2NRZA

Crystal structure of the c-terminal half of uvrc bound to its catalytic divalent cation
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrzA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrzA01
4RQ1A 8ICZA 1SL2A 2BKEA 2BCSA 3FYHA 4DEZA 4MFCA 3ZD8A 5KG2A 2XY5A 3RTVA 1XWLA 3SV3A 2HW3A 2NRWA 1TAQA 4ECTA 1LB2B 4IR9A 2UVVA 4O0IA 1ZQUA 5KFGA 1JXEA 3SYZA 3RJKA 1ZQMA 4ED2A 4C8MA 2JEJA 3H7IA 2KTQA 5DG9A 5IIMA 1UT5A 2W9BA 3PO5A 3KTQA 9ICPA 3RAXA 1B43A 2AU0A 1ZQTA 8ICXA 3M9NB 2KFNA 9ICRA 5KFYA 3HWTA 4I27A 3ZDEA 3TFSA 1TKDA 5J0UA 1D8YA 4MF8A 4JV1A 1D9FA 3PW4A 4DL6A 4M9JA 1NOMA 4QWBA 2PFNA 4I2GA 4KLHA 2B21A 3EZ5A 4KLIA 9ICBA 4B9LA 4TURA 3TQ1A 1ZQLA 2P6UA 4RQ5A 2W9CB 3HPOA 3TAQA 3B0XA 4ELTA 1UA1A 5KG3A 4JK1A 4YP3A 8ICJA 4KN4A 3GV7B 4RQ3A 5KFLA 2FPLA 4I2DA 2FPKA 3PR5B 4IRCA 1IXRA 4IRKA 5CP2A 3K75D 8ICWA 4PGYA 1DOQA 5DB9A 4YQWA 3MGIA 3V6KA 4TUSA 8ICIA 3UQ0A 2ATLA 1XS9D 1QSLA 4J9RA 4DQPA 3SI8A 1BPXA 3RB0A 2KZ3A 4G3IA 4RUAA 3GIIA 3C5FA 4YN4A 1KRPA 4RQ8A 4F2SA 5DG7A 2BPCA 7ICIA 3RB4A 4YMNA 4YG2A 3LWMA 1NJWA 3PR4A 4NLZA 4IQTA 4TQRA 1CEZA 1XU4A 3UXNA 1HUZA 4M9LA 5DLGA 4BXOA 1ZQPA 4F5PA 5KFIA 4RQ7A 4RQ0A 7ICJA 1NKCA 1BPYA 1BPBA 4XRHA 2ASLA 1TFRA 5J2IA 4KTQA 1MC8A 7ICMA 1L3TA 1JX4A 3KHGA 4DQRA 1T3NA 8ICSA 9ICVA 5KT3A 4PGXA 3G6YA 5KFCA 2AQ0A 1WCNA 4ECXA 4DSEA 5HP4A 4DOAA 3PVXA 3MABA 3MFIA 4F5QA 1U47A 4P4MA 1JIHA 8ICLA 5BOLA 5IILA 5DGAA 2AQ4A 1Z00A 2R8IA 4Q8EA 5KT6A 2XC9A 3ZDAA 4YXMA 5KG4A 3OJUA 3RRGA 4ED6A 3QEBZ 2RDIA 4DWIA 5D46A 5KG0A 4R65A 4R64A 4DOBA 3V6JA 4YMOA 4DL3A 3FDSA 1IM4A 3MR2A 4BGDA 5D4BA 4KLFA 4DL2A 5J2CA 5BPCA 4KLEA 1ZQSA 1XC9A 3EPGA 2DPIA 2KFZA 4ECRA 2VANA 1A77A 5DDMA 3GDXA 3N4MB 2IHNA 4M47A 1SKWA 8ICEA 2ISPA 1TAUA 9ICGA 2ZUBA 9ICAA 1Z00B 1ZQXA 5HNKA 4RNOA 1SZPA 4MEYA 4PHAA 2BR0A 1T8EA 3JPTA 2VA3A 4KLQA 4KLSA 4KLTA 1COOA 7ICSA 8ICBA 2BQUA 4F4ZA 3GILA 3HT3A 3SZ2A 9ICQA 3H8JA 1ZQJA 7ICNA 1S76D 3GQCA 5EOZA 4F4KA 3PW0A 1NK7A 1NK0A 5J2HA 4ECYA 1XSNA 4RQ2A 1QSYA 4M9GA 3BDPA 2HHVA 2KN7A 9ICLA 1QLNA 3RB3A 4O3OA 1X9SA 2XGQA 4C8NA 4I2HA 4B9SA 2NRVA 4J9LA 2AGOA 4RQ4A 4XA5A 4QZGA 4FO6A 5KFMA 1ZQRA 3G6XA 4DSKA 5HHHA 4O3SA 2KZZA 8ICPA 4FBUA 7ICLA 2XY6A 4KLOA 2Y1JA 1ZQAA 2FMPA 4UB5A 3ORYA 3ISCA 5KFXA 2NRRA 1X2IA 4Z6CA 5J2FA 1ZQNA 1L3UA 2ZUDA 3MR3A 2JEGA 1KEJA 3Q8LA 9ICNA 4DL5A 4I2IA 4J9MA 4F5RA 3NGDA 5BOMA 4YMMA 4R8UB 1U49A 1BPDA 4RPZA 1U4BA 9ICJA 4GLXA 2IMWP 5EWGA 3ZD9A 4FBTA 1XSLA 1DGSA 4Z6FA 8ICVA 1U45A 3TI0A 2H5XA 4B9NA 4MF2A 4KLJA 4GC6A 2IA6A 4F3OA 4QZAA 3RJHA 5DQGA 4BWJA 4QZ8A 4M2YA 1S0VA 3M8RA 3HW8A 3ZDCA 3KHRA 4RUCA 2J6TA 5KT4A 1ZQKA 4Z6EA 9ICUA 4J9SA 3LK9A 1TVAA 4I2EA 5KFEA 9ICKA 5KG6A 1NJYA 1JN3A 2RDJA 4Q45A 3TFRA 4IR1A 4Z6DA 3ZDDA 4O9MA 5DBCA 3Q8PB 1K1SA 5IIIA 4UAYA 4CCHA 3BQTA 5IIJA 2ALZA 5JUMA 1JXLA 2HHWA 4C8LA 4YR0A 4P4PA 3RJFA 5J0SA 2MAXA 5J2KA 1ZYQA 2KZMA 4UBCA 4LZGA 2HVHA 3G6VA 4EBDA 2BPFA 8ICTA 3T5LA 3AU2A 5L9XA 5KFDA 2JZBB 1TK0A 2BCQA 3BQ0A 3QZ7A 3GIJA 4M9HA 1BVSA 2ZJ8A 2HHSA 3MDAA 2BHNA 1K1QA 1ZQBA 4ECUA 1B22A 4YR2A 4RNMA 2F1IA 5J2AA 4PHEA 5J0OA 2W9BB 2BDPA 2AJQA 3IM1A 4YD2A 9ICXA 3GFKB 5KFZA 4O3QA 5J2DA 2V4QA 4GXJA 2FLPA 3RRHA 4I28A 4Q8FA 4M04A 8ICAA 4TQSA 1U9LA 4QZFA 4TUPA 1HUOA 3ETLA 5F9LA 4Q44A 4DO9A 1MQ2A 2FLNA 2A1JA 2ZTDA 3MR5A 4HYKA 1NK4A 4F50A 4R8UA 3BQ1A 3PMLA 3T5KA 9ICTA 5KFVA 2LYHA 2ZTEA 3AUOA 2BCUA 4RPXA 4YVZA 5KFKA 3TAPA 4GC7A 1BPZA 1ZQQA 1NKEA 1ZQGA 3C21A 5J29A 4J9NA 4PH5A 3UXOA 1KFDA 4DL4A 4J9KA 1UA0A 4KLGA 2ASDA 4R63A 2ZJAA 5F9NA 4KN7A 3OGUA 4DSJA 5KFAA 4IQUA 4PHPA 9ICHA 4B9UA 5J0XA 2WTFA 4F4WA 3QE9Y 4XQ8A 3UPQA 1SKRA 3B0YA 4ECZA 2ZTCA 4UBBA 1RPLA 3RJJA 4E0DA 3C5GA 1NK6A 5CJ7A 1X9WA 3K4GA 4EYIB 7ICVA 8ICQA 4UB3A 4RQ6A 3OJSA 2MUTA 3MDCA 4ED1A 1S10A 2ASJA 4KITB 4NM2A 2W9MA 4IRDA 2FLLA 3GIKA 4ED8A 1XSPA 4IQVA 2R8HA 4ED0A 4UAWA 4BWMA 5KFTA 2NRZA 3H8SA 4GXKA 7ICRA 1EXNA 2F1JA 2C2EA 4O5KA 2ZUCA 4X5VA 3ISBA 1ZJMA 7ICHA 3KHLA 2XY7A 5IIOA 5KFWA 2UVUA 3OSNA 4QWAA 2OWOA 2HVIA 3MGHA 1XO1A 2C28A 1T7PA 3PY8A 4K4HA 3C65A 5J0PA 5J0RA 4DQSA 1CUKA 1JMSA 4KLLA 2HHUA 2A1JB 2FMSA 4Q43A 2PFPA 2PFQA 4DFMA 3RH4A 5DLFA 4DQIA 2M9NA 1BPEA 1KTQA 1KLNA 2C22A 2BGWA 3V7LA 2C2RA 3OHBA 3BJYA 3PW2A 4RZRA 3RR8A 4ELUA 3RAQA 1KDHA 5L1JA 4NY8A 1C7YA 2ZJ5A 4QW8A 5CA7A 5KFSA 2FPMA 5KFRA 4RU9A 2P6RA 3OSPA 4RPYA 4KMUA 4O3PA 3JPPA 2JEFA 4P2HA 3C2LA 1D9DA 1TV9A 1ZQDA 2DPJA 1UT8A 5J2EA 4F4XA 4EZ9A 4DF4A 1BGXT 1V9PA 3C1ZA 1U48A 1RZTA 5DBAA 5CHGA 5CWRA 2UVRA 2W8LA 4EBCA 3N97B 8ICUA 3TANA 4K4GA 4DS4A 1L3VA 4DSFA 7ICGA 3RBDA 8ICCA 3JPOA 4F8RA 3RJEA 1ZETA 4JV2A 4YD1A 5KFBA 4KLDA 2HHTA 5DB6A 1NK9A 4PPXA 3Q8RB 1NK5A 1KSPA 4C8OA 4NLGA 3T5HA 3GIMA 1ZQWA 4MEXA 4BDPA 2PFOA 4M9NA 2XO7A 2PXIA 3JPQA 1T4GA 3E2EA 4QZBA 1S9FA 4I2AA 1ZQFA 4UQGA 4DQQA 5KG1A 2BQ3A 1ZQEA 5J0TA 3ZDBA 5KFNA 8ICNA 4DS5A 3IHQB 1ZQIA 2Y1IA 4C8KA 4JWNA 3NTUA 2NRXA 3OHAA 2W9CA 4ED3A 1ZQCA 3RH5A 9ICIA 1D8LA 9ICCA 3AU6A 5CR0A 4IQWA 4XUSA 4MFAA 3H40A 3PW5A 3GV8B 3JPNA 3LWLA 3RBEA 4YFKA 5KFOA 2V4RA 3PO4A 3MBYA 4LVSA 4MFFA 2VA2A 8ICKA 4DF8A 4K4IA 4FS1A 5IINA 4B9MA 5DGBA 3V72A 1L3SA 1ZQZA 4I2FA 1S97A 5KFQA 2Q0ZX 4YR3A 5L1IA 3PW7A 3THVA 2BQRA 1X9MA 1TK5A 1ZQHA 4I2JA 3MFHA 3PX6A 5KT7A 4YCXA 3Q8SB 5KTQA 1MQ3A 2DFLA 4TUQA 2PI5A 2AGPA 3PV8A 1SL0A 5HHIA 9ICOA 4QWCA 3RB6A 4JWMA 4RT3A 4UB2A 4QW9A 1S0NA 3RJIA 2C2DA 7ICFA 3M9MB 4PHDA 3MR6A 5TZVA 4EZ6A 2VA8A 2F1HA 4QZEA 2I1QA 3M9OB 4O5EA 8ICHA 4I29A 4DLGA 3JPSA 4JV0A 3PMNA 4BXOB 2R8GA 4DLEA 5L1KA 4F92B 3PX0A 2IHMA 4M0AA 1KFSA 5DQHA 4F91B 5L1LA 4P4OA 4J9PA 3GV5B 5DG8A 3Q8QB 3H4DA 7ICPA 2R8JA 7ICQA 4B9TA 3Q8MA 1ZJNA 4I2CA 2XCPA 9ICWA 2HHXA 5KG7A 4J9QA 3LDAA 1QTMA 9ICEA 5DKWA 4YXJA 4QZCA 4KLUA 5DBBA 1SL1A 5EWFA 8ICFA 7ICKA 3JPRA 1RYRA 4KLMA 9ICSA 5J2JA 4DSIA 2HHQA 4DFPA 3KHHA 2I9GA 4R66A 5J0QA 4DL7A 5DDYA 4UB1A 2IBKA 4ELVA 4QZIA 1NKBA 5KFJA 1ZQOA 4ZH4A 8ICMA 4DFKA 3C2KA 4O3NA 4F5OA 5KFFA 2BCVA 2XGPA 4NXZA 2J6UA 2P66A 5DB8A 4O3RA 1LV5A 1NK8A 3PNCA 4J9OA 5DB7A 2JEIA 9ICFA 4ECQA 2BPGA 1HJPA 3EYZA 4ECVA 1ZQVA 2R8KA 8ICOA 3T5JA 5KT2A 1ZQYA 3TARA 4UB4A 2V9WA 2MUTB 5HMLA 8ICYA 3UQ2A 2FMQA 2W9AA 4QWEA 3PX4A 4GXIA 1A76A 3UXPA 1NJZA 3T3FA 5J2BA 3QEAZ 4I2BA 9ICMA 4RNNA 1S0OA 1KFTA 4LZDA 4PGQA 2W8KA 3C23A 4QZDA 5KFUA 3HX0A 1RYSA 5KG5A 3V7JA 4QZHA 8ICRA 2UVWA 4EBEA 4UAZA 7ICOA 2XCAA 3EWAA 4ECWA 3H8WA 4EYHB 5J0YA 1L5UA 5KT5A 1N48A 1S77D 3RJGA 4F2RA 4NLKA 5DQIA 3QZ8A 3HP6A 3Q8KA 2PI4A 4O5CA 7ICTA 5HMMA 1PZNA 5J0WA 3M8SA 1SKSA 2BCRA 3EPIA 4M6WA 4B9VA 3V7KA 1RXWA 2ISOA 1WCLA 1NJXA 3SV4A 1QSSA 4M6WB 1Y88A 3C1YA 4RT2A 2NRTA 1N56A 2JZBA 1S0MA 3EW9A 4F4YA 3V6HA 1TK8A 1RXVA 3RH6A 4EEYA 3RR7A 4JUZA 5IIKA 3BQ2A 4ECSA 4QZ9A 4DSLA 1MSWD 7ICEA 3C2MA 1AROP 4FS2A 4NM1A 4QWDA 5CB1A 5D49A 5C5JA 5EWEA 4NLNA 4DOCA 7ICUA 4DFJA 2GWSA 1H38A 5KFHA 4ED7A 5KFPA 3ISDA 2AGQA 4F93B 8ICGA 1Z3EB 2J6SA 3H4BA 4F5NA 5J2GA
chains in the Genus database with same CATH superfamily
3SPZA 8ICZA 3DLRA 2BKEA 1YAGA 1N62A 4MFCA 5KRSA 1SZHA 3RTVA 2EAMA 3H6EA 5E41A 1WYGA 5AHXA 4BR9A 1X66A 2P9NA 3RJKA 1JKHA 3AVFA 1ZQMA 3EY1A 3LM2A 4O0JA 3F53A 2HOIA 3WUHA 3WK6A 4DU4A 1RDWX 1TKXA 3RMDA 1B43A 1E4GT 5AQWA 2AXTU 1BL3A 4FM0A 2KLAA 3HWTA 4MLEA 3NGIA 1FFUA 5J0UA 3VEXA 4MF8A 1BDGA 2FF3B 2P9UB 3P38A 3PW4A 4DL6A 1RNHA 4QWBA 2PFNA 2JH7A 2WF7A 4KLHA 1DGKN 3OYHA 4TURA 2YCHA 3ULEA 3HPOA 1T6DA 5KG3A 4JK1A 1W97L 5IT9O 3GV7B 2GBZA 2X78A 3CCRN 3LP3A 5CZ2A 2QB1A 4CF3A 4CEFA 3K75D 2X74A 4BC5A 3SUNA 5DB9A 4Z4EA 1KVAA 3KD1E 4OKJA 1K73O 4DKWA 3AGKA 3RB0A 3PIOL 3DEEA 4B6JA 3VEZA 4QS8A 4CZHA 4UW9A 2G5IB 2JWKA 4H4OA 5J2PA 2QLTA 7ICIA 2A6AA 3DXKB 4CZJA 1CLQA 3OY9A 3KKAA 3K0SA 4NLZA 4GY2B 4I2PA 4C80A 1VQLN 2ZG6A 3UXNA 4M9LA 3ATVA 4CFAA 3HK2A 4F5PA 1BA1A 4KKOA 1OVYA 3VQ8A 1YZ7A 7ICJA 4X65K 3DOLA 4KAZA 3HYFA 4F72A 4GMJB 4YY3K 1T3NA 9ICVA 1YZ6A 4H0PA 3KLHA 4BRLA 4DSEA 5AQLA 5HOOA 5HP4A 4DV6K 1ZD5A 4DTPA 3DLLL 3MABA 3AO1A 2Y9UA 3AO3A 3NRZA 1JIHA 4MO5A 4Q8EA 2ZE2A 3VGLA 4WQ5A 3AVJA 3HP9A 4DTXA 4B3OA 3GBTA 3PLAA 2RDIA 2Q97A 4OPKA 5D46A 3CW2C 5KG0A 1REVA 4R64A 4DOBA 4GKJK 3BY5A 3LPTA 4FPAA 3OS0A 4CEDA 4Z4GA 2RE2A 3MR2A 3WKEA 3OYKA 1QVGM 1LKYB 4JHDB 4RW7A 5AQRA 2ZM6K 1ZQSA 2PMZC 4FWQA 4OLBA 4KI4A 2OEHA 2ZF5O 5JS2A 1A77A 5ALTA 4JKAA 3GDXA 3N4MB 1KAXA 1SKWA 1IBLK 4FVUA 5M1PA 1XMQK 1KQSM 1Z00B 5HNKA 4CGHA 3F2BA 4MEYA 9ICEA 4CJFA 4H5NA 4CF9A 3LYSA 1WSHA 3O1BA 4FVMA 1COOA 3UKRA 8ICBA 3RWUA 2BQUA 3VQEA 5BREA 2E8MA 1SZ2A 3UMBA 3GILA 1N36K 3HT3A 4WE1A 4U67L 2EAOA 2KHQA 1DTQA 3PW0A 1NK7A 1QSYA 4M9GA 4B1ZA 1RG6A 3BDPA 3MXMA 3OVNA 4X64K 1QQ5A 1NU0A 4JKGA 4I2HA 1RTDA 3SQ0A 2ZGZA 1ATNA 3VQ6A 2NRVA 4J9LA 1OKJA 2E2QA 2ES6A 4GNIA 4EEKA 3HBTA 5KFMA 1ZQRA 3G6XA 4DSKA 2F2AB 3I28A 4IXCA 3CHWA 3MGVA 3VQ7A 2XY6A 4FW1A 4KLOA 1LVHA 2YKNA 2CPRA 4CF2A 1KN5A 3ORYA 2VIXA 5KFXA 2WF5A 3NCIA 2WB1F 3A5LC 4FWSA 2ZUDA 3MR3A 2JEGA 4WJ3B 1C20A 4P0QA 3ZT4A 4CGFA 4I2IA 5FRNA 3NGDA 3M6ZA 1U4BA 3E1YA 3WKDA 5AQPA 4ILHA 3KJVA 3ZD9A 3TAFA 1LCUA 2FSNA 4OPHA 4JRQA 2GOLA 4JS5A 2YMQA 8ICVA 4KHYA 4QIWC 3IRUA 1S3XA 4U7CA 3LP1A 2H5XA 3WK5A 1SAZA 4MF2A 1NM1A 4GC6A 4F3OA 4QZAA 3E0FA 2EZYA 4BWJA 4QZ8A 1S0VA 3M8RA 3R6MA 2KVCA 2JMGA 5M1NA 1QCKA 4CNQA 5AQXA 2NLXA 1B0XA 1Z4OA 3SENA 2D0AA 1FKPA 3ZX3A 1IKWA 4CK3A 4J9SA 4CZFA 3H0MB 4ICLA 9ICKA 2DWQA 5KG6A 2RKIA 2CGJA 3MN5A 3AL0B 3WNHA 1IKXA 1X6JA 5AM4A 4IFYA 5DBCA 3J81O 3H3NO 4OJLA 5ALQA 4CCHA 5DK5A 4CJKA 1JXLA 2PZSA 2HHWA 3U26A 1ZD2P 4CJ4A 3RJFA 1JCEA 2NRHA 3LDPA 3FZMA 5J0SA 4OO1J 4E1NA 1I39A 2WHEA 3SI6A 4MHVA 2KZMA 4UBCA 4JLHA 3B6OA 3NRWA 1HNZK 1EQYA 3VF6A 1L7NA 5KFDA 2JZBB 2YY6A 1TK0A 3BQ0A 3A5NC 3QZ7A 3TR8A 3VETA 3GIJA 1KD1O 3EKUA 4IOAL 3QETA 3RFAA 1TL3A 3DM2A 3SMSA 3MDAA 2QWLA 1ZQBA 4OJRA 5AR0A 3NF9A 3BP8A 4RNMA 2F1IA 5AKGA 2A1AA 2ZIXA 3F73A 3CFRA 5KFZA 3KVGA 1QH9A 2Q0RA 2FI1A 3DLBA 8ICAA 5FP0A 4JK7A 4AQYK 3QUTA 5ALWA 1HMVA 1VQ5N 1U9LA 4TUPA 2QEXN 1HUOA 3ETLA 4DU3A 2ZIUB 2F8TA 2A1JA 2ZTDA 1XNSA 1QS4A 3L4QA 3U9ZA 1QQ7A 3CG7A 1RT3A 5AJ3K 3T5KA 9ICTA 2P9LA 2P5OA 2BCUA 3V1QA 3S3OA 3TAPA 4ISEA 5E79U 4GC7A 1BPZA 1KXPA 2A19A 3R9PA 3OBYA 4J9NA 4PH5A 3F2CA 3FZFA 4ISGA 1KC8O 1IIPA 4J9KA 4Y2JA 1RDDA 1O08A 5AM5A 3OGUA 3O3HA 4PHPA 3AA2A 5J0XA 2WTFA 1L7MA 2JH1A 1SKRA 4ECZA 3IKMA 4UBBA 4OLAA 2QA4N 3RJJA 1VSDA 4WQ4A 3VEYA 5CJ7A 3DLEA 1X9WA 3LVWA 1S10A 3M5RA 3E58A 3U4LA 4KHNA 4BRCA 4LY7A 3SNNA 4NM2A 2W9MA 4RQMA 2V52B 5KPZA 4DR6K 4B3TK 3BEXA 4IQVA 1JLEA 1WB9A 1NGAA 4M41A 1NNLA 2DL0A 5B8HA 5FPDA 3OA9A 3U3GA 5KQDA 1SV5A 1T6CA 2C2EA 1T94A 2EAPA 3ISBA 4DQ8A 2XY7A 4EX6A 1MU2A 2W54A 5KFWA 2HF3A 3KLGA 3SAFA 3OSNA 2PYJA 1Q9XA 1NLVA 1L8OA 2D3DA 2OWOA 2G8FA 1VQKN 5AQFA 4K4HA 4CF4A 4GKKK 1B92A 2ASOA 3KKSA 2FE9A 3CJBA 4CIEA 3DLHA 4DCCA 4CF1A 4WFAL 4Q43A 3VMFB 4AHVA 4DFMA 2P9SA 2D8CA 3R3LA 1VSIA 3QNNA 1KLNA 2C22A 2IIRA 3LZJA 3OHBA 1BOTO 3PW2A 1B4FA 1IG9A 5AZIA 5BRFA 4P0PB 1D8BA 3A0HU 3QU4A 3PUFA 5KFRA 2VGMA 3CF5L 1XHXA 1V4TA 1W9HA 3CJAA 4P2HA 1PK1A 1VSFA 2YB1A 1UT8A 4EZ9A 4RW8A 1RDFA 4BUGA 5A2QO 1V9PA 2ZIVB 2DFHA 1ZBIA 3QIOA 5DBAA 3AVMA 5CHGA 5CWRA 2UVRA 2W8LA 4EBCA 1WOQA 3AMZA 5DMRA 2O8FA 4DS4A 3U6FA 1L3VA 3EO3A 7ICGA 1S9GA 1V97A 4F8RA 2VQFK 4LH4A 4YD1A 3SEIA 5KFBA 3HRDD 2WTUA 2IOHA 2YHXA 2F9TA 1KSPA 2F7TA 4CJVA 1M6YA 3ETRA 4NLGA 2KNJA 1RT4A 5EX5A 3OPXA 3WK8A 3T5HA 1DKGD 3GIMA 2QW9A 5C2DA 2PFOA 3VTIA 2AA4A 3TAGA 3AVKA 4HTLA 1VRUA 2W6LA 4QZBA 1VSHA 3WXJA 2W04A 4UQGA 4DQQA 3IFRA 1JLQA 2KICA 3CQXA 4B1WB 3HM9A 3NDKA 3IDWA 4HCCA 1ZQIA 4C8KA 4G1QA 2W9CA 1ZQCA 3RH5A 2KK0A 3AU6A 4UAVA 4MFAA 4OJ6A 4LF9K 3JPNA 3LWLA 3OS2A 5JVGL 1YIJN 4N76A 4MFFA 1HPZA 2VA2A 2AH5A 4O55A 4K4IA 1UAXA 5TKYA 4WQ5C 1VSKA 4B9MA 3VQ4A 4RW9A 4BRPA 3CMEN 1QVFM 2Q0ZX 3THVA 2V9WA 5L1IA 3UKUA 3MFHA 1F5SA 4LJXA 4A8EA 3Q8SB 4TUQA 4JHDA 4EP4A 2PI5A 1KAYA 2YHBA 4OKEA 5FDLA 3VEOA 1JL1A 4FLYA 3F5TA 4UB2A 4QW9A 3BZCA 4CJSA 3VF4A 1EP4A 3M9MB 2ESEA 4NB4A 1SQKA 4FPBA 4GV9A 4BXOB 5JICA 2V7ZA 3MEDA 3DLKA 4JN4A 3WNFA 2WB1C 3THXB 5ALDA 4AF1A 3KKAC 3UKRB 3OYJA 4KPYA 4P4OA 1X40A 2QKKA 5DG8A 3Q8QB 2FSJA 1G99A 1JRPA 7ICPA 2W3RA 4BRHA 4B9TA 1XI1A 1SIJA 2HHXA 5AKLA 1B9DA 4K41A 3CCSN 5DKWA 3WNGA 4BRDA 5DBBA 5EWFA 3C28A 1RYRA 4KLMA 3N28A 4UB8U 3KBBA 4C7ZA 4H8KA 2QK9A 1H1VA 2QWOA 2HNDA 2KV2A 3HOSA 1BIUA 2G08A 4DFKA 4FWMA 2P66A 3OTOK 3SUPA 4O3RA 1B9FA 3MECA 2JEIA 3E9LA 2LMRA 4HUGA 3EYZA 2OZSA 1ZQVA 2H3QA 8ICOA 3T5JA 3C7NB 4UB4A 2UXDK 1BCMA 4BC3A 1JLFA 3MCAB 3UQ2A 4RW6A 4QWEA 3PX4A 3RSEA 3O3FA 3OYDA 4BG9A 1JL2A 3T3FA 5J2BA 1KFTA 4G9ZA 2FXUA 3HX0A 1TVRA 1FEZA 5KG5A 3V7JA 4QZHA 8ICRA 7ICOA 4DV1K 2G07A 4UAZA 5EU7A 3WXIA 3SD7A 5C42A 4LD0A 3RJGA 4CBUA 3V6DA 4QAGA 3HJEA 4AHCA 2BDUA 1LW0A 5I3UA 1PUZA 3DI6A 3GL1A 3QZ8A 3CM6A 3ZT1A 4CJ5A 2LHTA 4O5CA 3OTQA 5F3XB 7ICTA 3NE6A 2OHFA 1MWMA 1X3MA 5AQIA 4DCHA 1GLLO 4IFVA 1SKSA 3ZSYA 3EPIA 4M6WA 3V7KA 3HTVA 2KKZA 4C1NI 1U04A 4EENA 1Y88A 4GIBA 1NGEA 3BZKA 4IS7A 3AARA 3O9QA 3LPUA 2JZBA 3JS6A 4CD3A 4B1VA 3RR7A 4JUZA 3MMVA 2H3IA 4DSLA 4FYDA 3C2MA 1AROP 4NM1A 3ONNA 1WUAA 1Q3UA 5CB1A 1NGJA 5C5JA 3CC7N 4PY5A 7ICUA 4Z0UA 3HO1A 1J53A 3L3FX 4ED7A 1X9JA 4KH6A 8ICGA 1Z3EB 3OYLA 3O8MA 5ALJA 4CHOA 3KD3A 1ZC6A 3SUQA 2OM6A 3S6JA 4CZLA 1NGFA 3AO5A 2BANA 5KGXA 4CK1A 2PKEA 4A59A 4H5VA 4C4SA 3QU5A 1TAQA 5AM2A 2UVVA 4O0IA 3SJHA 1BCOA 1ZRNA 1ZXIA 2F8SA 2KTQA 3NGZA 1JCGA 1UT5A 3PO5A 9ICPA 4KFBA 4HUEA 2AU0A 8ICXA 1IV0A 2KIWA 2EH9A 2KFNA 9ICRA 3ZDEA 3TFSA 4DTOA 3O9TA 1TKDA 5EVZA 4LF4K 3KLIA 4DV3K 4JV1A 1WBBA 2Y0SC 5M1QA 1D9FA 3KWIA 4DR5K 3AAQA 2B21A 3EZ5A 4OPJA 4KREA 2P9LB 1ZQLA 3ZEUA 4V19S 4RQ5A 2W9CB 1X1PA 1ASWA 5KGWA 4DR7K 1YT3A 4KX5A 1MN8A 4YP3A 4YOWA 4YHHK 1PVQA 4RQ3A 2DGZA 4Y2XA 4PZOA 2FPLA 3PR5B 1ASVA 4JI4K 2R18A 2JWLA 3O08A 3HI0A 4Y2SA 1IG6A 3P39A 1DOQA 4AHRA 3MGIA 4JK8A 8ICIA 4LF6K 4RW4A 4A2AA 5ALIA 1QSLA 4O8KA 3MWPA 4J9RA 1RQNA 2QTDA 4I7FA 2A3ZA 5H1SQ 2FLOA 4J2DA 3DXKA 4YN4A 4BRMA 5DG7A 4CEEA 5G5HA 3B6PA 2OH2A 4MFBA 5EY4A 1GOCA 1Z1BA 5AKXA 1CI4A 1CEZA 4H0OA 3W3DA 5GINA 4RQNA 4Y2TA 1RCHA 3MEEA 2IDOA 4BXOA 3FZHA 3O3GA 3B9JA 4BVPA 5KFIA 4RQ7A 5HRPA 5HR7A 3I8BA 1YTUA 3UE5A 2F77X 1NKCA 1BPYA 3LAMA 2QWRA 3C6HA 1C0TA 5J2IA 2A1SA 1MC8A 1LKYA 1L3TA 1JX4A 4K8XA 1HEKA 1RTJA 8ICSA 4CFDA 4FLZA 4PWDA 3G6YA 4PGXA 4ECXA 5KFCA 3MK6A 4EFHA 4DR3K 2LPEA 4F3TA 3AVAA 3PVXA 5AZIB 1U47A 1NWKA 3HVTA 1EXQA 2LYBA 8ICLA 5HRNA 5BOLA 4FWRA 1Z00A 2XC9A 2GUIA 3CFOA 4N47A 4YXMA 5KG4A 3DDHA 4Y2YA 3QEBZ 2Q31A 4OGCA 2ITMA 5G5GA 1NOZA 3G25A 3FDSA 4EHTA 2WC9A 3VERA 2P9SB 4DL2A 3SQ4A 1CXQA 3QFUA 2O8FB 4N41A 4A62A 2DPIA 3V9UA 5DDMA 2IHNA 4ISFA 2ISPA 1DEJA 5BR9A 1HQUA 3O4QA 9ICAA 3HVRA 3CPWM 3K57A 4HAIA 3CETA 2K4HA 4PHAA 1K5OA 4L8RB 3JPTA 4CHNA 5ALGA 5AM1A 1GLFO 2WFAA 1RT7A 4FE3A 3SZ2A 3MXJA 3H8JA 1ZQJA 3LL3A 5EOZA 5AKKA 1NK0A 2HHVA 1XSNA 4ZTFA 3IG8A 1OUQA 1A6SA 2VG6A 2VJ5A 2ZD1A 3G10A 1XNQK 1NMDA 4KHWA 3CC2N 4O44A 1BO5O 4RQ4A 4BQZA 4JKEA 2EDUA 2W11A 2BZFA 1SV4A 1X6IA 1OH6A 4O3SA 1LAWA 4M7XA 4FBUA 2YMMA 2QM1A 2FDRA 2QI2A 1ZQAA 2YTUA 4UB5A 4LF8K 3TKAA 3U8XA 2NRRA 2ZIWA 5AQTA 4IG3A 1ZQNA 2P9KA 5JRTA 4E19A 3TSPA 4DL5A 3NF7A 3THWB 3S3MA 4PKHA 5BOMA 5EOYA 3BS5B 1U49A 4RPZA 1NMNA 2IMWP 1HYSA 2WF6A 2V7YA 4XH5A 3NHGA 5ALRA 3SPYA 4PL7A 1QQ6A 3T1AA 5HL7L 4Z6FA 1J5EK 2YJEA 3TI0A 2A41A 5C0YA 4BRGA 3THYB 2IA6A 2Z1IA 4FJ7A 3HW8A 3NS1A 3WKBA 4RUCA 4GW6A 3ID6A 3P83D 1TVAA 4I2EA 1NJIO 2F8LA 4Y1DA 5AQKA 4OX9K 3CQ8A 2EQYA 3HPGA 3ENOA 4O9MA 2IGIA 5I9EB 3TTDA 4MDAA 1XHZA 1K1SA 5IIIA 1DLOA 4MQ3A 1S1TA 2UUAK 2ALZA 4BGAA 4W5QA 3V9WA 4C8LA 4O8UA 3I56N 5J1EA 1Q8KA 3SQIA 2MAXA 5J2KA 1MWKA 1ZYQA 2RHKA 4BRNA 3NGYA 5BPMA 1WBDA 4XH1A 2UXCK 3V81A 2HVHA 4LFCK 4LSNA 3G6VA 3BS7A 2BPFA 4A5BA 2G8WA 4NL9A 4BE1A 3GG4A 2H3FA 3QU2A 4NYNA 2XIDA 4DTMA 1RM6C 2BHNA 1K1QA 3TADC 3C7NA 4JKHA 3LDQA 3KOOA 2BDPA 3KLEA 4PHTX 4YD2A 1BWFO 3GFKB 4GXJA 5J2DA 4X66K 4I28A 2QWNA 1SWVA 2WF8A 3RRHA 3DJCA 3QMLA 2KVSA 3I1YA 3GZFA 2BH1A 3HSTB 4FZZA 5F9LA 5AQJA 3TAMA 3RF9A 5AQVA 3A8YA 1S72N 5JS1A 1NK4A 1RT1A 4R8UA 2OCEA 2AP1A 2Q2RA 2LYHA 1A5VA 3FE1A 2DFEA 5KFKA 2RLTA 1NKEA 1SB3C 4DG1A 3M8QA 5CE3A 4UASA 3MAQA 3ZCMA 4B3SK 3L6QA 5KRTA 5LMUK 2ZJAA 4KN7A 2WFBA 9ICHA 3DYAA 4LFBK 1RFQA 3H1VX 3FZKA 3OBWA 4F4WA 3QE9Y 1CZBA 2GV9A 3CCVN 4XQ8A 4M3TA 2ITGA 3N7PD 2Q0UA 3P5JA 4K43A 1J6ZA 3OYFA 3OYMA 2DFFA 4ACOA 1DTTA 5I42A 3EKSA 4FJXA 3ZX2A 3GE1A 4JK9A 1VLBA 4KHUA 8ICQA 1N32K 4ED1A 3KFUF 1V4SA 3IDHA 1HNXK 4FJLA 3ALRA 2ASJA 4JKFA 3HILA 4NL9C 1DK3A 2YQEA 5F0XA 5AKZA 2YV0X 1E4FT 3CCLN 3L3VA 4ED8A 4QCLA 1HYVA 1JI7A 2R8HA 4ED0A 1Q18A 4NLCA 3J7AP 2B4JA 4UAWA 2CGKA 2Q3SA 4CEBA 5KFTA 4Z4CA 2LI6A 4GXKA 2KJ5A 5CHIA 1C1AA 1HR0K 3KIOA 4UB6U 2G8HA 4O5KA 4WCEL 2FBTA 3KHLA 5IIOA 5GIOA 5HLFA 4A2BA 4ZHRA 3FLCO 5HROA 4E7KA 1RDCA 3O0FA 2NO5A 5F1XA 2C28A 1T7PA 3PY8A 4CIFA 1HNWK 1JMSA 2B0CA 5AQQA 2EHGA 2NO4A 1SXDA 2PFQA 4BRQA 4CI6A 3H0RB 5C15A 1BPEA 1VSEA 3QICA 1TYQA 3RR8A 4ELUA 2WF9A 4RZRA 3RAQA 3NMUA 5L1JA 1WSEA 1HRHA 1C7YA 3FR0A 5KFSA 2FPMA 2P6RA 3G6EN 2O8CB 2H3ZA 2PY5A 2EX3A 3LDOA 3OSPA 4KMUA 4O3PA 4CVNE 1T3QA 3C0BA 4Z4FA 4RWTA 1SUQA 5J2EA 4JI5K 3C1ZA 3O6WA 1URJA 4CEQA 1WSIA 4Z4HA 4M63C 5FPMA 3WNEA 3NH1A 3OYIA 3PSIA 2Z1HA 1UQVA 1VQON 4CJTA 3JPOA 2HHHK 5KL8B 3AQEA 1ZETA 4Y1CA 1S1UA 4KLDA 4YOVA 1NK9A 1JCFA 3WXLA 3QIPA 4QS9A 4FLTA 2CH6A 5J8YC 1IV8A 1A5WA 2FBVA 4M7YA 4BR2A 5BRDA 4YOXA 1LOTB 4CD1A 2XO7A 4JD2A 2PXIA 4I2AA 1S9FA 4BY9C 2ODGA 1Z4NA 5KG1A 1ZQEA 5J0TA 5BPLA 4L3QA 4CZGA 3CCUN 2P9IA 5TKWA 1FIQA 2Y1IA 4JWNA 3OHAA 3HPHA 2VYPA 2AHOB 3PSTA 4CHPA 4PL8A 3VQ9A 3WEEB 3WQTA 9ICCA 4KB0A 1GLDG 4XUSA 3H40A 3PW5A 3J7ZO 3D2FA 2F8KA 3L2WA 5KFOA 3CPEA 4DV2K 5CZ1A 3VN5A 4FLWA 1ZQZA 4I2FA 3UKUB 2DF4B 3CCEN 1Q82O 2F3NA 2BQRA 3CJ1A 1ZQHA 4I2JA 2E2NA 3PX6A 1TGOA 5KT7A 3C6TA 1RQLA 4FWKA 1MQ3A 2DFLA 4FJMA 3DMJA 3FGUA 2E1ZA 1JLGA 2AGPA 1CRXA 4JAXA 3RB6A 1YUWA 1BUPA 3EN9A 1S0NA 3RJIA 2C2DA 2RN2A 3ITHA 4JKGB 4PHDA 3MR6A 4FJJA 5TZVA 3C29A 4BRIA 4QZEA 4I29A 4KBOA 3PMNA 1D5AA 4IDHA 2DUYA 4DLEA 3QBWA 2VWJA 1AQ6A 1MDUB 2L5YA 4M3YA 2O8BA 5DQHA 4F91B 5L1LA 5JVHL 4J9PA 3GV5B 3P4IA 3H4DA 2IVOA 3K1ZA 3O9UA 2OYQA 1DK2A 1C6VA 4DFDA 2R8JA 2M0NA 1ZJNA 3MN6A 4EHUA 2GUPA 4BACA 9ICWA 1IBKK 3CERA 1TE2A 3JYTA 5KG7A 2HOEA 2YNIA 3CCMN 2QKQA 3FFKB 4KLUA 4YXJA 1F21A 4Y2RA 2K4IA 1SL1A 3OYCA 3T69A 4OJ5A 2HHQA 3FM9A 2N1RA 4FK4A 3KHHA 4W5RA 3VC8A 1V38A 3HZ6A 4ILGB 2QKBA 2W55A 4UB1A 1N5XA 2EWSA 2WONA 3VESA 3CXCM 4RTFD 2HMIA 2ASPA 4O3NA 4F5OA 4F9OA 4B08A 2J6UA 5DB8A 3EEQA 4BX9C 3SBGA 2K8AA 3ICXA 1VHXA 1EWRA 1ESVA 2IS3A 3VQQA 5KT2A 1ZQYA 3TARA 4E1JA 3RSEB 1YHQN 4ICAA 5HMLA 4IWVA 2FMQA 3QEVA 3I0SA 2HOFA 2D6FC 1NJZA 2YKMA 3QEAZ 1FXXA 4CGDA 3A0IX 4JV5K 1FFVA 4LZDA 5LL6Z 2W8KA 5AKJA 3C23A 1MA7A 4FLUA 3I8DA 3NVWA 4KB1A 4NXNK 2JRZA 1WSFA 4O4GA 2XCAA 1Z19A 1NZBA 4KRFA 4I9QA 3NVZA 4EYHB 5J0YA 2E4LA 2G8KA 4B8AB 3IV6A 4NXMK 4N5SA 2W40A 2G09A 4F2RA 4NLKA 4B1YB 3LP2A 5DQIA 4JI3K 4Z4IA 4IOCL 2ETJA 2K8BB 3Q8KA 2W6KA 2UUBK 3NF6A 5HMMA 3IAYA 5ALKA 5J0WA 4DV5K 4DHYA 3ZT2A 3M8SA 3OS1A 4J2AA 2ZJPL 2ISOA 4HTUA 2HBJA 1NJXA 3SV4A 1QSSA 1PVRA 3L2RA 5KI6A 3C1YA 1N5YA 1N56A 4IO9L 3EW9A 3UMCA 1TK8A 1RXVA 4BE0A 3T19A 1QQNA 3QESA 4CEAA 4H03B 1RDAA 4ECSA 1JLBA 5D49A 1K6YA 3IG1A 4G9BA 1VQ9N 2GWSA 2NNWA 5KFPA 2AGQA 3QNMA 4FXDA 3ZSQA 2HHSA 3BUZB 4F5NA 4RQ1A 4QS7A 1SL2A 5DM6L 1NG9A 3MDQA 4J8FA 2HDOA 4JYAK 5KG2A 1T05A 5ALLA 1XWLA 1C1CA 3LAKA 1L8LA 2HW3A 4EELA 2KD1A 5KNIA 4ECTA 5M1OA 2CGLA 4AP9A 3SYZA 3JAMO 4C8MA 5KPTA 3H7IA 1N61A 2OPRA 1P7DA 5DG9A 5IIMA 1Z25A 1BHLA 3EE9A 4JKCA 4KH4A 4WYBA 3RAXA 1ZQTA 2F4VK 3ZT0A 3M9NB 2VGNA 3R8EA 3AN1A 5AI0A 1T44A 1D8YA 1FO4A 3W0LA 1VK0A 3EUB2 4M9JA 3AQFA 4FSVA 3A2FA 1S5JA 2MRLA 2PFUA 2HB5A 5AZJA 2ZGYA 4NO7A 3FFIA 4KMOB 2P6UA 3TAQA 4ELTA 3CD6N 2D0CA 8ICJA 4KN4A 4DUYK 5EE0A 3D2FB 2FPKA 5AI8A 3D0PA 1W2BM 5EE9A 3IRXA 5CP2A 2BUPA 2E2OA 4OJOA 2E20A 3QEIA 2OPSA 2O4IA 4YQWA 4BE2A 3JXUA 1NGCA 3H0LB 3UQ0A 2ATLA 1XS9D 3BF1A 1JXBA 3R1XA 1S1XA 1I94K 4PQUA 3SI8A 1BPXA 4IL6U 4PA1A 3AAPA 1L7PA 3S9HA 2ZXIA 1S8OA 2D0OA 4LFAK 2MA1A 5B66U 3KZIU 1KRPA 1YVUA 4ZTJA 1WWVA 4YMNA 4YG2A 3LWMA 4TQRA 5D3GA 1XU4A 1HUZA 1O1WA 5LY3A 4PL1A 4FM1A 3TSQA 3CC4N 1ZQPA 3NF8A 3SK3A 4LF5K 3G0ZA 3T1YK 2YNGA 4XRHA 3QERA 1WSJA 1TFRA 2ZIVA 4KTQA 3A5OC 4DQRA 4C4TA 4P0QB 4CESA 5KT3A 3VA0A 1ED1A 3DOKA 3MN9A 1MA9B 3V9XA 3MFIA 4F5QA 4CHYA 3MXIA 1G15A 4JEPA 3CI5A 5IILA 2Z7JA 3PIPL 3TAEA 5CR4A 3ZDAA 3RRGA 5T7BA 4ED6A 3AVCA 4ID1A 3ZSWA 4CGZA 4FW2A 2OPPA 4CJQA 1M90O 1KQQA 1YXQA 4HCBA 3CIPA 2KJ8A 1KVBA 2YX8A 1ECWA 3V6JA 3P1GA 4LC9B 2YB4A 3O5BA 4CJ7A 4JI1K 2RPIA 5D4BA 4KLFA 3D2NA 5KAFU 4KLEA 2FBYA 4KHQA 3DV9A 4ECRA 1QHAA 2OYYA 2VANA 1JUDA 1C0UA 1S22A 3ULDA 1T3VA 3ZSOA 4FLXA 3ZSRA 8ICEA 2UUCK 2OZMA 1TAUA 9ICGA 2XI9A 5T14A 5AQGA 2W3SA 5K14A 4BC2A 1SZPA 5J2MA 2W7OA 1T8EA 2VA3A 3C95A 3SMPA 2GLEA 1O03A 7ICNA 3CM5A 8ICKA 1VRTA 5J2HA 4O5FA 4JS4A 4RQ2A 9ICLA 1N63A 3O9SA 4ILJA 5J2QA 4C8NA 3HOTA 1Y97A 3C94A 2K8CB 1YTAA 3DRRA 3O4NA 3H45C 5HR6A 2AGOA 1A5XA 2FSKA 4XA5A 2P9PA 2XICA 1I3AA 2PAVA 1XO0A 2KZZA 2E5LK 7ICLA 1VAZA 1YJWN 4K0KK 4M3RA 2Y1JA 1Q7YO 2FMPA 3ISCA 3ISNC 4K25A 3F9MA 4BDZA 2ZWHA 2H3GX 4Z6CA 5J2FA 1GO3F 2W41A 4FJGA 1KEJA 3Q8LA 9ICNA 4B9QA 4Z94A 4J9MA 4F5RA 3LDSA 4YMMA 2P9IB 2GWKA 4M3XA 3CCJN 4FBTA 3SLCA 4CE9A 1KCFA 1XSLA 2KIVA 1DGSA 2JHDA 1PVPA 1Q81O 1U45A 4FZXC 3LALA 4IEEA 4B9NA 3O1WA 4KLJA 2HMPA 5AM3A 5DQGA 1RYUA 4OKKA 1JALA 4M2YA 2I6XA 4C4RA 1HNVA 3C6UA 3LANA 1SS6A 1OVQA 5KT4A 1ZQKA 1X42A 4Z6EA 2KKVA 9ICUA 4UAUA 4Y2VA 3LK9A 1DT9A 4IDKA 4HVJA 1KW4A 2GELA 3AA4A 3VGKA 2W42A 1JN3A 2RHFA 5BRHA 3DWLA 4DV0K 4M42A 3TU5A 2YNHA 4BR5A 3KK2A 3BQ7A 4UARA 3Q8PB 3BQTA 2A5XA 5IIJA 5JUMA 1RBVA 1NGGA 3QYPA 3AM9A 4ZOHC 1BIZA 4A57A 4B8CA 1KKXA 4LZGA 8ICTA 1D4XA 3T5LA 2FC0A 3IS9A 1EWQA 4DR4K 1BVSA 5AK5A 3DXMB 2ZJ8A 2WOMA 4IZ9A 2XHBA 4ECUA 1ITGA 4YR2A 2PBDA 5JU5A 4CJ3A 5J0OA 2W9BB 3M1YA 3A5MC 4FFDA 4Q8FA 1CZ9A 1Z1VA 2ZQBA 4AM6A 4CRXA 4N56A 4TQSA 3F2DA 2QWMA 4H0XB 1IH7A 3SBTA 4CF8A 5ADXA 2O6KA 4QZFA 2FLNA 4FCYA 1MQ2A 2JV3A 3MR5A 4QIWF 4HYKA 4CF5A 3BQ1A 3TTFA 1NNEA 2LM1A 5KFVA 1K8KA 2E1YA 2VJ4A 4M3UA 3OYAA 5B5EU 1SV0A 1J2MA 5AM0A 2JLEA 3C21A 3HL8A 5J29A 5AI9A 1KFDA 1J9AA 1UA0A 4KLGA 5AQYA 5FROA 2ASDA 4R63A 1OW5A 5F9NA 4CFBA 4CHQA 4DSJA 4IQUA 5C12A 4CGIA 4BR0A 3IP4B 2P35A 2GH1A 4B9UA 1N6QA 2KOBA 2D4WA 2NYVA 3B0YA 2ZTCA 4H0TB 1RPLA 4ID5A 3FAHA 4E0DA 1N5WA 3DAWA 1NK6A 1Q46A 2H3VA 3F2KA 2KW4A 4EYIB 7ICVA 1HQEA 4UB3A 4RQ6A 3OJSA 3MDCA 3QUQA 3VQ5A 3CMAN 5JMVA 1X3NA 1PK1B 4WF9L 1XC3A 3HXMA 4KX3A 4IRDA 2FLLA 2R7YA 4LH5A 1XSPA 5HRSA 4YFUA 2QXFA 2NV3A 5GAHP 2BE2A 1EXNA 3NUQA 1SGGA 5SWMA 1PK3A 4R79A 7ICHA 3KZBA 1VQMN 1S1VA 4J2BA 4GV3A 1HJRA 3SQ2A 5C25A 5AQUA 4DQSA 1CUKA 4IC9A 1FKOA 3U9DA 2HHUA 1HX1A 2A1JB 4CECA 4CJEA 1FK9A 3ZLJA 1DGJA 2PFPA 3RH4A 2P1JA 5DLFA 4CIGA 1KTQA 2BGWA 1ZRMA 3MX5A 3V7LA 5GAEP 4NYFA 4NY8A 3L0QA 4DMNA 3CYMA 3SUOA 5CA7A 4RU9A 3DRSA 2O8DB 4RPYA 3QEPA 4WFBL 2G8VA 3C2LA 4DTNA 4CBWA 1W0HA 1BQNA 4K8ZA 4M3ZA 4C7YA 5L1MA 1K9MO 4JRPA 3BF3A 1P90A 1RZTA 1U48A 4M3WA 1KVCA 2Z1GA 3EZWA 3FZLA 3KZXA 3M1FA 8ICUA 3F5EA 1BNPA 2K89A 4K4GA 2PYLA 4DSFA 2HI0A 3RBDA 4IBNA 4H5WA 1VQ6N 2BGGA 4NV0A 1A0PA 3OYEA 4CJWA 2HHTA 4OD0A 5DB6A 4PPXA 1QQOA 2I7PA 1NK5A 4AM7A 3VGMA 3MN7A 3VF2A 4B3RK 4C8OA 3ENBA 1QZ5A 4FK2A 1ZQWA 4MEXA 3J81j 4M9NA 3JPQA 1T4GA 3E2EA 3L4PA 5FPEA 1Q86O 2A42A 1ZQFA 3S3NA 4Q0BA 1K8AO 1WAFA 3ZDBA 2KP7A 3E9PA 8ICNA 4DS5A 3IHQB 4PUOA 3WEEA 2E8AA 5ALNA 1F44A 1D8LA 1J2NA 3MCPA 4FM2A 2A3VA 4IQWA 4FZNA 3GV8B 2O8EB 3RBEA 4LVSA 3TACB 3E01A 2V4RA 3WXMB 2HSZA 3OYBA 2IVPA 3NVYA 1IG8A 1M1KO 3J80O 4FS1A 3CQYA 1EETA 4W5OA 1BNOA 5ALOA 5DGBA 4BROA 1L3SA 4YORA 4KTWA 3ZT3A 5ALVA 2UYTA 5LJVA 2W43A 5CEHA 1X9MA 2CRXA 3FC4A 3SAGA 1UHUA 1ZOLA 1ZBUA 4Y0WA 1XNRK 5C2FA 3PV8A 1SL0A 5HHIA 3V1RA 1VJ5A 4RT3A 4W5NA 4H0VB 4J03A 4PKGA 4CGJA 2VA8A 2YMLA 2KQ2A 1FJGK 3JSMA 5AKIA 4CHZA 1NGDA 3KLFA 1VQ4N 3JPSA 1ZBFA 5J8YA 2KE7A 2G5HB 5L1KA 3CFPA 5CYMA 4M0AA 3WU2U 1GLJO 3ZI4A 3T79A 2HNZA 1KLMA 2WUSA 4YNQA 5AI6A 5E84A 3NH2A 7ICQA 4I2CA 2XCPA 1YVNA 5FRMA 3LDAA 1S6PA 1QTMA 4C0ZA 3SMVA 2BTFA 2P9PB 3O4WA 3JPRA 9ICSA 4FZMA 4E7JA 2E5SA 4DSIA 3M3ZA 4USAA 1V85A 4DL7A 5J0QA 2LYAA 2IBKA 5AFUA 1S6QA 1YF5L 4A5AA 5KFJA 1ZQOA 3K5NA 1TL1A 4ZH4A 3CRXA 8ICMA 4QOZB 3QU9A 3ED5A 4NXZA 2XGPA 3VOVA 5F2RA 4GVEA 5ALYA 1YITN 1R0AA 4US8A 3PNCA 9ICFA 1VSJA 4I6MB 4BRFA 2BPGA 3J7YP 5CRXA 3QB0A 3NVVA 4ECVA 5ALHA 1U6ZA 3LZIA 1LW2A 1LWEA 1U2VA 3AGRA 4LSLA 1ZBHA 2O4GA 3NH0A 8ICYA 1P8ZA 4U7BA 4GXIA 1A76A 3UXPA 1Q8IA 1GOBA 4I2BA 9ICMA 2KSOB 4A61A 4CJRA 2OANA 3BGRA 1BISA 3G71N 5KFUA 1RYSA 1NGHA 1BQMA 2UVWA 4EBEA 3EWAA 3H8WA 1GLBG 3ALYA 3V9SA 1S5LU 3RMBA 3Q7BA 2ZIXB 2WBNA 2UU9K 2QXLA 3UB5A 4AILC 2P5GA 1C0GA 4HWIA 4E7LA 2I5HA 4FJ8A 3HP6A 4XH4A 3I76A 3V4IA 4E7HA 3L2QA 4CJUA 1JLCA 1ATRA 3MEGA 3E9OA 3D7EO 2E1FA 3TADA 3R9KA 1WCLA 4FO0A 3KK3A 1E3MA 1KBUA 4FJKA 4RT2A 2NRTA 5AKEA 1S0MA 2KMDA 2B6GA 4O3MA 5IIKA 3M7DA 5ALFA 4QWDA 2D0BA 4DOCA 2O8DA 4IKFA 4DFJA 1WLJA 4DR1K 1H38A 1SWWA 5KFHA 1HYZA 3ISDA 4FWLA 2HSTA 4F93B 4AHTA 2BCRA 2W03A 2J6SA 3WK7A 2GO7A 1LWCA 3V6HA 5J2GA 3F9KA 5KQ8A 4Q5VA 1HKGA 2JGUA 2BCSA 3FYHA 4DEZA 3ZD8A 1Q9YA 2XY5A 3GDQA 2KJ9A 3SV3A 2NRWA 2E6MA 1OH7A 4AHSA 1LB2B 5KL1B 4MDBA 4IR9A 1ZQUA 5KFGA 1S9EA 1JXEA 2GWJA 3H8MA 3ZX0A 3L8BA 4ED2A 2IOFA 2JEJA 3TTCA 2F44A 3VENA 3AA3A 2V51B 1TKZA 2W9BA 3KTQA 4KHSA 3H3OB 1Q3VA 2E1EA 4KHPK 5BN9A 4KO0A 3L2VA 2D0PA 1RBTA 1DRGA 5KFYA 4I27A 3K2PA 5M1FA 1N60A 2RP5A 3K9KA 3UIQA 4KV8A 4GVMA 5MLCQ 4YDUC 1NOMA 4I2GA 2EZZA 2K4EA 3I33A 4EX7A 4FJ9A 4IO8A 1BI4A 4KLIA 9ICBA 4B9LA 2GX9A 3TQ1A 3AEVA 1ATSA 4C23A 2RRDA 5AK3A 3B0XA 1UA1A 2P9NB 1CZAN 3ULEB 2QWPA 4BJQA 3LM9A 4YOYA 4BR7A 5KFLA 4I2DA 5LMNK 4IRCA 1IXRA 4IRKA 2D1KA 8ICWA 4PGYA 5DM7L 3QFPA 3V6KA 3NVKA 4TUSA 3SCXA 2W7PA 2CN1A 4AYBF 2X6NA 2Q36A 1T03A 4DQPA 2P9UA 4NCBA 1N33K 2KZ3A 1L7OA 3CP8A 4G3IA 4RUAA 3GIIA 4P0PA 4OJPA 3C5FA 3AVNA 4H0YB 4M45A 3HJFA 2LM4A 3K58A 2QARB 4RQ8A 5ALMA 2BPCA 4F2SA 1TYQB 2IAJA 3AA5X 1BU6O 3RB4A 3LDLA 4FOEA 3N4PA 1NJWA 3PR4A 4IQTA 4QJFB 5A0LA 5DLGA 1RBUA 3VA3A 2YHWA 1NGBA 3NAEA 2ATQA 4B1XB 1WWUA 4RQ0A 5AFUH 1BPBA 1IJJA 2ASLA 4FWNA 4CZKA 3D2EA 7ICMA 3KHGA 3EL2A 2HCFA 2B6AA 3AY9A 3D6JA 2AQ0A 1WCNA 3N4QA 4DTUA 4CW7B 1IO2A 4DOAA 2Z1JA 3H46O 3KK1A 3ZSZA 4P4MA 2VWKA 3IG5A 5AIAA 4KH5A 2AQ4A 5DGAA 4TSXA 3QUBA 2R8IA 5AQOA 5KT6A 3WK4A 5CYQA 5EE1A 3QU7A 3OJUA 1WNSA 1QE1A 4E89A 3L2UA 4DWIA 4R65A 1NOYA 2ZIWB 3H1QA 3QX7A 4DV4K 4YMOA 2DPNA 3SJJA 1YI2N 4DL3A 1WAJA 1TUUA 1IM4A 4BGDA 5GIPA 4JI8K 3F5AA 2XRIA 5AK6A 1VQ8N 5J2CA 1NBWA 5BPCA 1XC9A 1NI3A 3EPGA 3ZEUB 2KFZA 2OA8A 5GTIU 3QBXA 4IG0A 4JKDA 4M47A 1RGIA 3IUCA 3MX2A 4YDUA 2ZUBA 2KHVA 1ZQXA 4RNOA 3LP0A 3QO9A 1F0MA 3NASA 2BR0A 4KLQA 4KLTA 4KLSA 1GLCG 7ICSA 3T7ZA 4F4ZA 2KEYA 9ICQA 4JKBA 1S76D 3KK7A 3GQCA 4F4KA 3HM8A 9ICOA 1HLUA 3D2SA 4ECYA 1S1WA 5FLXO 3QEXA 2KN7A 4CZMA 1QLNA 3RB3A 4O3OA 1X9SA 4IEIA 2XGQA 5AQHA 2YNFA 4DU1A 3CJ7A 1R59O 4B9SA 2WAQC 1EKEA 1O13A 1RDBA 4YOUA 4DV7K 4QZGA 4FO6A 2YX6A 3SQ1A 2F96A 5HHHA 1TKTA 3NBPA 8ICPA 5CY4A 2HBLA 4MLHA 2IOCA 3AVLA 3TWHA 4CJPA 5FPNA 1X2IA 3GU3A 4Y2PA 4BG8A 2O8BB 3PSPA 1L3UA 4R8UB 3ZSXA 1BPDA 9ICJA 4GLXA 2F76X 2YMPA 3HRGA 4W5TA 2UXBK 4BQLA 5EXWA 5EWGA 3DLGA 4US9A 3KWGA 2KKPA 5HBMA 2O8EA 3O80A 4UY8O 3K5LA 2CH5A 3AVHA 2DKZA 1VQPN 3RJHA 4BR4A 3VPZA 4GFJA 3ZDCA 1VSMA 3VEVA 3KHRA 2J6TA 1J54A 1LWFA 1Z26A 2ZXHA 2DKXA 4PZNA 5AQNA 3L5KA 3QLHA 5KFEA 1NJYA 2RDJA 4NLBA 4OVLA 4Q45A 3TFRA 3S41A 3DXMA 1EO1A 4IR1A 4Z6DA 4CDGA 3ZDDA 3TPQA 4JI0K 3M6KA 4UAYA 4X62K 5ALEA 1TUYA 1ZBSA 1YJNN 4KI6A 2F9WA 1VSLA 1JROA 4BC4A 1HPMA 1OH5A 1OH8A 4YR0A 4P4PA 1C0MA 3NVMA 4MO4A 4XEIA 4OGEA 5IWAK 2E8OA 1ZD4A 2QWQA 1N34K 2A1RA 4EBDA 4R5PA 3AU2A 5L9XA 2BCQA 5E26A 2DBYA 5AKHA 4M9HA 1BI4B 2X6SA 5H2FU 2ZJQL 3LDNA 1WG8A 1XUPO 3P31A 4IFEA 2CXYA 4E1MA 4YOTA 1B22A 5J2AA 3SAHA 4PHEA 2AJQA 3IM1A 9ICXA 3THYA 4O3QA 2V4QA 2FLPA 3N7SC 3VEWA 4FOIA 4E3SA 4M04A 4CEZA 2Q1NA 1QHTA 3K1RB 2P9KB 4Q44A 4DO9A 4BREA 3OYGA 4JI7K 1K8KB 2ZIUA 2YHAA 4F50A 1JLAA 3BS5A 3PMLA 4B3MK 1XQSC 2HBMA 2ZTEA 3AUOA 4BRAA 4RPXA 2HMXA 2QARA 2QB0B 4YVZA 5HRRA 3OYNA 5EE3A 1ZQQA 2Q4TA 2E3TA 2I7NA 3M8PA 2DY4A 1ZQGA 4CE6A 4OPAA 3UXOA 1W7AA 5AK4A 2EANA 5AIBA 4DL4A 2E6LA 2OTJN 1KAZA 3WT0A 5KFAA 2E8PA 5JTIA 2HF4A 3UPQA 4CJLA 1Z6RA 4CK2A 3C5GA 3J8AA 1LAVA 2J4RA 3K4GA 3UMGA 1XMOK 2FBXA 1ZXOA 3QDKA 1KL9A 2MUTA 4LF7K 5K4LA 2B5JA 4KITB 3K5OA 2RF2A 1ZBLA 5HP1A 3MC1A 4OCZA 4U6PA 3OHRA 3GIKA 3RMAA 5ADXH 3CNHA 3K9JA 2YJFA 1BA0A 3MWTA 4BWMA 2NRZA 3H8SA 7ICRA 2F1JA 4F71A 2GTDA 1C0FA 3ZETB 3G4SN 4FJ5A 2ZUCA 5M1KA 4X5VA 1ZJMA 2HBKA 4JB3A 3VQAA 4DUZK 2VWBA 4HHTA 2UVUA 2Y9TA 4HUFA 3RMCA 1RT5A 4B1UB 4QWAA 1HUXA 2HVIA 3MGHA 3V1OA 4CERA 1XO1A 3C65A 3VQBA 4WFNL 3AO2A 3D6RA 4EAHD 5J0PA 4BGBA 2JR5A 4AYBC 5J0RA 2NZTA 2MU2A 4KLLA 4FWOA 4JD2B 2FMSA 1RT6A 3QEWA 4GV6A 1GLAG 3VQDA 4DQIA 2E88A 1YJ9N 2M9NA 4CZEA 1IKVA 2JGAA 2C2RA 3BJYA 4AHUA 4Y2QA 1KDHA 1QQMA 3N7RC 4FJHA 2ZJ5A 3WK9A 4QW8A 2VG7A 4FWPA 3TABA 4PKIA 1IKYA 4RG8A 4DTRA 3U3YA 2K4PA 3JPPA 2JEFA 2K60A 1D9DA 1RBSA 1TV9A 1ZQDA 1QZ6A 4FL9A 2DPJA 4F4XA 3Q7CA 3VQCA 4FJIA 4DF4A 1BGXT 3VTHA 2VQEK 2WAQF 5TISU 2D5RA 2FJ6A 3N97B 1HKBA 1RTHA 5ALXA 4JMUA 5ALPA 2VKQA 3TANA 1WN7A 3AV9A 3HKZC 3EE8A 3QNOA 4NCAA 4CF0A 8ICCA 5KPRA 1J5OA 3RJEA 1RBRA 4JV2A 4EP5A 4NWIA 2GEMA 3KD5E 2E2PA 3Q8RB 1ZD3A 5AI5A 1NZPA 3D2QA 4H4MA 5KAIU 3DRPA 1UPHA 2XY8A 3ID8A 1TV6A 4BDPA 2DTUA 1GOAA 4CGGA 1UWBA 3CJ9A 5BPNA 2G8UA 2BQ3A 4AH9A 2G0AA 4IJNA 5KFNA 3V9ZA 4CZIA 3HSCA 2VG5A 4K42A 3NTUA 2NRXA 4ED3A 9ICIA 2YI1A 1HKCA 2PMZF 5CR0A 3K5MA 1SV0C 3I55N 4BVOA 4YFKA 3VCBA 3PO4A 4FLVA 3MBYA 4O5BA 4DF8A 3A0BU 5GADP 5IINA 3H08A 3V72A 1RDUA 1S97A 5KFQA 1DXSA 4YR3A 3PW7A 2A40A 4JI6K 3CCQN 1TK5A 3D2EB 1TAMA 4YCXA 5KTQA 2NUBA 4JI2K 4I2QA 3WQUA 1SXEA 1HNIA 3D45A 4QWCA 4JWMA 2G8IA 3LVVA 4XIUA 1CXUA 7ICFA 2O8CA 1UCVA 4EZ6A 2F1HA 3M9OB 2I1QA 4PL2A 4O5EA 8ICHA 3O9RA 4E7IA 4DLGA 3HKZF 4JV0A 5AICA 2R8GA 5ALUA 1VQ7N 1X9XA 1RT2A 2HNYA 1FW6A 3PX0A 5GTHU 4F92B 2IHMA 3NFAA 5GAGP 1KFSA 3OW2M 3QXGA 5JLFA 3THXA 1RTIA 3IN5A 3THWA 4JNEA 4IOXA 2XVTA 2OXOA 2P51A 3Q8MA 1Z05A 1J97A 4I6MA 3WKCA 4RCHA 3ATUA 2ZJRL 4FJNA 3E66A 2IC3A 3RVCA 4J9QA 2QB0A 5C24A 3QUCA 4QZCA 3AVIA 8ICFA 5AKYA 7ICKA 4BRKA 5J2JA 1QQCA 3PSFA 4DFPA 2I9GA 1RILA 1HIWA 4C1NK 3KHYA 4R66A 4ELVA 2KSOA 2RQ5A 5DDYA 2KG5A 1NGIA 3L3UA 4QZIA 1NKBA 5SZTA 3QINA 4CBXA 3C2KA 5KFFA 2BCVA 5AQSA 5ALSA 1COKA 2LBOA 1ASUA 1L6NA 1LV5A 1NK8A 3WXKA 4J9OA 5DB7A 4ECQA 3VQPA 4QNLA 1WUDA 1U2VB 1HJPA 3KKRA 3AVBA 2R8KA 2MSNA 3PZPA 4FZYA 4UATA 2MUTB 2LKYA 3K59A 4Y2UA 2W9AA 4NJ8A 1Y64A 1VDVA 3UM9A 2OPQA 1IBMK 3T1HK 3B8AX 2YN4A 4CFCA 4RNNA 5ELZA 1S0OA 3TSUA 1EX4A 4PGQA 2KHOA 1JJ2M 4QZDA 4NCGA 4ECWA 3AVGA 2LSNA 3ZETA 4IJAA 1L5UA 5KT5A 1N48A 5BR8K 3WKAA 3ENHA 1S77D 2FF6A 3I0RA 4FK0A 1UOCA 2I5JA 2HOQA 4J2EA 5C10A 1HJOA 3AO4A 2EZXA 2DQNB 2PI4A 2VCPA 1WSGA 3ZSVA 1C1BA 3ZYYX 1PZNA 1OXJA 5AI4A 4FZLA 2IOFK 1BG3A 1N2XA 2Y0SF 4B9VA 4DTJA 1RXWA 1GLEG 1ZQ1C 3ASMA 4I9LA 4BDYA 1N8RO 4M6WB 4KTZA 4WQ4C 2OTLN 2ASMA 3SR6A 4DB3A 5AZJB 1VQNN 4F4YA 4CEOA 5J2NA 3RH6A 2IVNA 4EEYA 3C6AA 4H5RA 3BQ2A 3GOIA 5AQMA 4QZ9A 4PJ0U 1MSWD 7ICEA 5BN8A 2JXJA 4FS2A 5JLHA 5LJWA 2G06A 4NLNA 3M6GA 5EWEA 2YHYA 4H5TA 5AQZA 4EIAA 4DTSA 1ILYA 3IMXA 4DR2K 2E8NA 3CJCA 3L4IA 5ALZA 3H4BA
chains in the Genus database with same CATH topology
8ICZA 2BKEA 1YAGA 4MFCA 3RTVA 3H6EA 4BR9A 2P9NA 3RJKA 1ZQMA 3LM2A 3WUHA 1RDWX 1B43A 1E4GT 5AQWA 2KLAA 3HWTA 4MLEA 5J0UA 3VEXA 4MF8A 1BDGA 2FF3B 2P9UB 3P38A 3PW4A 4DL6A 4QWBA 2PFNA 4KLHA 1DGKN 4TURA 2YCHA 3ULEA 3HPOA 1T6DA 5KG3A 4JK1A 1W97L 3GV7B 3CCRN 3K75D 4BC5A 5DB9A 1K73O 4DKWA 3AGKA 3RB0A 3PIOL 3VEZA 4QS8A 4CZHA 2JWKA 7ICIA 2A6AA 3DXKB 4CZJA 4NLZA 4GY2B 1VQLN 4M9LA 3UXNA 3ATVA 4F5PA 1BA1A 1OVYA 7ICJA 1T3NA 9ICVA 4H0PA 4BRLA 4DSEA 5AQLA 5HOOA 5HP4A 3DLLL 3MABA 1JIHA 4MO5A 4Q8EA 3VGLA 4WQ5A 3GBTA 3PLAA 2RDIA 2Q97A 5D46A 5KG0A 4R64A 4DOBA 4FPAA 2RE2A 3MR2A 1QVGM 4JHDB 5AQRA 1ZQSA 4FWQA 2ZF5O 1A77A 4JKAA 3GDXA 3N4MB 1KAXA 1SKWA 4FVUA 5M1PA 1KQSM 1Z00B 5HNKA 4MEYA 9ICEA 4H5NA 3O1BA 1COOA 3UKRA 8ICBA 2BQUA 5BREA 1SZ2A 3GILA 3HT3A 4U67L 3PW0A 1NK7A 1QSYA 4M9GA 4B1ZA 3BDPA 4JKGA 4I2HA 2ZGZA 1ATNA 2NRVA 4J9LA 1OKJA 2E2QA 4GNIA 3HBTA 5KFMA 1ZQRA 3G6XA 4DSKA 4IXCA 3CHWA 2XY6A 4KLOA 3ORYA 5KFXA 3A5LC 4FWSA 2ZUDA 3MR3A 2JEGA 4I2IA 3NGDA 1U4BA 3E1YA 5AQPA 4ILHA 3ZD9A 1LCUA 2FSNA 4OPHA 8ICVA 1S3XA 2H5XA 1SAZA 4MF2A 1NM1A 4GC6A 4F3OA 4QZAA 4BWJA 4QZ8A 1S0VA 3M8RA 3R6MA 5M1NA 5AQXA 2NLXA 3ZX3A 4J9SA 4CZFA 9ICKA 5KG6A 2CGJA 3MN5A 5DBCA 3H3NO 4CCHA 1JXLA 2HHWA 3RJFA 1JCEA 2NRHA 3LDPA 3FZMA 5J0SA 4OO1J 2KZMA 4UBCA 1EQYA 3VF6A 1TK0A 5KFDA 2JZBB 3BQ0A 3A5NC 3QZ7A 3VETA 3GIJA 1KD1O 3EKUA 4IOAL 3SMSA 3MDAA 2QWLA 1ZQBA 5AR0A 3BP8A 4RNMA 2F1IA 5KFZA 3KVGA 2Q0RA 8ICAA 4JK7A 1VQ5N 1U9LA 4TUPA 2QEXN 1HUOA 3ETLA 2A1JA 2ZTDA 3L4QA 3U9ZA 3T5KA 9ICTA 2P9LA 2BCUA 3TAPA 4ISEA 4GC7A 1BPZA 1KXPA 3R9PA 3OBYA 4J9NA 4PH5A 3FZFA 4ISGA 1KC8O 4J9KA 3OGUA 4PHPA 5J0XA 2WTFA 1SKRA 4ECZA 3IKMA 4UBBA 2QA4N 3RJJA 4WQ4A 3VEYA 5CJ7A 1X9WA 3M5RA 1S10A 3U4LA 4BRCA 4NM2A 2W9MA 2V52B 5KPZA 3BEXA 4IQVA 1NGAA 5B8HA 5FPDA 3OA9A 5KQDA 1T6CA 2C2EA 3ISBA 4DQ8A 2XY7A 5KFWA 2HF3A 3SAFA 3OSNA 1NLVA 2OWOA 1VQKN 5AQFA 4K4HA 2ASOA 3CJBA 4WFAL 4Q43A 3VMFB 4DFMA 2P9SA 3R3LA 1KLNA 2C22A 2IIRA 3OHBA 1BOTO 3PW2A 5AZIA 5BRFA 5KFRA 2VGMA 3CF5L 1V4TA 3CJAA 4P2HA 4EZ9A 1UT8A 1V9PA 5DBAA 5CHGA 5CWRA 2UVRA 2W8LA 4EBCA 1WOQA 4DS4A 1L3VA 3EO3A 7ICGA 4F8RA 4YD1A 5KFBA 2YHXA 2F9TA 1KSPA 2F7TA 4NLGA 5EX5A 3T5HA 1DKGD 3GIMA 2QW9A 5C2DA 2PFOA 3VTIA 2AA4A 4HTLA 4QZBA 3WXJA 4UQGA 4DQQA 3IFRA 3CQXA 4B1WB 1ZQIA 4C8KA 2W9CA 1ZQCA 3RH5A 3AU6A 4MFAA 3JPNA 3LWLA 1YIJN 5JVGL 4MFFA 2VA2A 4K4IA 5TKYA 4WQ5C 4B9MA 4BRPA 3CMEN 1QVFM 2Q0ZX 3THVA 2V9WA 5L1IA 3UKUA 3MFHA 3Q8SB 4TUQA 4JHDA 2PI5A 1KAYA 3VEOA 3F5TA 4UB2A 4QW9A 3VF4A 3M9MB 4NB4A 1SQKA 4FPBA 4GV9A 4BXOB 5JICA 2V7ZA 4JN4A 4AF1A 3UKRB 4P4OA 5DG8A 3Q8QB 2FSJA 1G99A 7ICPA 4BRHA 4B9TA 2HHXA 4K41A 3CCSN 5DKWA 4BRDA 5DBBA 5EWFA 1RYRA 4KLMA 1H1VA 2QWOA 3HOSA 4DFKA 4FWMA 2P66A 4O3RA 2JEIA 3E9LA 3EYZA 1ZQVA 3C7NB 8ICOA 3T5JA 4UB4A 4BC3A 3MCAB 3UQ2A 4QWEA 3PX4A 3RSEA 4BG9A 3T3FA 5J2BA 1KFTA 4G9ZA 2FXUA 3HX0A 5KG5A 3V7JA 4QZHA 8ICRA 7ICOA 4UAZA 3WXIA 3RJGA 4CBUA 3GL1A 3QZ8A 4O5CA 7ICTA 1MWMA 1X3MA 5AQIA 4DCHA 1GLLO 1SKSA 3EPIA 4M6WA 3V7KA 3HTVA 2KKZA 4C1NI 1Y88A 1NGEA 3O9QA 3AARA 2JZBA 3JS6A 4CD3A 4B1VA 3RR7A 4JUZA 3MMVA 4DSLA 3C2MA 1AROP 4NM1A 1WUAA 5CB1A 1NGJA 5C5JA 3CC7N 7ICUA 4ED7A 1X9JA 4KH6A 8ICGA 1Z3EB 3O8MA 1ZC6A 4CZLA 1NGFA 4A59A 4H5VA 1TAQA 2UVVA 4O0IA 3SJHA 2KTQA 1JCGA 1UT5A 3PO5A 9ICPA 2AU0A 8ICXA 2KFNA 9ICRA 3ZDEA 3TFSA 3O9TA 1TKDA 5EVZA 4JV1A 5M1QA 1D9FA 3KWIA 3AAQA 2B21A 3EZ5A 2P9LB 1ZQLA 3ZEUA 4RQ5A 2W9CB 4YP3A 4YOWA 4RQ3A 2FPLA 3PR5B 2JWLA 3O08A 3HI0A 3P39A 1DOQA 3MGIA 4JK8A 8ICIA 4A2AA 1QSLA 4O8KA 3MWPA 4J9RA 2QTDA 2A3ZA 5H1SQ 2FLOA 3DXKA 4YN4A 4BRMA 5DG7A 5EY4A 4H0OA 1CEZA 3W3DA 5GINA 4BXOA 3FZHA 4BVPA 5KFIA 4RQ7A 3I8BA 3UE5A 1NKCA 1BPYA 2QWRA 3C6HA 5J2IA 1MC8A 1L3TA 1JX4A 8ICSA 3G6YA 4PGXA 4ECXA 5KFCA 3MK6A 4EFHA 3PVXA 5AZIB 1U47A 1NWKA 8ICLA 5BOLA 4FWRA 1Z00A 2XC9A 4YXMA 5KG4A 2Q31A 3QEBZ 2ITMA 3G25A 3FDSA 4EHTA 2WC9A 3VERA 2P9SB 4DL2A 3QFUA 4A62A 2DPIA 5DDMA 2IHNA 4ISFA 2ISPA 1DEJA 5BR9A 9ICAA 3CPWM 3CETA 4PHAA 3JPTA 1GLFO 3SZ2A 3H8JA 1ZQJA 3LL3A 5EOZA 1NK0A 2HHVA 1XSNA 1NMDA 3CC2N 1BO5O 4RQ4A 4BQZA 4JKEA 4O3SA 4M7XA 4FBUA 2QM1A 2QI2A 1ZQAA 4UB5A 3U8XA 2NRRA 5AQTA 1ZQNA 2P9KA 3TSPA 4DL5A 4PKHA 5BOMA 5EOYA 1U49A 4RPZA 2IMWP 4XH5A 2V7YA 4PL7A 5HL7L 4Z6FA 2YJEA 3TI0A 2A41A 5C0YA 4BRGA 2IA6A 3HW8A 4RUCA 3ID6A 1TVAA 4I2EA 1NJIO 5AQKA 3ENOA 4O9MA 5I9EB 3TTDA 4MDAA 1K1SA 5IIIA 2ALZA 4BGAA 4C8LA 4O8UA 3I56N 2MAXA 5J2KA 1MWKA 1ZYQA 2RHKA 4BRNA 5BPMA 4XH1A 2HVHA 3G6VA 2BPFA 4A5BA 3GG4A 2BHNA 1K1QA 3C7NA 4JKHA 3LDQA 2BDPA 4PHTX 4YD2A 1BWFO 3GFKB 5J2DA 4GXJA 4I28A 2QWNA 3QMLA 3RRHA 3DJCA 2BH1A 5F9LA 5AQJA 5AQVA 3A8YA 1S72N 1NK4A 4R8UA 2AP1A 2Q2RA 2LYHA 3FE1A 5KFKA 1NKEA 5CE3A 3L6QA 2ZJAA 4KN7A 2WFBA 9ICHA 1RFQA 3H1VX 3FZKA 3OBWA 4F4WA 3QE9Y 3CCVN 4XQ8A 2Q0UA 4K43A 1J6ZA 3EKSA 3ZX2A 3GE1A 4JK9A 8ICQA 4ED1A 3IDHA 1V4SA 2ASJA 4JKFA 5F0XA 1E4FT 3CCLN 4ED8A 2R8HA 4ED0A 1Q18A 4NLCA 2CGKA 4UAWA 5KFTA 4GXKA 5CHIA 4O5KA 4WCEL 3KHLA 5IIOA 5GIOA 4A2BA 3FLCO 5F1XA 2C28A 1T7PA 3PY8A 1JMSA 5AQQA 2PFQA 4BRQA 4CI6A 5C15A 1BPEA 3QICA 1TYQA 3RR8A 4ELUA 4RZRA 3RAQA 3NMUA 5L1JA 1C7YA 3FR0A 5KFSA 2FPMA 2P6RA 3G6EN 3LDOA 3OSPA 4KMUA 4O3PA 3C0BA 4RWTA 5J2EA 3C1ZA 3O6WA 4M63C 5FPMA 1VQON 3JPOA 1ZETA 4KLDA 4YOVA 1NK9A 1JCFA 3WXLA 4QS9A 2CH6A 4M7YA 4BR2A 5BRDA 4YOXA 1LOTB 4CD1A 2XO7A 4JD2A 2PXIA 4I2AA 1S9FA 4BY9C 5KG1A 1ZQEA 5J0TA 5BPLA 4L3QA 4CZGA 3CCUN 2P9IA 5TKWA 2Y1IA 4JWNA 3OHAA 2VYPA 4PL8A 3WQTA 3WEEB 9ICCA 1GLDG 4XUSA 3H40A 3PW5A 3J7ZO 3D2FA 5KFOA 3CPEA 1ZQZA 4I2FA 3UKUB 3CCEN 1Q82O 2BQRA 3CJ1A 1ZQHA 4I2JA 2E2NA 3PX6A 5KT7A 4FWKA 1MQ3A 2DFLA 3FGUA 2E1ZA 4JAXA 2AGPA 1YUWA 3RB6A 1BUPA 3EN9A 1S0NA 3RJIA 2C2DA 4JKGB 4PHDA 3MR6A 5TZVA 4BRIA 4QZEA 4I29A 4KBOA 3PMNA 4IDHA 4DLEA 3QBWA 1MDUB 5DQHA 4F91B 5L1LA 5JVHL 4J9PA 3GV5B 3P4IA 3H4DA 2IVOA 3O9UA 2R8JA 1ZJNA 3MN6A 4EHUA 2GUPA 9ICWA 3CERA 5KG7A 2HOEA 3CCMN 3FFKB 4KLUA 4YXJA 1SL1A 3T69A 2HHQA 3KHHA 3HZ6A 4ILGB 4UB1A 2EWSA 3VESA 3CXCM 4RTFD 2ASPA 4O3NA 4F5OA 4F9OA 2J6UA 5DB8A 3SBGA 1ESVA 5KT2A 1ZQYA 3TARA 4E1JA 3RSEB 1YHQN 5HMLA 4IWVA 2FMQA 1NJZA 3QEAZ 3A0IX 4LZDA 2W8KA 3C23A 2XCAA 4EYHB 5J0YA 2W40A 4F2RA 4NLKA 4B1YB 5DQIA 4IOCL 3Q8KA 5HMMA 5J0WA 4DHYA 3M8SA 2ZJPL 2ISOA 2HBJA 1NJXA 3SV4A 1QSSA 3C1YA 1N56A 4IO9L 3EW9A 1TK8A 1RXVA 1QQNA 4H03B 4ECSA 5D49A 1VQ9N 2GWSA 2NNWA 5KFPA 2AGQA 2HHSA 3BUZB 4F5NA 4RQ1A 4QS7A 1SL2A 5DM6L 3MDQA 4J8FA 5KG2A 1XWLA 2HW3A 4ECTA 5M1OA 2CGLA 3SYZA 4C8MA 5KPTA 3H7IA 3EE9A 4JKCA 4KH4A 5DG9A 5IIMA 3VPZA 4WYBA 3RAXA 1ZQTA 3M9NB 2VGNA 3R8EA 1T44A 1D8YA 3W0LA 4M9JA 4FSVA 2PFUA 5AZJA 2ZGYA 4NO7A 2P6UA 3TAQA 4ELTA 3CD6N 8ICJA 4KN4A 3D2FB 2FPKA 1W2BM 5CP2A 2BUPA 2E2OA 2E20A 4YQWA 3JXUA 1NGCA 3UQ0A 2ATLA 1XS9D 3BF1A 3R1XA 3SI8A 1BPXA 3AAPA 2D0OA 1KRPA 4YMNA 4YG2A 3LWMA 4TQRA 1XU4A 1HUZA 5LY3A 3TSQA 3CC4N 1ZQPA 3SK3A 4XRHA 1TFRA 4KTQA 3A5OC 4DQRA 5KT3A 3MN9A 1MA9B 3MFIA 4F5QA 4JEPA 3CI5A 5IILA 3PIPL 5CR4A 3ZDAA 3RRGA 4ED6A 1M90O 1YXQA 3CIPA 3V6JA 4LC9B 3O5BA 4CJ7A 5D4BA 4KLFA 4KLEA 1QHAA 4ECRA 2VANA 1S22A 1T3VA 8ICEA 1TAUA 9ICGA 5AQGA 4BC2A 1SZPA 1T8EA 2VA3A 3SMPA 7ICNA 8ICKA 5J2HA 4O5FA 4RQ2A 9ICLA 3O9SA 4ILJA 4C8NA 3HOTA 3H45C 2AGOA 2FSKA 4XA5A 2P9PA 2PAVA 2KZZA 7ICLA 1VAZA 1YJWN 2Y1JA 1Q7YO 2FMPA 3ISCA 4K25A 3F9MA 2ZWHA 2H3GX 4Z6CA 5J2FA 2W41A 1KEJA 3Q8LA 9ICNA 4B9QA 4Z94A 4J9MA 4F5RA 4YMMA 2P9IB 2GWKA 3CCJN 4FBTA 3SLCA 1XSLA 1DGSA 1Q81O 1U45A 4IEEA 4B9NA 3O1WA 4KLJA 2HMPA 5DQGA 4M2YA 1SS6A 5KT4A 1ZQKA 4Z6EA 9ICUA 3LK9A 1DT9A 2GELA 3VGKA 1JN3A 5BRHA 3DWLA 3TU5A 4BR5A 3Q8PB 3BQTA 2A5XA 5IIJA 5JUMA 1NGGA 4A57A 4LZGA 8ICTA 1D4XA 3T5LA 1BVSA 3DXMB 2ZJ8A 4IZ9A 4ECUA 2PBDA 4YR2A 5J0OA 2W9BB 3A5MC 4Q8FA 4AM6A 4TQSA 2QWMA 4H0XB 3SBTA 5ADXA 4QZFA 2FLNA 1MQ2A 3MR5A 4HYKA 3BQ1A 3TTFA 1K8KA 5KFVA 2E1YA 3C21A 5J29A 1KFDA 1UA0A 4KLGA 5AQYA 2ASDA 4R63A 5F9NA 4DSJA 4IQUA 5C12A 4BR0A 4B9UA 2D4WA 3B0YA 2ZTCA 4H0TB 1RPLA 3DAWA 4E0DA 1NK6A 3F2KA 4EYIB 7ICVA 3CMAN 4UB3A 4RQ6A 3OJSA 3MDCA 5JMVA 1X3NA 4WF9L 1XC3A 4IRDA 2FLLA 1XSPA 5GAHP 1EXNA 4R79A 7ICHA 3KZBA 1VQMN 4GV3A 5AQUA 4DQSA 1CUKA 3U9DA 2HHUA 1HX1A 2A1JB 2PFPA 3RH4A 5DLFA 1KTQA 2BGWA 3MX5A 5GAEP 3V7LA 4NY8A 3L0QA 5CA7A 4RU9A 4RPYA 4WFBL 3C2LA 4CBWA 1K9MO 3BF3A 1P90A 1RZTA 1U48A 3EZWA 3FZLA 3M1FA 8ICUA 4K4GA 4DSFA 3RBDA 4H5WA 1VQ6N 2HHTA 1QQOA 5DB6A 4PPXA 2I7PA 1NK5A 4AM7A 3VGMA 3MN7A 3VF2A 4C8OA 3ENBA 1QZ5A 1ZQWA 4MEXA 4M9NA 3JPQA 1T4GA 3E2EA 1Q86O 5FPEA 2A42A 1ZQFA 1K8AO 3ZDBA 3E9PA 8ICNA 4DS5A 3IHQB 3WEEA 2E8AA 1D8LA 3MCPA 4IQWA 3GV8B 3RBEA 4LVSA 2V4RA 3WXMB 2IVPA 1IG8A 1M1KO 4FS1A 3CQYA 4BROA 5DGBA 1L3SA 4YORA 5LJVA 2UYTA 1X9MA 3SAGA 4Y0WA 5C2FA 3PV8A 1SL0A 5HHIA 4RT3A 4H0VB 4PKGA 2VA8A 1NGDA 1VQ4N 3JPSA 5L1KA 4M0AA 1GLJO 2WUSA 5E84A 7ICQA 4I2CA 2XCPA 1YVNA 3LDAA 1QTMA 2BTFA 2P9PB 3O4WA 3JPRA 9ICSA 4DSIA 3M3ZA 5J0QA 4DL7A 2IBKA 5AFUA 1YF5L 4A5AA 5KFJA 1ZQOA 4ZH4A 8ICMA 2XGPA 4NXZA 3VOVA 5F2RA 4GVEA 1YITN 3PNCA 9ICFA 4I6MB 4BRFA 2BPGA 3QB0A 1U6ZA 4ECVA 1U2VA 3AGRA 8ICYA 1P8ZA 4U7BA 4GXIA 1A76A 3UXPA 4I2BA 9ICMA 4A61A 2OANA 3G71N 5KFUA 1RYSA 1NGHA 2UVWA 4EBEA 3EWAA 3H8WA 1GLBG 3Q7BA 2WBNA 2QXLA 3UB5A 1C0GA 4HWIA 3HP6A 4XH4A 1ATRA 3E9OA 3D7EO 1WCLA 4FO0A 4RT2A 2NRTA 1S0MA 5IIKA 4QWDA 4DOCA 4DFJA 1H38A 5KFHA 4FWLA 3ISDA 2HSTA 4F93B 2BCRA 2J6SA 3V6HA 5J2GA 5KQ8A 1HKGA 2BCSA 3FYHA 4DEZA 3ZD8A