA 4CHNA 2V4RA 3KLIA 3QXGA 3D45A 1B43A 3KKRA 3IG8A 1JX4A 5C0YA 4R63A 4OGCA 3RR8A 3C6TA 2QXLA 4P2HA 4NCBA 3K2PA 5J0OA 3ATUA 4ZH4A 4XEIA 4DG1A 3EYZA 4IQTA 3PO4A 4NM1A 4JI6K 1F5SA 4PZNA 1BGXT 5ALOA 9ICPA 3EE9A 1Z00A 3TAFA 3DLRA 4NLCA 3K58A 3FYHA 8ICCA 4JLHA 1RBUA 3TAGA 4QZDA 2A3ZA 4RPYA 8ICJA 1MU2A 4AHSA 1UA0A 1YAGA 3P4IA 4DR6K 2JWLA 1QQCA 4DSLA 2ZD1A 3AVLA 1L7NA 3BGRA 3E66A 4IFEA 1PK1B 4RPZA 3C6UA 1J5OA 4JUZA 4Q8EA 2AXTU 3H8JA 1KAZA 4YMNA 3PW4A 2FE9A 4RG8A 1CRXA 3PIPL 4RQ6A 3ZT2A 1N36K 2UVVA 1IV0A 4YORA 4FS2A 5KFDA 1U49A 2ZWHA 4H0OA 3TQ1A 5C42A 1ZD5A 4AYBC 1T8EA 3RMCA 2VGNA 5KT3A 3CCVN 4O3PA 1IKXA 5K4LA 1HIWA 1SKSA 2CRXA 4RQNA 2ITGA 4B1UB 3HP6A 4O3RA 2D4WA 5AQKA 3WNGA 2ZTDA 3T79A 4YMOA 4MFFA 3AVAA 4DF8A 4PKGA 1RFQA 4CEFA 1FFUA 4AHTA 5EOYA 2NO5A 3C1ZA 1UPHA 3QU2A 1TV9A 1ZQAA 2O4GA 5GADP 5J1EA 3WXIA 3H8MA 4ECXA 2KFZA 2PKEA 4KLDA 3K4GA 4NXZA 1NOZA 3OS1A 3Q7BA 2EQYA 3BF1A 2NRTA 2IVOA 5D4BA 3BS7A 1PVPA 3V9SA 1Y64A 3NF8A 4C80A 2GX9A 4ED6A 3S41A 4RUCA 4YDUC 2YHBA 2KW4A 3E9PA 1S9FA 3RVCA 3AVCA 1BI4B 4CJ5A 5BPMA 3GFKB 3KJVA 5J2MA 3V6JA 2D0CA 2P1JA 2O8EA 4H5TA 1RPLA 1L3VA 1NGAA 3EE8A 4QS7A 4B9MA 1E4GT 1BDGA 1RYUA 4JRPA 2YKNA 2BHNA 3C95A 1MSWD 4O55A 3D2FA 4J2BA 4DV4K 2DFHA 5SWMA 4FCYA 3TACB 3UXNA 4KTWA 3NH1A 4Z6DA 4M9GA 1RT5A 2ASOA 5AM5A 8ICEA 4Z4EA 4K25A 4CIFA 8ICTA 1FO4A 4K41A 1YIJN 3HPHA 2IS3A 3VETA 1L7PA 2JH7A 3FZLA 5DLFA 1B92A 4FSVA 3PW2A 5DB8A 5BREA 4ILHA 3RMBA 3NVVA 4BRKA 4B3OA 3M7DA 5EWFA 3AA4A 2IMWP 3J81j 3QU9A 3WK7A 2BR0A 4I2HA 4BWJA 4TUPA 2C2EA 4IG3A 4ACOA 3K0SA 4CBXA 3LVVA 1JLAA 3HVTA 2W9MA 5DBBA 4JWNA 4CFAA 3SCXA 3MDCA 2VA3A 2CGJA 5E84A 5HROA 3ZDEA 4IC9A 3C2MA 4CNQA 3PSPA 4LJXA 3N4PA 2GTDA 4FZLA 4OJ6A 3DEEA 2VWJA 4I7FA 2A1RA 7ICTA 3IP4B 3AO1A 5AQPA 5M1QA 3C2LA 2XY5A 5DDYA 4UB2A 1SL1A 2DF4B 3MR5A 4FWPA 2XY6A 4DS5A 3GZFA 2PMZC 3H4DA 2G8VA 2OHFA 4Z6CA 9ICXA 1BOTO 3DLLL 2OTLN 4JYAK 5J2GA 3CC4N 1YHQN 2K8CB 4DR4K 4H5WA 1ZQQA 1NG9A 4LFBK 1A0PA 4BR9A 3MAQA 3BP8A 3SUNA 1BPDA 1EETA 2NRHA 5CZ1A 4JI3K 4UASA 3ISDA 2ZG6A 3QE9Y 2VIXA 9ICTA 4GY2B 2ASMA 4A62A 3SI6A 4IL6U 4YOYA 3LDLA 2RN2A 1ZBLA 4M3TA 5G5HA 3CJCA 1Q86O 1X9SA 4EZ6A 1ZC6A 2F8SA 2OTJN 3WK6A 4IQWA 2KVCA 2V52B 3DLKA 3FZMA 4JMUA 2KJ9A 1XWLA 4XH5A 2Q0ZX 3ZX0A 1DKGD 2QWQA 4IR9A 4E1JA 3CXCM 4YP3A 4KTZA 2NV3A 4CIGA 4CCHA 2I1QA 1KD1O 1SWWA 3H0RB 3VQCA 4E1NA 4FWOA 3HKZF 1TL1A 3BS5A 1MQ2A 3SLCA 3MFIA 3EKSA 3GE1A 4GKKK 4UAYA 4QZCA 7ICKA 1RDWX 3MGIA 2HCFA 4QJFB 1C0UA 1WWUA 1E3MA 5C2FA 1VQPN 4OJLA 2HOEA 5J2NA 3CCRN 1N62A 2K4PA 3N97B 1SV0A 1K8KA 1KLNA 5ALKA 5FPDA 5CR4A 3BQ7A 4FE3A 1N48A 3OW2M 3O4NA 4UY8O 9ICOA 4IDHA 5HRNA 5BR8K 5ADXH 4O5EA 3DV9A 1SQKA 1JALA 4JI4K 4JV2A 4WQ5A 1K5OA 3TTCA 3NRZA 3WKDA 3PR5B 3PY8A 2OZMA 2W11A 3CM5A 2P35A 5ALIA 5D46A 1WWVA 3HX0A 2BKEA 3ATVA 1D9DA 1IJJA 4NLZA 4CZEA 4CF8A 4JAXA 1T05A 1J9AA 3LPUA 1CZAN 7ICJA 1DGKN 4EFHA 2YB1A 4CVNE 2W54A 2ZIVA 4XH4A 4GXIA 4H0XB 3AUOA 9ICKA 1TVRA 2QI2A 2O8CB 5J0UA 2ZXIA 1L7MA 4WCEL 2MU2A 3VEVA 1GLDG 3TAQA 4GXJA 2UUCK 4X64K 3F5TA 4RW6A 4CK2A 1XU4A 3OHBA 3HRGA 3VQ8A 1TUYA 2V4QA 4BREA 2P5GA 4BXOA 2OPSA 4OGEA 3O3HA 1U9LA 2I6XA 1K8AO 5G5GA 1YJNN 2PFNA 1LWEA 2YX8A 4NV0A 4FW2A 3QX7A 1VRTA 2A42A 5J0WA 4YR2A 3CQYA 3O3GA 4DU3A 5GINA 2JEFA 2BCQA 5DG8A 2HOIA 3D7EO 4H5RA 3JPSA 1WSHA 3AAPA 1Z25A 4JHDB 5CHGA 4NYNA 3L2UA 1DGSA 1RXVA 1XC9A 4RU9A 3AARA 5HP1A 2E6LA 3VEXA 3MCAB 1VK0A 2HHHK 3LZJA 3O4QA 4BVOA 3KFUF 2KEYA 3VF2A 3S3MA 5TISU 1C0FA 1S3XA 3K5LA 4WQ4A 2P9PA 3MWTA 3AO3A 4QIWF 3AO5A 3T7ZA 4ISGA 5J2JA 1PVQA 5J29A 4JKFA 5KFFA 2K60A 3WQTA 3TU5A 1S72N 4W5RA 2KNJA 1WUAA 3AU2A 4FO6A 1N5XA 4I2BA 4MO5A 3B0XA 4B1YB 3UKUB 2KHQA 4LZDA 3SUPA 3N7SC 1JI7A 4IFYA 1TVAA 2ASDA 2EAOA 2HF4A 1ZD4A 2MUTA 3ETLA 3BS5B 4ECUA 4QZEA 4RUAA 3NBPA 1C7YA 1K1QA 4RNOA 3ALRA 3F5EA 3CETA 5J8YC 1L6NA 2JLEA 4O44A 4ELUA 1D5AA 1B9FA 2W8KA 4KLJA 3PNCA 1KC8O 1SL0A 4R64A 3BQ1A 4LF8K 3NF9A 4A2AA 9ICVA 3NGZA 4UB6U 1IG9A 1NGEA 3LP0A 1V9PA 4Z4HA 4G3IA 1G99A 1QVFM 5CEHA 4FL9A 4RQ1A 2WF8A 2YQEA 4M9NA 4JN4A 4RWTA 2O8FA 5IIIA 4FZMA 3C29A 4K4GA 5HRPA 3ZDCA 3IS9A 3GU3A 4DQSA 1KFSA 4ILJA 1TV6A 4CGIA 1X9WA 2Z7JA 4FWKA 3VPZA 4CZKA 2UYTA 1XNRK 3R9KA 3AVKA 2E88A 1Z6RA 3QB0A 8ICUA 2ZGZA 1Y88A 2HMPA 1T44A 4DTPA 4F50A 2IOCA 2NRWA 1BPBA 4CGDA 3L2VA 3KZIU 3HI0A 2ZJRL 4FO0A 2ZQBA 1CZBA 3CJAA 1NZPA 2QWNA 5KFWA 2DFFA 1TKDA 4QWDA 2A5XA 3QEIA 4I9QA 2ZJPL 2Q1NA 4DWIA 4QNLA 4EHTA 1BU6O 5DQGA 9ICMA 1ZQCA 1DRGA 3N4QA 4W5OA 2QB0A 4CESA 1L8LA 3B8AX 4FOIA 4QZIA 4FJMA 5KQDA 3RB4A 1ZQWA 3TADA 3BQ2A 2FSNA 1CXUA 3LALA 3LP3A 5AK3A 2OH2A 3DXKA 4BRHA 4LFAK 2XC9A 1EP4A 3UKRB 3KTQA 3D2SA 2IHNA 3THXA 3V6DA 3EO3A 5KFMA 1ZBIA 3EUB2 1QQOA 4IFVA 1O08A 2QARB 4F5RA 1VSMA 3VEZA 3TKAA 4JI0K 1RT7A 2A1AA 3HZ6A 2BPGA 2D3DA 3TSPA 2YI1A 4YVZA 4YG2A 4FJHA 2R8HA 3DRPA 1S77D 2QARA 3ALYA 3SUQA 2Q0UA 3SK3A 2NZTA 2YHAA 4CE6A 4B3MK 3CQ8A 2UVWA 5I42A 4GKJK 3KKSA 3M8PA 4GW6A 4F93B 3THWA 4B9NA 4ECZA 4CJWA 1NZBA 5AI8A 4C4RA 2KOBA 5M1FA 4CECA 1NK5A 1Q8IA 3CI5A 3OBYA 3RAQA 5KG4A 2VGMA 1NWKA 9ICCA 1RDBA 3PW7A 3H0MB 1F0MA 3D2EB 4BRPA 4JK7A 3ZX2A 1VQLN 3ENOA 4KX3A 9ICEA 3VA0A 1S1UA 1QH9A 4YOVA 4KH6A 3RFAA 4RQ0A 2KJ5A 3AEVA 5FRMA 1W2BM 1XNQK 3ZD9A 2KIVA 2W9CA 3TI0A 3ZSQA 4WFNL 2P51A 3F2BA 2HBMA 4AHVA 4DB3A 5AKHA 4B9UA 3FGUA 1QVGM 2OEHA 3ULDA 4RQMA 3TAEA 5KFKA 1WLJA 3ZETB 4BY9C 4NL9A 5DMRA 5KAIU 4H4OA 2O8EB 4FWSA 2NYVA 4Y2SA 1IO2A 1VSKA 3QZ8A 3QO9A 3VQAA 3DLEA 1RNHA 1Q9XA 3QEAZ 3DJCA 4Y2UA 4KHWA 4NM2A 4RQ5A 2OPQA 4MLEA 1ZQFA 3M9NB 9ICNA 2I7PA 3Q8PB 5J0YA 4IQVA 5AHXA 3GILA 3U3GA 2LM4A 3QFPA 4CBUA 2G8WA 1QQNA 4JI8K 4JNEA 1Z1VA 2KTQA 4A61A 3KZXA 5CWRA 3ENBA 1YJWN 4EAHD 4GC7A 4CJTA 3WK8A 1YVNA 2G5HB 2BDPA 2YNGA 5KQ8A 4BGAA 1GOCA 4CF2A 4KKOA 2D8CA 4KLQA 2DWQA 2KKZA 4DR1K 3VOVA 4KH4A 2I5HA 3BZKA 2C2RA 4LY7A 1RCHA 4B1WB 5F3XB 3CC7N 1I3AA 3NCIA 7ICRA 2F44A 3KHRA 2ESEA 4F5QA 3HWTA 2NNWA 4FWQA 1YI2N 2HHQA 3GIJA 2GWSA 4C7ZA 2EX3A 2EZYA 5KFZA 3WNHA 1RYRA 2W40A 4YR3A 4DCCA 5JLFA 4RQ3A 4P0PB 3LYSA 3HYFA 4LF4K 3VF6A 2KIWA 1XO1A 2NUBA 5DK5A 2W6LA 1WCLA 4FJ7A 1ZBHA 3ZX3A 3PVXA 3CIPA 2KZ3A 2H3GX 3O80A 4H0YB 1S5LU 4CFDA 3V1OA 1C0TA 5AI5A 1LWCA 2A40A 5TKWA 5BOMA 2UUBK 2K8AA 5DG9A 2YTUA 5DG7A 4YQWA 3TSQA 1LKYB 5AZJB 2D0AA 1HKBA 5EU7A 3LDOA 1VAZA 1S8OA 1WCNA 2FDRA 4GMJB 2PZSA 4F72A 1DK3A 1O03A 3GOIA 1W0HA 4QAGA 3QERA 5JVHL 2N1RA 2PYLA 5CE3A 4CEAA 3QU5A 4RQ8A 1Q3UA 3H3NO 1WNSA 1OVQA 4YMMA 4WYBA 2HBLA 1BNOA 2VJ4A 4BR4A 3E01A 1GOBA 1HMVA 5DB6A 3JYTA 1JLBA 1HYVA 2J6TA 2FI1A 4QZHA 4PL8A 2K4IA 2OYYA 5GIPA 1KKXA 3JPNA 4BR5A 3LDAA 4FWLA 2M0NA 3RTVA 4H5VA 1FKOA 4I2DA 4CDGA 5IIKA 1SV4A 3L0QA 1CI4A 2ZUBA 4LF5K 4FK0A 4PUOA 2HVIA 3K5OA 2PY5A 1U2VB 1Q82O 4KTQA 2H3FA 2Q36A 4DUZK 2E2NA 4LD0A 2QWOA 8ICIA 4J9NA 4EX6A 1BPEA 1HQEA 4UAVA 1JKHA 3KBBA 5AZIB 3CRXA 1TL3A 2YHXA 3NF6A 2OCEA 1RBTA 3LP1A 1OW5A 1X6JA 2BH1A 4CEBA 5KFAA 3ZD8A 4GIBA 3OTOK 2QKBA 2E1FA 4QS9A 2ZJQL 3CNHA 3V9ZA 2AGOA 1KFDA 1AQ6A 4JK1A 3OY9A 3QYPA 5EY4A 4ED0A 5ALJA 4Q0BA 2PFQA 3CHWA 1IBKK 2NRVA 3ISBA 1Q9YA 3WU2U 3ZT3A 3SV4A 4PPXA 3VMFB 3I33A 3NVWA 4X65K 3KWGA 3KHYA 3SNNA 4IJNA 4NL9C 3PIOL 3DLHA 1VQNN 2JEIA 4B9LA 1C1BA 5FDLA 1J97A 3KD3A 4JKGA 4BRNA 4RNNA 4AM7A 3MABA 2IA6A 3MK6A 1JXEA 7ICUA 2QWPA 3P5JA 2E20A 4BRIA 5DDMA 2DL0A 4HWIA 2ALZA 2KZMA 1TYQA 4WJ3B 1NI3A 1WAJA 5C25A 4E7LA 1J2NA 1B0XA 4Y2QA 4B9TA 4C8OA 4NLBA 3VERA 4DSKA 1L3TA 5I9EB 5AKZA 3VQ9A 2FC0A 4CHYA 3OJSA 3SZ2A 1O1WA 1WBBA 2HMIA 3I0RA 3NVKA 3GIMA 4A2BA 3EKUA 4LVSA 1NGCA 5F9NA 3DOKA 4CERA 3AVNA 1RT3A 1LWFA 2OPRA 4QW9A 3NF7A 2NRRA 1L8OA 3L2QA 2OWOA 3IRXA 2LYBA 4UAUA 4PH5A 4ELVA 2EWSA 1BVSA 1DEJA 3F5AA 4ECWA 4OKEA 3NFAA 4CF1A 2R8KA 1KVCA 1RT6A 4DSEA 1ATRA 4FPAA 2WB1F 4ECQA 1NGGA 5E26A 4O8UA 3IN5A 3D2NA 2CXYA 1RDDA 4CF4A 3LANA 3HILA 5J0SA 1B9DA 3Q8SB 3KKAA 3Q8RB 1WBDA 1LAWA 1N60A 5DM7L 1ZQJA 3H7IA 1LW2A 1HR0K 1W9HA 4UARA 3SI8A 3D6RA 4NB4A 2PFPA 3FLCO 1N56A 4PL7A 4ECVA 3UXOA 1ZQMA 2P9UA 1NGJA 1FFVA 4AP9A 3QZ7A 5KG6A 2HI0A 5KL8B 1NK8A 4CD3A 4U67L 2VQEK 5KT4A 2BCUA 3QLHA 5KFOA 1ZQOA 1KXPA 4HUGA 3VQ4A 2NRZA 3MEGA 1PK1A 1QE1A 2PYJA 3A0HU 4FXDA 1S6QA 2DBYA 3WK4A 3C94A 4E19A 3SAHA 2WTFA 2P9IA 1QZ6A 3B9JA 3T3FA 1CLQA 2G0AA 1S1TA 1NK9A 1DOQA 2BDUA 2K8BB 2FMPA 1SAZA 2OANA 1BPYA 3O6WA 2F1JA 4YOTA 4MFAA 4CHZA 3W3DA 2FBVA 2Y0SF 3QETA 1O13A 1VQ7N 4DFDA 2YMQA 2WUSA 3VQ6A 4ZTJA 4BQLA 3CPWM 2W42A 4CI6A 2R8IA 2W3SA 3Q8LA 5KT5A 1QSYA 4F4XA 4B3RK 3JS6A 4JK9A 3WXMB 3H45C 4HAIA 4DFMA 4W5NA 1SL2A 4UB3A 4BGBA 5GTHU 3LDQA 2BGWA 2B6AA 2AGQA 4JHDA 1Z26A 3IG1A 3NVYA 4FJJA 1JCFA 2RKIA 1IG6A 4JI2K 2KMDA 5J2AA 2G8IA 3DOLA 3W0LA 9ICLA 1NGHA 3KLGA 1IH7A 4DU1A 4K4IA 2HHUA 1SZPA 2CN1A 4BQZA 1VQ9N 4O3OA 1SZHA 2BTFA 4EEKA 3ZSYA 4JEPA 4FJIA 4DTNA 4KHPK 9ICIA 1HUXA 8ICHA 1VSIA 4NYFA 3SAGA 4GC6A 4LZGA 3M5RA 5M1KA 2R18A 2W9CB 2DPNA 3LZIA 3M9OB 4B1VA 3KWIA 1K6YA 3J80O 4A5AA 2J6UA 4HUFA 1DK2A 2EH9A 2ZTEA 4MF8A 7ICVA 3OBWA 1RTJA 4EP4A 2QB1A 4IG0A 3OYDA 1FK9A 4YY3K 1GLJO 5J2HA 1WAFA 2MSNA 3LDPA 3DYAA 3H8WA 3WKBA 3H0LB 4A8EA 1NKCA 4FLUA 3UM9A 2PMZF 2GOLA 2EHGA 3O4WA 5AQXA 5EX5A 4IOCL 1KQSM 2UXDK 3VQ5A 4AHUA 4CBWA 1Q81O 2AP1A 2IVPA 1RZTA 1MDUB 4CEOA 1JCEA 2JMGA 4IQUA 2Z1HA 3G6EN 5KFSA 2V7ZA 4KI6A 5L1JA 3SQ0A 1EO1A 2XICA 1S0NA 3CCUN 4M0AA 2O6KA 2KHOA 2AGPA 3OVNA 3MBYA 5AQSA 3WEEA 4AHRA 3G6XA 3F9KA 3ZSXA 1Z19A 4KMOB 4DQRA 1NJYA 1T6CA 3SPZA 2O8BA 4CJEA 4DF4A 1DTQA 5CY4A 1VSEA 3GG4A 3CG7A 3OHRA 3IRUA 4CGZA 4KLLA 3QUBA 4K4HA 3THYA 1ZJMA 2W7PA 4Y0WA 1GO3F 4MO4A 4RW4A 3ID8A 2LSNA 4TQSA 3C2KA 4DLGA 3V9XA 1T4GA 4CGHA 1B4FA 1Z3EB 4HYKA 1KVBA 2E1EA 4FZXC 4ED1A 4N5SA 4KH5A 4J2AA 5KFCA 5BPLA 4BDZA 3R8EA 3PO5A 1BIUA 4QZFA 3MGVA 1ILYA 5KFJA 1RG6A 4B3TK 2O8DA 1P7DA 3HO1A 4I2JA 1VQMN 4NO7A 1YVUA 2JEJA 3CF5L 3H4BA 2FBYA 3PV8A 3MN7A 5ALDA 4BE0A 2D5RA 1X40A 2F1HA 2G07A 1S0MA 1HNIA 1RDUA 4A59A 2MA1A 3L4PA 2ASPA 4OKKA 4BR0A 3RJJA 5KT6A 4DSJA 2KVSA 1NM1A 3CMEN 4KHQA 4CJRA 1EKEA 3AGKA 4R79A 1NGFA 2YHWA 4KN7A 1VLBA 3GDQA 2RHKA 1YITN 2QA4N 2LYAA 1TAUA 1X2IA 4DEZA 4ZHRA 1TGOA 3EL2A 3O3FA 1S0VA 3OTQA 1H38A 4GVMA 2Q31A 5KFEA 1ZQUA 3UIQA 4H0TB 3N4MB 4PQUA 1HQUA 4PWDA 3IG5A 3MCPA 3U4LA 4MHVA 4QWBA 4M3XA 2H3VA 1ZD3A 5KFTA 1NKEA 3F2CA 2QEXN 1WN7A 4V19S 3IM1A 5DM6L 2EDUA 3CPEA 1X1PA 1IM4A 1KVAA 1JLFA 1XHZA 1BPXA 2F76X 2IBKA 4JS5A 1CZ9A 1P8ZA 4EBDA 3KLFA 3NASA 1RBVA 4KB1A 1CUKA 3V81A 5AI0A 4JD2A 4A57A 2AU0A 4PL2A 2R8GA 1FXXA 1U2VA 3C7NA 5AFUH 4FJLA 4DFKA 1VSHA 3QEPA 4M6WA 2CH6A 3ZEUA 5KPTA 2VQFK 2XCPA 3T1AA 1OH8A 4DTJA 3N7PD 4H4MA 4KLMA 1SWVA 1BWFO 4HUEA 1S1WA 2NLXA 5AK5A 4FM1A 2ETJA 4JB3A 4M6WB 3C5GA 5AQLA 3RJGA 3SBTA 4KLUA 4JKAA 5AQNA 2FLPA 5L1MA 4F92B 4I9LA 2Y0SC 2E3TA 3BQTA 8ICOA 1UHUA 1KTQA 2GUPA 4PGYA 3ULEB 5BRHA 5KT2A 3VQ7A 2ZUDA 2YB4A 3NGDA 5AQRA 3THWB 4Z6EA 3NH2A 2XGQA 3DRRA 5FROA 1YZ6A 2FLLA 3A5OC 3UQ2A 1Q7YO 2IOHA 1ASUA 5HRSA 4DSIA 4O3SA 4A5BA 2RRDA 3BEXA 3OSPA 2RDIA 2NRXA 1REVA 1IBLK 1N32K 4FLZA 4QIWC 4O9MA 4JKBA 3G10A 2G8KA 4BACA 2HW3A 5KFQA 2YKMA 3UXPA 4CHQA 1IKYA 3ORYA 3QEVA 3KOOA 3QUQA 3MXJA 1J5EK 3FE1A 2BUPA 3AA3A 1HX1A 2IAJA 1C1AA 3T69A 8ICKA 4F5OA 4FWRA 4IZ9A 3MR2A 3V72A 1KEJA 1ZQHA 1HPMA 1BCOA 3OYLA 1SKWA 4CGFA 3HM9A 4DKWA 2P9UB 5AQVA 2RF2A 3AN1A 5AK4A 4EBEA 1DT9A 4CJLA 3MN6A 4DOBA 4WFBL 1QS4A 3WT0A 3OYEA 2GBZA 3OYIA 5F1XA 4RQ4A 1T3NA 1URJA 7ICIA 3SR6A 5KFBA 1K8KB 1RDAA 4YR0A 4K43A 5E41A 3VTHA 2Z1GA 4M47A 1V4TA 1TAMA 2ZUCA 4UB8U 4DOAA 1J54A 4DTRA 3L3VA 3PW0A 4F2RA 4IO8A 8ICYA 5BRFA 2BPFA 5J2EA 4OJPA 4QZ9A 4X62K 3QIOA 3R6MA 2KQ2A 3V1QA 1HJRA 3HVRA 3F73A 4KPYA 3HKZC 5J2PA 1L3SA 4FJXA 4QCLA 1Z05A 3UQ0A 3TTFA 2F8KA 1JLQA 2ISPA 1SXDA 2VANA 4MF2A 3EZWA 2MAXA 4N76A 3ZT4A 2ATLA 2BZFA 4TUQA 1Q8KA 2E6MA 1NK7A 2JV3A 2F77X 3L5KA 1Q3VA 3MX2A 4PHAA 4F2SA 1NK4A 3GBTA 1BQMA 1NGIA 4Y1CA 3OYNA 5KT7A 2AQ4A 3JPOA 7ICPA 1X66A 3CCQN 3QUTA 2YJFA 3ZCMA 1RBRA 3B0YA 2P9KA 3M9MB 4CEZA 3V9WA 1LV5A 1OKJA 4OX9K 4C4SA 4I2AA 4XQ8A 5AKEA 4Q43A 2F7TA 2Z1IA 5LMNK 4PHPA 1MC8A 2YMLA 4O3NA 5KFIA 3LWLA 3M6GA 3P83D 3QBXA 1LCUA 3M1YA 4M3UA 3VESA 3LDNA 4EIAA 2W6KA 4CE9A 1QSLA 3IUCA 1JMSA 1VSFA 5AKYA 3LL3A 1BPZA 4OCZA 2P9LB 4EYHB 3RR7A 3CD6N 1VQ6N 5D3GA 1NK0A 1L3UA 1WSFA 1ZQPA 3MGHA 3ETRA 9ICAA 4G9BA 4RQ7A 2J6SA 3AVMA 5CRXA 7ICSA 1DLOA 3FC4A 1SS6A 1Z4NA 2ZIXB 3CYMA 4F4KA 1VSJA 5AFUA 2Q4TA 4KLEA 4I2QA 5TZVA 3AVBA 3RBEA 4ED2A 2C2DA 2DFEA 4ECSA 8ICXA 4IS7A 3U9ZA 7ICOA 4KBOA 4KHNA 1G15A 2QB0B 4CK1A 3C21A 1NLVA 3H46O 3LVWA 4O0IA 1KDHA 2BPCA 4CZHA 4DTXA 5J2QA 3V9UA 3AY9A 2P6RA 1ZXIA 5AKIA 5IINA 1BA0A 2I9GA 5KRTA 5AI6A 3THXB 4EZ9A 4U6PA 3RB3A 3MC1A 3ZSZA 5AQGA 1JL2A 4CEEA 2ATQA 4BC3A 3IHQB 1BG3A 3F2KA 5L1LA 3O1WA 4CD1A 5BPCA 5KL1B 4UW9A 4P4MA 3HOSA 3P39A 2IC3A 3G4SN 1LW0A 2VWKA 3FR0A 4QZGA 2YCHA 3P1GA 4IEEA 2ZJ8A 2X74A 4DHYA 3CQXA 3TARA 1NOYA 3C28A 3QDKA 1IXRA 4FLWA 3K1ZA 5A0LA 1TE2A 1NGBA 1QLNA 4P0PA 2GEMA 1JLGA 5ALXA 2Z1JA 1QTMA 3UKUA 3DI6A 4DSFA 3P31A 4CJ4A 1ZQLA 1BISA 5FPEA 3O08A 2RPIA 1RYSA 1ZRNA 1UCVA 1IKVA 1U45A 1ZBFA 4O5FA 1XMQK 1JLEA 1BL3A 1DGJA 1JXBA 3PMNA 3MDQA 3QBWA 2ASJA 4DLEA 4KITB 2AJQA 4BR2A 2BCRA 4CF9A 2YNFA 1UOCA 5ELZA 3WEEB 3H6EA 3O5BA 5DLGA 4B08A 4YXJA 1H1VA 1OVYA 5AZIA 1U48A 1XC3A 4RW8A 3AA5X 3PSFA 3NHGA 3JPTA 1KSPA 1IV8A 1S9GA 5BN9A 5KPZA 5ALUA 1BQNA 3GIIA 4MFBA 3NAEA 4EHUA 4ISFA 4YHHK 2PI5A 3KVGA 4FW1A 4PJ0U 1RTHA 1LOTB 2H3ZA 5LJWA 2W04A 4IBNA 7ICMA 3A8YA 4F5PA 2FLNA 4CJ3A 1A5VA 2ZIUB 3ISNC 4KMUA 4M3ZA 3T19A 4C7YA 2BANA 4CW7B 2RLTA 2O8CA 2HSZA 1XUPO 2ZIWB 3KLEA 3S6JA 1A5XA 3FZKA 2ITMA 2AHOB 5AI9A 3NMUA 3AM9A 5KG7A 2E2QA 1C0MA 3NGYA 5AQOA 4NLKA 2OYQA 2ODGA 3IAYA 2VG6A 1RQLA 2VA8A 1F21A 2XY8A 4HHTA 3AMZA 8ICPA 1T94A 4FJ5A 2FMQA 3I56N 5J2KA 1ESVA 5CHIA 2GELA 1S76D 3ZSVA 2EAMA 3CCEN 4FK2A 2F8LA 1UT8A 4TURA 5KTQA 4M7XA 4IO9L 1T7PA 3RRGA 4I2FA 2BCVA 1SUQA 4YOWA 4J2EA 3V6KA 3PX6A 2WF7A 1A6SA 3BUZB 4JI1K 3C5FA 2WHEA 3G6VA 2GUIA 4WQ4C 4DQ8A 2O8DB 1I39A 3KD5E 4WE1A 4ID1A 4Z4GA 4DUYK 3NUQA 2HNDA 1S5JA 4E7KA 3BZCA 3PSIA 3UE5A 2C28A 3THVA 3OYKA 3RRHA 4Q45A 5J2CA 2VG5A 3FFIA 3HK2A 2JRZA 4HTLA 5IT9O 3SQ1A 5GAGP 5J0RA 2LM1A 2W55A 4BDPA 5IIOA 4KI4A 1IG8A 2Q3SA 1BO5O 2JZBB 2PXIA 2KHVA 5ALVA 1ZQBA 8ICFA 3HM8A 3E0FA 3PR4A 4PHEA 1RT4A 1RT2A 3OS0A 3AV9A 2KK0A 2FXUA 5KFRA 1NK6A 3NTUA 3VTIA 3DXMA 3CW2C 2WC9A 3ZETA 4Q44A 5ALHA 3VCBA 1U6ZA 3MEEA 1JUDA 2Q97A 4PA1A 4GV3A 5FPNA 3QEWA 4Z4FA 4JD2B 2XCAA 1U47A 1TYQB 1TK0A 1SKRA 5F0XA 2OZSA 4L8RB 3CP8A 5IIMA 3MXIA 4GLXA 5LY3A 4Y2VA
chains in the Genus database with same CATH topology
3HT3A 3A0IX 3IFRA 3MR3A 3A5NC 4F5NA 4KLIA 2ZTCA 2HVHA 4UB5A 4DFPA 4F8RA 2D0OA 3SJHA 5LJVA 4BR7A 3TFRA 1NKBA 1E4FT 3OGUA 3SV3A 2I7NA 3RJHA 2FSKA 4GNIA 5AQQA 1ZQEA 4QZBA 3IDHA 1ZQZA 1JIHA 4KN4A 5DQIA 1X3MA 8ICLA 5BN8A 4AF1A 3C65A 3HSCA 4M2YA 4L3QA 2W9BA 1HLUA 3BJYA 3F9MA 4TQRA 2E2OA 2PFUA 1XS9D 3MN5A 4B1ZA 4J9QA 3SBGA 4C1NI 2VA2A 5KFXA 4J9SA 4IXCA 2XO7A 1M90O 2BQUA 2E2PA 4J9RA 5AQFA 3MX5A 5C15A 4XH1A 5DBCA 3ID6A 1VQKN 3RH6A 3J8AA 3P38A 5C2DA 4R8UA 3AGRA 4I2GA 4R65A 2P9NA 3SYZA 1NJXA 3RJIA 4MDBA 4KLSA 4YXMA 4ED7A 1MA9B 3T5LA 4B1XB 1LB2B 4O5CA 3CCSN 4IOXA 3NVMA 1TUUA 1UT5A 5KG1A 2JZBA 8ICBA 3PLAA 9ICSA 1S97A 4GXKA 4FBTA 4CZGA 4GV6A 4XUSA 3Q7CA 1D4XA 5BR9A 5IIJA 5IILA 2W8LA 2W9BB 3CJ1A 4GVEA 1ZQGA 4EBCA 5F2RA 2DFLA 3U9DA 4RPXA 1HKCA 5CB1A 4QWEA 3ZYYX 8ICNA 1NBWA 2HHWA 2JWKA 2M9NA 3RAXA 3RSEB 4DQIA 4Q8FA 1X3NA 1ZQVA 4B9QA 3G25A 3LM2A 3R9PA 2IIRA 3V7JA 4BRDA 4QWCA 1S0OA 4IEIA 9ICGA 5M1PA 4RTFD 4BG9A 1YJ9N 4UAZA 2LYHA 4OPAA 5DKWA 3G6YA 4UQGA 4Z6FA 3HW8A 3AU6A 5CA7A 3TAPA 1R59O 4DL2A 2XY7A 4C1NK 1TFRA 4YDUA 2HSTA 1J6ZA 1D9FA 1VQON 3AAQA 4QS8A 3J7ZO 3CCMN 4MEYA 4CZMA 3GV5B 9ICHA 4MLHA 1ATNA 5HMLA 2R8JA 1ZQDA 4IRDA 2YHYA 1NJIO 2KZZA 5B8HA 5C5JA 4CZJA 3CJBA 1VQ5N 8ICQA 5AQJA 1ZQSA 3D2FB 4M63C 1ZQKA 1XSNA 4IRCA 4ED8A 1YUWA 5KFYA 3CC2N 4BC5A 2P9SB 8ICGA 4JKEA 2CGLA 3QMLA 2B21A 3ENHA 5AQUA 4YCXA 4PKHA 3SAFA 4J8FA 2HHTA 2Y1IA 2J4RA 5F9LA 4ECRA 3PX4A 4F3OA 4JV0A 3BDPA 2QW9A 5J2BA 1M1KO 3C1YA 4DL6A 3FDSA 3EPIA 1HUOA 3ZEUB 4JV1A 4E0DA 2CGKA 3O9UA 3VEYA 4H03B 2P9IB 2W41A 5AQIA 4BGDA 3CJ7A 4ELTA 4J9PA 1QZ5A 2VWBA 3HPOA 1HJPA 2KN7A 1N8RO 4YFKA 1S10A 1TK5A 4DOCA 3TTDA 4QWAA 4IWVA 3RB6A 3KHHA 4C8LA 8ICSA 4KLOA 9ICBA 4ISEA 3OA9A 4PHTX 3K9KA 4BVPA 4CJ7A 2YX6A 4I2CA 3PMLA 2WBNA 3RH5A 3EZ5A 2HF3A 4B9SA 5AQZA 4MEXA 3ZDDA 4ECTA 1GLFO 5DBAA 5H1SQ 1COOA 3VGKA 7ICHA 1ZYQA 2WFBA 1JJ2M 5DGBA 2ZJ5A 1RXWA 5J2IA 4QW8A 2KLAA 3OJUA 2P9LA 3L4IA 3DAWA 3KHLA 3T5JA 9ICJA 5AQYA 5KG2A 5HOOA 1NMDA 2Q2RA 4LC9B 5GAEP 3TFSA 4IR1A 1EQYA 1YF5L 4F91B 5C12A 2FPMA 3M3ZA 1GLBG 4I6MA 3WUHA 4DL4A 2A1JB 5CP2A 4DQQA 2DPJA 3MFHA 1ATSA 3C7NB 5JMVA 4YD2A 2FF6A 5M1OA 1GLAG 3FZHA 2E8AA 2RDJA 1P90A 4NY8A 8ICZA 4QZAA 5CR0A 5HHIA 5DB7A 2AA4A 3OSNA 3EN9A 2KFNA 3FFKB 2D1KA 4O5KA 1ZQYA 3CERA 8ICMA 4RZRA 3SMSA 2W9AA 3ULEA 4DL7A 5J0QA 5D49A 3KZBA 2F9WA 3IKMA 4BXOB 3DWLA 3Q8MA 4AM6A 4IOAL 2DPIA 3LWMA 4FWNA 4BC4A 1ZETA 3O9RA 4K42A 3CCLN 2IHMA 1KAYA 3UPQA 4OO1J 3GQCA 2Y1JA 1ZJNA 3VF4A 3T5HA 2E1YA 5DB9A 3HTVA 8ICWA 3QICA 2UVUA 1RGIA 1PZNA 5KPRA 4FWMA 4IRKA 2A1JA 4FPBA 2V9WA 3WXKA 1ZXOA 4BRAA 2YJEA 5FPMA 9ICRA 3D2EA 3V7KA 4M9LA 4PGXA 3UB5A 3Q8QB 9ICQA 2QWRA 4F4YA 5HHHA 4M9HA 1Z00B 2Q0RA 4O3QA 2QWLA 5DGAA 3GV8B 3MMVA 3L6QA 4OPHA 3EW9A 3M8RA 3A5LC 3Q8KA 7ICEA 4CZLA 4UB4A 3VENA 4KLGA 1KRPA 3CJ9A 4ILGB 1XSLA 1XQSC 5AR0A 5L9XA 4BRCA 3RB0A 5J0XA 4G9ZA 9ICFA 4I6MB 4DO9A 4U7BA 5KFGA 2RE2A 5EWGA 1TAQA 5L1IA 3MDAA 2HHSA 1HJOA 2QWMA 4J9OA 2CH5A 3CMAN 5KFVA 7ICFA 2BCSA 4F9OA 1C0GA 3LM9A 3A5MC 2A41A 4DL5A 1ZQXA 2PAVA 3JPRA 3VGMA 3EPGA 4CZIA 4I2IA 4IJAA 2XGPA 4I28A 4RT3A 4WQ5C 4UBCA 4GV9A 1A76A 5DQHA 4X5VA 1X9MA 8ICAA 3C6HA 1AROP 2FF3B 3C6AA 5AQTA 3V6HA 2F9TA 4J9MA 2MUTB 4YOUA 4BROA 5HMMA 3HOTA 1JXLA 4B9VA 4KLTA 1T6DA 1D8LA 3DXKB 1SZ2A 1K73O 5KFLA 4R8UB 5AQWA 3V7LA 2VYPA 5KFHA 4FS1A 3WQUA 1GLEG 4ECYA 2VCPA 1QQMA 1ZQRA 4JWMA 3SMPA 2BQ3A 4CZFA 3H1QA 2HHVA 5CJ7A 4UBBA 2PBDA 4DFJA 4KLHA 3E9OA 3HBTA 2P9PB 3M8SA 1W97L 3GIKA 1K9MO 4XRHA 2BQRA 4R66A 3ZDAA 2ZGYA 3IMXA 3I8BA 5HL7L 1S22A 4YD1A 4JKCA 5KG0A 1NOMA 4DS4A 5GAHP 4J9KA 3GL1A 1Q18A 2IVNA 2PFOA 4QZ8A 1U4BA 5J2FA 4BRFA 4NLNA 4I27A 1KAXA 2P9SA 1NGDA 3L4QA 4RCHA 5BOLA 4BG8A 1VQ4N 1K1SA 4BRQA 3GDXA 3MR6A 4C8MA 5KFNA 2ASLA 4C8NA 3CCJN 1X9JA 2QM1A 4BWMA 4JKDA 4PHDA 2FSJA 2ZJAA 3E2EA 4F4ZA 1L5UA 5KG5A 2FMSA 5C10A 1CEZA 4EYIB 8ICRA 4BRGA 4I29A 2HHXA 3TANA 3DXMB 1T3VA 4RNMA 3O9SA 7ICQA 4FBUA 2V7YA 3JXUA 3M1FA 2QTDA 5L1KA 5JICA 3BQ0A 4I2EA 5EXWA 3C0BA 3TSUA 3O1BA 3VEOA 5J0PA 4DQPA 4BRLA 5EVZA 1GLCG 4TUSA 3E9LA 5KFPA 5EWEA 3O9QA 5AQHA 4RT2A 1NJWA 2P66A 4YN4A 8ICVA 4EEYA 3RSEA 2P9NB 3ZDBA 1QHAA 4JKGB 4M04A 1B22A 2ISOA 5HP4A 3K9JA 1ZQTA 1YXQA 3H8SA 4RQ2A 1KFTA 3PX0A 4FOEA 1BA1A 5TKYA 2ZF5O 3WXJA 3EWAA 3E1YA 3KK7A 4WFAL 3JPQA 3ISCA 5J2DA 1GLLO 2PI4A 4DL3A 4ED3A 2H5XA 2A6AA 7ICNA 4BC2A 4Z94A 2HBJA 5EOZA 3U8XA 3FZFA 7ICLA 5JVGL 3RJKA 1JN3A 4H5NA 3K75D 1HUZA 3RJFA 3RJEA 4P4OA 9ICUA 3PW5A 2C22A 2AQ0A 4FVUA 3OHAA 1ZQNA 3O8MA 3H40A 3G71N 3RBDA 3JPPA 1ZBSA 4KLFA 5ADXA 3WXLA 3MWPA 4UB1A 4XA5A 4NLGA 3R3LA 2F1IA 4J9LA 4H0PA 4JKHA 2P9KB 4M7YA 4UAWA 1NJZA 2P6UA 1HKGA 1XSPA 3GV7B 3BF3A 3H1VX 1EXNA 3O9TA 5JLHA 2D0PA 4H0VB 5J0TA 2FLOA 3RH4A 3VEWA 4YOXA 4C8KA 5AQMA 1D8YA 2GWJA 7ICGA 2FPLA 3QFUA 3R1XA 5M1NA 5MLCQ 3UKRA 4F4WA 5KFUA 2V51B 3QEBZ 1ZQIA 1TK8A 5AZJA 2JEGA 1JCGA 2HBKA 2GWKA 5HNKA 1MQ3A 3VGLA 3MN9A 3LK9A 4M9JA 4PKIA 5BPNA 1QSSA 1UA1A 1WOQA 1V4SA 3KHGA 3I55N 4DCHA 3T5KA 4BRMA 5BRDA 4O8KA 2UVRA 4MFCA 4P4PA 3H3OB 5GIOA 2E1ZA 4C23A 9ICWA 3C23A 1A77A 5KG3A 1BUPA 2FPKA 4PGQA 4WF9L 5JUMA 1MWKA 1MWMA 1VQ8N 4JK8A 4MDAA 3TPQA 2V4RA 1B43A 1JX4A 5C0YA 4R63A 3RR8A 2QXLA 4P2HA 5J0OA 3ATUA 4ZH4A 4XEIA 3EYZA 4IQTA 3PO4A 4NM1A 9ICPA 1BGXT 3EE9A 1Z00A 4NLCA 3FYHA 8ICCA 4QZDA 2A3ZA 4RPYA 8ICJA 1UA0A 1YAGA 3P4IA 2JWLA 4DSLA 4IFEA 3E66A 4RPZA 4JUZA 4Q8EA 3H8JA 1KAZA 4YMNA 3PW4A 3PIPL 4RQ6A 2UVVA 4YORA 4FS2A 5KFDA 1U49A 2ZWHA 4H0OA 3TQ1A 1T8EA 2VGNA 5KT3A 3CCVN 4O3PA 1SKSA 4B1UB 3HP6A 4O3RA 2D4WA 5AQKA 2ZTDA 4YMOA 4MFFA 4DF8A 4PKGA 1RFQA 5EOYA 3C1ZA 1TV9A 1ZQAA 5GADP 3WXIA 4ECXA 2KFZA 4KLDA 3K4GA 4NXZA 3Q7BA 3BF1A 2NRTA 2IVOA 5D4BA 1Y64A 2GX9A 3S41A 4ED6A 4RUCA 4YDUC 3E9PA 1S9FA 3RVCA 5BPMA 3GFKB 3V6JA 4H5TA 1RPLA 1L3VA 1NGAA 3EE8A 4QS7A 4B9MA 1E4GT 1BDGA 2BHNA 1MSWD 3D2FA 3UXNA 4Z6DA 4M9GA 2ASOA 8ICEA 4K25A 8ICTA 4K41A 1YIJN 3VETA 4FSVA 3FZLA 5DLFA 3PW2A 5DB8A 5BREA 4ILHA 4BRKA 5EWFA 2IMWP 4I2HA 2BR0A 4BWJA 4TUPA 2C2EA 4CBXA 2W9MA 5DBBA 4JWNA 3MDCA 2VA3A 2CGJA 5E84A 3ZDEA 3C2MA 3N4PA 2GTDA 7ICTA 5AQPA 5M1QA 5DDYA 1SL1A 4UB2A 3C2LA 2XY5A 4FWPA 3MR5A 2XY6A 3H4DA 4DS5A 4Z6CA 9ICXA 1BOTO 3DLLL 2OTLN 5J2GA 3CC4N 1YHQN 4H5WA 1ZQQA 4BR9A 3BP8A 1BPDA 2NRHA 3ISDA 3QE9Y 9ICTA 4GY2B 2ASMA 4A62A 4YOYA 3LDLA 3CJCA 1Q86O 1X9SA 4EZ6A 1ZC6A 2OTJN 4IQWA 2V52B 3FZMA 1XWLA 4XH5A 2Q0ZX 3ZX0A 1DKGD 2QWQA 4IR9A 4E1JA 3CXCM 4YP3A 4CCHA 2I1QA 1KD1O 4FWOA 1MQ2A 3SLCA 3MFIA 3EKSA 3GE1A 4UAYA 4QZCA 7ICKA 1RDWX 3MGIA 5C2FA 1VQPN 2HOEA 3CCRN 3N97B 1K8KA 1KLNA 5FPDA 5CR4A 1N48A 3OW2M 4UY8O 9ICOA 4IDHA 5ADXH 4O5EA 1SQKA 4JV2A 4WQ5A 3TTCA 3PR5B 3PY8A 5D46A 3HX0A 2BKEA 3ATVA 1D9DA 1IJJA 4NLZA 4CZEA 4JAXA 1CZAN 7ICJA 1DGKN 4EFHA 4XH4A 4GXIA 4H0XB 3AUOA 9ICKA 2QI2A 5J0UA 4WCEL 3VEVA 1GLDG 3TAQA 4GXJA 3F5TA 1XU4A 3OHBA 3HRGA 1TUYA 2V4QA 4BREA 4BXOA 1K8AO 1U9LA 1YJNN 2PFNA 2A42A 5J0WA 4YR2A 3CQYA 5GINA 2JEFA 2BCQA 5DG8A 3D7EO 4H5RA 3JPSA 3AAPA 4JHDB 5CHGA 1DGSA 1RXVA 1XC9A 4RU9A 3AARA 3VEXA 3MCAB 4BVOA 3VF2A 1C0FA 1S3XA 4WQ4A 2P9PA 3MWTA 3T7ZA 4ISGA 5J2JA 5J29A 4JKFA 5KFFA 3WQTA 3TU5A 1S72N 1WUAA 3AU2A 4FO6A 4I2BA 4MO5A 4B1YB 3B0XA 3CF5L 3UKUB 4LZDA 1TVAA 2ASDA 2HF4A 2MUTA 3ETLA 4ECUA 4QZEA 4RUAA 1C7YA 1K1QA 4RNOA 3CETA 4ELUA 2W8KA 4KLJA 3PNCA 1KC8O 1SL0A 4R64A 3BQ1A 4A2AA 9ICVA 1NGEA 1V9PA 1QVFM 4G3IA 1G99A 4FL9A 4RQ1A 4M9NA 4JN4A 4RWTA 5IIIA 4K4GA 3ZDCA 4DQSA 1KFSA 4ILJA 1X9WA 4FWKA 3VPZA 4CZKA 2UYTA 2E88A 1Z6RA 3QB0A 8ICUA 2ZGZA 1Y88A 2HMPA 1T44A 4F50A 2NRWA 1BPBA 3HI0A 2ZJRL 4FO0A 3CJAA 2QWNA 5KFWA 1TKDA 4QWDA 2A5XA 2ZJPL 2Q1NA 4DWIA 4EHTA 1BU6O 5DQGA 9ICMA 1ZQCA 3N4QA 3B8AX 4FOIA 4QZIA 5KQDA 3RB4A 1ZQWA 3BQ2A 2FSNA 3DXKA 4BRHA 2XC9A 3UKRB 3KTQA 2IHNA 3EO3A 5KFMA 1QQOA 4F5RA 3VEZA 3TSPA 3HZ6A 2BPGA 2YI1A 4YVZA 4YG2A 2R8HA 1S77D 2Q0UA 3SK3A 2NZTA 2UVWA 4F93B 4B9NA 4ECZA 5M1FA 1NK5A 3CI5A 3OBYA 3RAQA 5KG4A 2VGMA 1NWKA 9ICCA 3PW7A 3D2EB 4BRPA 4JK7A 3ZX2A 1VQLN 3ENOA 9ICEA 4YOVA 4KH6A 4RQ0A 1W2BM 3ZD9A 2W9CA 3TI0A 4WFNL 1QVGM 2HBMA 4DB3A 4B9UA 3FGUA 5KFKA 3ZETB 4BY9C 4FWSA 3QZ8A 3QEAZ 3DJCA 4NM2A 4RQ5A 4MLEA 1ZQFA 3M9NB 9ICNA 2I7PA 3Q8PB 5J0YA 4IQVA 3GILA 3QFPA 4CBUA 1QQNA 4JNEA 2KTQA 4A61A 5CWRA 3ENBA 1YJWN 4EAHD 4GC7A 1YVNA 2BDPA 5KQ8A 4BGAA 4KLQA 2KKZA 3VOVA 4KH4A 2C2RA 4B1WB 3CC7N 7ICRA 3KHRA 4F5QA 3HWTA 2NNWA 4FWQA 1YI2N 2HHQA 3GIJA 2GWSA 5KFZA 1RYRA 2W40A 4YR3A 5JLFA 4RQ3A 3VF6A 1XO1A 1WCLA 3ZX3A 3CIPA 3PVXA 2KZ3A 2H3GX 3O80A 4H0YB 2A40A 5TKWA 5BOMA 5DG9A 5DG7A 4YQWA 3TSQA 5AZJB 1HKBA 3LDOA 1VAZA 1WCNA 3GOIA 5JVHL 5CE3A 4RQ8A 3H3NO 4YMMA 4WYBA 2HBLA 4BR4A 5DB6A 2J6TA 4QZHA 4PL8A 5GIPA 3JPNA 4BR5A 3LDAA 4FWLA 3RTVA 4H5VA 4I2DA 5IIKA 3L0QA 2ZUBA 2HVIA 1U2VB 1Q82O 4KTQA 2Q36A 2E2NA 2QWOA 8ICIA 4J9NA 1BPEA 5AZIB 2YHXA 2BH1A 5KFAA 3ZD8A 4QS9A 2ZJQL 1KFDA 2AGOA 4JK1A 5EY4A 4ED0A 2PFQA 3CHWA 2NRVA 3ISBA 3SV4A 4PPXA 3VMFB 3I33A 3KWGA 3KHYA 4IJNA 3PIOL 1VQNN 2JEIA 4B9LA 4JKGA 4BRNA 4RNNA 4AM7A 3MABA 2IA6A 3MK6A 1JXEA 7ICUA 2QWPA 2E20A 4BRIA 5DDMA 4HWIA 2ALZA 2KZMA 1TYQA 4B9TA 4C8OA 4NLBA 3VERA 4DSKA 1L3TA 5I9EB 3OJSA 3SZ2A 3NVKA 3GIMA 4A2BA 3EKUA 4LVSA 1NGCA 5F9NA 4QW9A 2NRRA 2OWOA 4PH5A 4ELVA 2EWSA 1BVSA 1DEJA 4ECWA 2R8KA 4DSEA 1ATRA 4FPAA 4ECQA 1NGGA 5E26A 4O8UA 5J0SA 3Q8SB 3Q8RB 5DM7L 1ZQJA 3H7IA 3D6RA 3SI8A 4NB4A 2PFPA 3FLCO 1N56A 4PL7A 4ECVA 3UXOA 1ZQMA