2NRZA

Crystal structure of the c-terminal half of uvrc bound to its catalytic divalent cation
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrzA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrzA01
3RR8A 4KLMA 3M9MB 3GV5B 3EWAA 1L3VA 3RRGA 2RDIA 4DS4A 1ZQUA 1S0OA 1JIHA 4F5RA 3OJSA 4KLDA 7ICGA 9ICOA 5KFEA 4YQWA 4C8NA 9ICCA 8ICSA 4KMUA 2RDJA 4QWEA 4DFPA 3EW9A 3SYZA 4ECTA 4LZDA 2BCSA 1QLNA 5KFAA 1S9FA 3KHHA 4QWBA 3TFRA 4IRDA 4Z6FA 5KT4A 1NJYA 1BVSA 7ICQA 1HUOA 5CB1A 4YG2A 1K1QA 9ICIA 4XUSA 4RPXA 2B21A 5EWEA 4DQQA 1X9MA 1ZQRA 1ZQPA 2FLLA 4LZGA 3C1ZA 4DQRA 1SZPA 5J2EA 3MGHA 8ICAA 4B9SA 4O3RA 4RUCA 4YMOA 3TQ1A 2PXIA 3RH5A 4MFCA 2C2RA 3PNCA 9ICFA 1ZQCA 4RQ7A 5KFSA 3HP6A 4KN7A 5HP4A 2HW3A 2NRWA 5D46A 2BQ3A 1BPXA 4QZ9A 4DFKA 4DLGA 1ZQFA 4O0IA 9ICJA 9ICSA 1NK8A 9ICXA 2J6TA 4KLSA 2VA8A 3JPPA 4J9RA 1L3TA 2MAXA 3AU6A 2IMWP 7ICEA 5HMMA 2XGPA 4F4XA 4R66A 3PMNA 5KFRA 1JN3A 5J2FA 4TUSA 4X5VA 1ZQBA 4I2FA 4KLFA 3GFKB 5DDYA 1WCLA 4ELUA 4PHDA 3V7KA 2BPGA 4RQ6A 4J9OA 8ICMA 5KFHA 2ISPA 4DFJA 3RJJA 1UA1A 5J0YA 4DQSA 4QZDA 2F1IA 1ZQNA 4ECUA 3N97B 3MR6A 8ICEA 7ICRA 5D4BA 4J9QA 1L3UA 1XWLA 2VANA 5IIIA 1NJZA 4I2EA 4ECRA 4RPZA 2BGWA 5J0UA 4ECWA 3KHRA 3PW0A 2XO7A 1XSNA 4O5CA 7ICKA 2AGOA 2W9BB 4RQ1A 4FS2A 4BDPA 8ICLA 4NM2A 3OGUA 3BDPA 2ASLA 5KFIA 4I2BA 9ICRA 3G6XA 1SL0A 4M04A 4DSIA 4F4ZA 3C21A 1N56A 4NM1A 9ICBA 5KFXA 3RB6A 3H8SA 5DQGA 3SZ2A 5J2JA 1NK6A 4KLLA 5DGAA 2HHWA 2AJQA 4J9SA 1ZQZA 4QW9A 1U47A 4KITB 4ED2A 9ICQA 8ICJA 1NK5A 4M0AA 1ZQWA 4RQ2A 9ICGA 4RNNA 2NRVA 4I2JA 1IXRA 3EZ5A 4IRKA 5BOLA 3UXNA 4ECZA 4RUAA 4QW8A 3IHQB 5DLFA 2I9GA 4BXOB 3V6KA 8ICKA 4R65A 4UAZA 2OWOA 3PW2A 4ED1A 5IINA 4GXJA 3TARA 2NRZA 3V7LA 4IQTA 1S0MA 2UVWA 7ICIA 8ICQA 1H38A 2Y1JA 9ICUA 4DEZA 2BKEA 4Q43A 3HWTA 4J9LA 2AU0A 3ZDBA 1AROP 4YR3A 3PX0A 4RQ4A 4Q45A 7ICVA 3ISBA 2FMPA 3MR2A 3RAQA 3PW7A 3TI0A 8ICPA 3MBYA 1N48A 4UBCA 4Z6DA 1U49A 2FPLA 3C1YA 5CHGA 1NJWA 7ICJA 9ICMA 5DLGA 3LWLA 3OHAA 2P66A 7ICPA 2BR0A 2P6RA 1TV9A 2C2EA 4C8OA 1Z00A 3RBDA 1XC9A 3PMLA 1ZQMA 5KFNA 3Q8MA 8ICYA 2UVRA 3ZD8A 4PHPA 4R8UB 5HHHA 3GIIA 3BQ1A 4QZGA 4F5OA 3RB3A 3C65A 5J2CA 1ZQDA 2P6UA 4DLEA 3KHGA 3PW5A 2NRXA 2R8JA 5CP2A 4UBBA 4MF8A 4YR0A 1NK7A 3UQ0A 3M9NB 4P4OA 3MDCA 4FO6A 9ICTA 1KFSA 1BPBA 4RQ5A 4M47A 1JMSA 1COOA 5J2HA 4DL6A 1HJPA 2Q0ZX 3RB0A 4B9TA 5KG7A 3HPOA 3OSPA 2C22A 5KG1A 2F1HA 1TAQA 3C23A 4YMNA 2ASDA 4PH5A 5KT3A 2AQ0A 2R8HA 3V7JA 4I2HA 3ISDA 3PW4A 2ZTCA 5J0WA 2BCRA 1B22A 1NJXA 3ISCA 7ICLA 1RZTA 1KLNA 2ZJ5A 1WCNA 4QZFA 3QZ7A 3H8JA 4UB1A 4DL2A 3KHLA 4EBEA 9ICAA 5KFGA 3MDAA 4DO9A 3RAXA 4ECVA 4ED0A 3BJYA 1RYSA 3RJGA 4M9NA 2W9CA 5KFPA 4EEYA 4O5EA 3KTQA 4I2IA 4DOBA 4I28A 4JWNA 5J0QA 8ICIA 3MR3A 5IIMA 4YCXA 5KFJA 1TK0A 5EOZA 1RXWA 4YP3A 5CWRA 4DSJA 5J0RA 3RH6A 1XS9D 3TAPA 3M9OB 2IA6A 9ICNA 5HMLA 5CJ7A 1CUKA 5KG0A 4FS1A 3RJHA 2DFLA 2W9AA 5JUMA 5KTQA 5DBBA 3ZDAA 5KFOA 2BHNA 4P4MA 4RQ3A 5J2IA 1T4GA 4B9MA 5F9NA 4EZ9A 4M9JA 1ZQTA 4ELVA 2W8KA 4M6WB 4F92B 4P2HA 4IQUA 1ZQVA 2H5XA 1U48A 8ICRA 2JZBB 1JXLA 1UA0A 2W9MA 3C5GA 3T3FA 4M9GA 4TQRA 3SV4A 1XO1A 3PO4A 1CEZA 4YD2A 2XCAA 1MQ2A 8ICXA 4KLIA 4M2YA 4Q8FA 3TAQA 3JPQA 4UAYA 3H7IA 1PZNA 4DSFA 4F4WA 4QWAA 1DGSA 3HT3A 1S76D 1KFTA 4BWJA 2DPIA 4QZAA 3EPGA 3M8SA 2M9NA 4F93B 4YXJA 4DL5A 2XCPA 1C7YA 4UB4A 3JPOA 2I1QA 2HHUA 4F4KA 1BPDA 4PGYA 3K4GA 1ZQSA 2JEGA 2R8IA 1ZJMA 3N4MB 2ATLA 5HHIA 1Z00B 2KZ3A 4TQSA 4EBCA 2MUTA 1ZJNA 5KFVA 5DB7A 4RZRA 3JPNA 3JPTA 4DQPA 1S0VA 8ICUA 9ICVA 1V9PA 4O3NA 1T8EA 1TFRA 2KFZA 5EWFA 1ZQAA 4NXZA 3BQ2A 3RH4A 1KSPA 1U45A 3B0XA 3C5FA 5L1IA 2AQ4A 4IQVA 5CA7A 2J6UA 4O3PA 3SI8A 3UXOA 2IHNA 9ICPA 2XC9A 9ICLA 2UVVA 5J2DA 2ZJ8A 1BPZA 3JPRA 1ZYQA 4NLGA 2BQRA 4PGXA 4YXMA 3MGIA 4KTQA 7ICTA 4F2SA 1QSYA 4YVZA 4HYKA 3H8WA 3T5HA 1D9FA 1QSLA 2V9WA 7ICHA 3RTVA 2XY6A 2Y1IA 4I2CA 5KG5A 5J29A 4RQ8A 4O5KA 4Q8EA 5TZVA 2HHTA 4LVSA 2J6SA 2IHMA 4R64A 3QEBZ 2KFNA 4TURA 4EZ6A 5J2AA 1QSSA 4JWMA 4YD1A 1KTQA 3RJIA 3Q8QB 1UT8A 1A77A 2NRTA 5F9LA 1D8LA 4UB2A 1NK4A 3ETLA 1B43A 4FBTA 3GQCA 4IR9A 5IIOA 2BDPA 1JXEA 3EYZA 3ZDDA 1ZQXA 3C2KA 2BQUA 1SKRA 1KDHA 4KLGA 8ICZA 4MFAA 3QZ8A 4F4YA 4KLHA 1ZQKA 5KFWA 4PPXA 4YR2A 3H4DA 2PFPA 5BOMA 3Q8LA 1X9SA 1ZQQA 2IBKA 5DGBA 4F5NA 1BPEA 1Z3EB 1S97A 4PHEA 1ZQHA 4DL7A 4K4IA 4ECYA 2ALZA 4MEXA 1TVAA 5DDMA 3RRHA 3PR4A 5C5JA 1ZQYA 4P4PA 1U9LA 2WTFA 3IM1A 4ECSA 1TKDA 1JX4A 4F8RA 1A76A 2AGQA 3QE9Y 2PI4A 1L5UA 4GC6A 7ICFA 4I27A 4DL3A 2BPCA 5KFYA 3PY8A 3FYHA 1NOMA 2AGPA 2KN7A 2HVHA 3HW8A 4QZIA 3RJEA 4F50A 4J9MA 1MQ3A 5KG3A 2XY5A 1T3NA 5BPCA 5D49A 5KFDA 1SL2A 1QTMA 7ICNA 3B0YA 3Q8PB 5KFKA 4RPYA 2XY7A 3PV8A 1UT5A 4RQ0A 5L1LA 4C8KA 4DQIA 5CR0A 3RB4A 2C2DA 4DFMA 2A1JA 1RXVA 4ECXA 8ICNA 4J9KA 3RJKA 8ICCA 3BQTA 5KFLA 1NKEA 3FDSA 1ZQGA 1D9DA 4PHAA 4GC7A 1NK9A 4BGDA 4GLXA 1T7PA 2PFOA 5IIJA 2ZUBA 5IIKA 4QZCA 4BXOA 5L9XA 5DQHA 2PI5A 5L1KA 4K4GA 5KT5A 4TUQA 1MSWD 2HHSA 2FPMA 2HVIA 3G6YA 4Z6EA 9ICWA 5L1JA 4I29A 3V72A 1IM4A 4ED7A 7ICUA 3PO5A 4QWCA 1LV5A 3UXPA 5KFTA 5J0TA 5KFUA 3ZD9A 3MR5A 5DB6A 4EBDA 2BCUA 4UAWA 3GILA 4XRHA 3GIMA 3THVA 2GWSA 2VA2A 3V6JA 3PX4A 2R8KA 4K4HA 2HHXA 4JK1A 4JV2A 4ZH4A 3LDAA 1ZETA 1RYRA 3OHBA 1BPYA 4QZBA 5J0XA 4ED6A 2HHQA 3LK9A 2KZZA 1HUZA 3G6VA 1ZQIA 4I2DA 4F5PA 2JEIA 8ICTA 1D8YA 4I2AA 3T5KA 3UPQA 3T5LA 2DPJA 4R8UA 2KZMA 4B9NA 2V4QA 4YMMA 4O3QA 3BQ0A 2FMQA 2W8LA 5J0OA 1LB2B 3MFIA 4NLZA 5KFBA 3GV7B 4QZ8A 4KLEA 2NRRA 4E0DA 4NLNA 3H40A 4Z6CA 3JPSA 5KFCA 1K1SA 4KN4A 4ED8A 4MEYA 1DOQA 4KLTA 1EXNA 1SL1A 4G3IA 2JEFA 2JEJA 5KFZA 1TK8A 5KFFA 2R8GA 1NKCA 7ICOA 4R63A 4IR1A 5HNKA 3TANA 3Q8RB 3GV8B 3C2LA 3HX0A 5J2KA 4F2RA 5KFMA 4MF2A 2ZTDA 2V4RA 8ICHA 3GIJA 4JUZA 1S0NA 4DOAA 5EWGA 3PX6A 5DB8A 8ICOA 1SKSA 5KT7A 3UQ2A 8ICWA 5KG4A 5KT6A 3ORYA 5J2GA 3M8RA 3Q8SB 4DWIA 4QZEA 5DBCA 4JV1A 1TK5A 3GDXA 3C2MA 4RNMA 1BGXT 2BCVA 3AU2A 4ECQA 2HHVA 2A1JB 2W9CB 2ZUCA 5DG8A 8ICBA 1X9WA 3SV3A 2ASJA 1SKWA 4IRCA 3ZDEA 4F5QA 1KRPA 4DSKA 4O3SA 4O9MA 4UB3A 4C8MA 5DG9A 4RNOA 4M6WA 4M9HA 3T5JA 4DSLA 3OJUA 2JZBA 1KFDA 4RT3A 5J0SA 4KLQA 4EYHB 2F1JA 4RT2A 4DSEA 4DF8A 2FLNA 4B9VA 3RJFA 4KLJA 4YN4A 1NKBA 1KEJA 3ZDCA 4KLUA 3GIKA 3LWMA 3RBEA 1U4BA 7ICSA 8ICFA 2C28A 1S77D 3PVXA 5DQIA 3NGDA 3TFSA 4XA5A 4UB5A 2ZJAA 3H4BA 4B9LA 4PGQA 4M9LA 1NK0A 5KT2A 4O3OA 4C8LA 4J9PA 1XU4A 3EPIA 4F3OA 2ZTEA 4UQGA 1ZQOA 2FMSA 4RU9A 4IQWA 3NTUA 8ICVA 1ZQLA 3PR5B 5IILA 2FLPA 3K75D 4EYIB 1S10A 5J0PA 1XSPA 2KTQA 4FBUA 8ICGA 5DG7A 4F91B 3MFHA 2ISOA 2BCQA 3V6HA 4DF4A 1RPLA 2W9BA 2LYHA 3Q8KA 5KG2A 2ZUDA 4QZHA 1XSLA 1X2IA 4Q44A 4YFKA 4QWDA 4DS5A 9ICKA 2PFNA 5DKWA 9ICEA 4JV0A 2UVUA 4ELTA 4I2GA 4BWMA 4ED3A 1MC8A 4DL4A 4CCHA 9ICHA 1L3SA 2PFQA 7ICMA 5DBAA 4J9NA 4MFFA 4NLKA 2BPFA 2MUTB 4TUPA 2FPKA 5KFQA 3QEAZ 2XGQA 3RR7A 4NY8A 4B9UA 5DB9A 5J2BA 4DOCA 5KG6A 2VA3A 4XQ8A 4KLOA 3OSNA 3AUOA 3E2EA 4GXIA 1ZQJA 1ZQEA 1TAUA 1Y88A 4GXKA 3MABA
chains in the Genus database with same CATH superfamily
3GV5B 3EWAA 2NO4A 2RDIA 3BZCA 2CRXA 1ZQUA 4L3QA 4LH5A 3K58A 5AM1A 4G1QA 2O4GA 3G71N 2ZG6A 4JI3K 4YQWA 9ICCA 4HHTA 3DXKA 4KMOB 3M8PA 3ZETA 5F2RA 2RDJA 3KJVA 2GX9A 3ZSZA 4FJKA 4BGBA 4CE9A 2DFHA 2IOHA 3G25A 3MWTA 4FLWA 4KBOA 2Y9UA 3KZXA 5KT4A 5FLXO 2CXYA 3P1GA 1VSKA 5CB1A 1C0FA 1NU0A 2F7TA 4DQQA 1ZQRA 3LVWA 3MN9A 2G07A 2Y9TA 2KOBA 1OH6A 3MGVA 3LAKA 1BL3A 3DAWA 5J2EA 5AICA 2KVCA 3ENBA 3RH5A 3HI0A 1O13A 4BROA 2GH1A 4I9LA 2A1RA 3OYDA 3HP6A 5HP4A 5D46A 4JRQA 4QZ9A 3MXMA 1KVBA 4KV8A 3RSEA 1N63A 3BZKA 1QQCA 4FOEA 4RW8A 1JI7A 2J6TA 4KLSA 2VA8A 2YN4A 2ZIVB 2D0BA 2MAXA 2IMWP 2L5YA 4CJ5A 1W2BM 7ICEA 2QKKA 2OYQA 4F4XA 4R66A 5KFRA 3NF8A 3ENHA 1ZQBA 5KQ8A 2V52B 3B9JA 5HROA 1YAGA 4ELUA 1MA9B 3SJHA 4OCZA 3V7KA 1KVAA 1JROA 4RQ6A 8ICMA 3DI6A 5KFHA 1EO1A 4DFJA 1L7OA 2H3QA 3RJJA 4BE0A 2ZJRL 3AVAA 4CJ4A 1XHZA 3N97B 3MR6A 5D4BA 1CI4A 4J9QA 3RF9A 1L3UA 1XWLA 2VANA 4BRNA 5IIIA 5LJVA 4FJLA 3PUFA 4ECRA 3MX5A 4RPZA 2BGWA 3FZHA 3PW0A 2XO7A 5AK5A 5AKKA 2ATQA 4KO0A 4CF1A 4NM2A 4QNLA 3ULDA 3OGUA 5KFIA 4I2BA 4O3MA 9ICRA 2JR5A 5AQFA 4CZLA 3G6XA 1SV0C 3SAGA 3TSPA 1DGKN 1NGFA 2B5JA 3MEEA 4NLCA 3HZ6A 2AA4A 2YHYA 5KFXA 2YHWA 3H8SA 5AI5A 5J2JA 4KLLA 2FSJA 5AK3A 3CM6A 3L6QA 1N33K 4B3TK 4FWLA 4FZLA 4ED2A 2HMXA 1WLJA 4IEEA 4OLAA 5ALOA 1ZQWA 5C0YA 3THWA 3QEPA 1NOZA 1S5LU 4Z4CA 4NCBA 5EE1A 4BVOA 3EZ5A 4IRKA 2GTDA 4LF7K 3UXNA 3E58A 1QQ5A 5DLFA 2I9GA 3IHQB 1Z1BA 1OUQA 4BXOB 3CJBA 4R65A 4QOZB 2HDOA 5H2FU 3L3UA 8ICQA 1S0MA 3TARA 2ZXIA 1HJOA 4CGHA 4DEZA 2BKEA 4J9LA 1K8AO 5HRSA 3DOKA 3CFRA 2O8DA 1YZ6A 4RQ4A 1H1VA 2W41A 2KSOB 2FMPA 4NL9A 1NG9A 2HSTA 4DB3A 2G8HA 1U49A 2JRZA 2FPLA 7ICJA 2Z7JA 5DLGA 1A5XA 4PJ0U 3OHAA 4CNQA 5J1EA 7ICPA 3KBBA 3DJCA 4ILHA 2QW9A 4ISEA 2C2EA 3RBDA 3PMLA 3J81j 5KFNA 1GLCG 3A2FA 5C15A 4QZGA 4CEAA 1ITGA 1ZQDA 3BP8A 1N60A 4C7ZA 3SMVA 5GAGP 1NK7A 5JLHA 3MXIA 3MDCA 1SXDA 3DMJA 9ICTA 1OH5A 4I6MA 3KK7A 4N47A 5J2HA 2Q0ZX 5KG7A 1S72N 2KQ2A 1TAQA 1WUDA 1VQ7N 2ZIUB 4JK7A 5ALDA 1GO3F 4FWPA 2CGLA 3K9KA 3M6KA 3PW4A 3QNOA 2K8BB 2ZIXB 4ISFA 1B22A 2GWKA 1N5YA 3V6DA 1RZTA 3QZ7A 3H8JA 4MFBA 3D45A 3DRSA 1L7MA 1WYGA 3CFOA 3DLGA 3I55N 5KFGA 1GOCA 4ECVA 4F72A 1RYSA 2Z1HA 2W9CA 5KFPA 2O8EB 3KTQA 5ALLA 3TADC 4DOBA 4H0XB 4WFAL 4KHWA 4YCXA 1RXWA 2ASMA 2YX6A 4YP3A 4FJNA 5J0RA 1VLBA 4E7KA 1CUKA 3LZIA 5KG0A 4DTJA 2ZQBA 4K25A 5DBBA 3S41A 1IKXA 3HTVA 4EAHD 4DR6K 4EZ9A 1ZQTA 4ELVA 2W03A 4HCBA 2G8IA 4F92B 4J2AA 3O9SA 1ZQVA 4YOXA 1RYUA 1D8BA 1RT2A 2JZBB 3WK7A 2P9LB 4H0VB 4CHYA 2Q97A 3VTIA 4NO7A 3AV9A 4TQRA 4JMUA 1XO1A 1CEZA 2XCAA 5ALTA 4KLIA 5AK4A 1K8KB 4FOIA 1JRPA 1LAWA 2G08A 3JPQA 3MK6A 3THXB 3AVCA 3A0BU 3A5NC 1NWKA 4F4WA 4DV7K 4JS5A 3HT3A 1G15A 2DPIA 4E7LA 3UIQA 5BR9A 3M8SA 1JLEA 3LM2A 4F93B 3D2FB 4FJXA 5M1PA 2D3DA 4DL5A 2DGZA 2XCPA 1RT1A 1C7YA 3QERA 2I1QA 2E8PA 1HNIA 4F4KA 3CIPA 1XC3A 2VG5A 3VQBA 4PGYA 1ZQSA 4JI2K 3N4MB 3U8XA 2DWQA 1NI3A 5HHIA 4JI0K 1Z00B 4NYNA 3IV6A 2KZ3A 1HIWA 2MUTA 2PMZF 9ICVA 1QHTA 1TKZA 2XICA 2KFZA 3NF9A 2YTUA 5EWFA 3EZWA 1HUXA 4NCAA 5JRTA 4NXZA 2KK0A 4DV2K 3C5FA 4M42A 9ICPA 4M41A 3DLHA 4QIWF 2UVVA 1DLOA 1T6CA 1BQNA 3VQPA 1PK1A 2BQRA 4OPJA 4OKEA 2WFBA 4M7YA 4CFCA 2JMGA 4YXMA 2O8FB 3V4IA 3HK2A 3L3VA 1RDFA 5AKEA 3TAEA 3KKSA 1DT9A 3E1YA 5AQMA 3J7ZO 4KHYA 4OPHA 3T5HA 2V9WA 1QSLA 1LW0A 4I7FA 2EZYA 4FVMA 2KJ9A 2QARB 4DUZK 4RQ8A 4UAUA 3WKDA 1V38A 4C7YA 2CPRA 4FJHA 2KP7A 4ZTFA 5E41A 3S3NA 2OEHA 2KFNA 3UB5A 4X64K 3T1HK 2FBTA 5BRHA 2M0NA 3ZSWA 2H3IA 1YT3A 4OKKA 1UT8A 1A77A 2NRTA 1WB9A 1D8LA 4FBTA 3CXCM 1B43A 1BA0A 4A57A 1DKGD 5IIOA 3ZDDA 2LHTA 2BQUA 1SKRA 1KDHA 3AA2A 3CCVN 4DR4K 3QZ8A 3NVVA 1X9XA 4KLHA 4PPXA 4YR2A 3ZX0A 5E26A 3HVRA 3Q8LA 1X9SA 3M7DA 3DLBA 2IBKA 5DGBA 4F5NA 4PHEA 1XQSC 4MEXA 2NNWA 3VEYA 1TVAA 3SUPA 5DDMA 3RRHA 2EH9A 2P9PA 3IM1A 3FFKB 4YDUC 3I33A 4FFDA 5EXWA 2PI4A 1RBRA 3LALA 4JKGA 5AKIA 3NDKA 2KKZA 3RFAA 3AQFA 2KN7A 2E2QA 5AQSA 5K14A 4IFYA 4Z4HA 3RJEA 2KMDA 5BPCA 4EX6A 2Q31A 1FXXA 3VETA 2W54A 4RPYA 3DDHA 5ALXA 4A59A 5AQUA 1UT5A 2KD1A 3KVGA 4DV0K 4PA1A 4YHHK 2A1JA 2XVTA 4UB6U 3DXMA 4CGZA 4FSVA 4BC4A 1VQNN 1O08A 2IVPA 4JS4A 4WYBA 1NKEA 4JD2A 1D9DA 4PHAA 2HMPA 1C1CA 2JLEA 5AJ3K 2W3RA 1XNSA 1T7PA 1JLBA 3HOSA 2XRIA 3QUBA 2Q0RA 3UE5A 4CEBA 2VJ4A 5DQHA 3NVWA 3BS5A 3DYAA 3WT0A 3ALRA 3WK9A 5AR0A 1X3MA 2HF3A 3D6RA 5AFUA 3NHGA 3GE1A 2UUAK 4EIAA 2DPNA 3ZT2A 5KFTA 2XIDA 5J0TA 4DR7K 1SAZA 5AM4A 2FLOA 1WN7A 5J8YA 4KRFA 3VQ8A 1QZ5A 2R8KA 3G0ZA 3QXGA 2ITGA 3VEWA 3UMBA 3VN5A 3QETA 4B3OA 2QXLA 5FPNA 5AM0A 4QZBA 3QUQA 2WONA 3LK9A 1HUZA 4DU3A 3G6VA 3L2QA 3CCQN 4I2DA 1NGAA 2W40A 5F3XB 3AGRA 3K5OA 4I2AA 5EE0A 3T5KA 2DPJA 4CJQA 4R8UA 3NH2A 1X1PA 1TYQA 3CC2N 4H5NA 4YMMA 4O3QA 2F44A 1N36K 2W8LA 3CJ1A 1LB2B 4CZHA 3U9DA 3GV7B 3F2BA 4M63C 3ID8A 3HVTA 4RG8A 1LCUA 3JPSA 1HMVA 2MU2A 5KFCA 4KN4A 4P0PB 3CERA 4RW6A 3ONNA 4MEYA 2RP5A 1KN5A 1Q18A 1ZBSA 3KLIA 3SQ0A 3AVMA 1SL1A 3AVLA 2ZD1A 4Y2XA 2JEJA 3S9HA 3VTHA 4R63A 3H3OB 4KX3A 3TANA 5KPRA 2O4IA 3WKCA 3Q8RB 4FWMA 3CQYA 5J2KA 3QBWA 4JI4K 3WNFA 3FC4A 2QKBA 2ZTDA 1BO5O 2ASPA 3O8MA 5AHXA 2HSZA 1S0NA 2NYVA 3LVVA 1IBKK 2F8KA 4LF6K 4CEOA 4BRKA 2HI0A 5KT7A 1YJNN 5JS1A 5KG4A 5KT6A 5J2GA 4DWIA 1X66A 4QZEA 3TU5A 1X42A 3GDXA 4H0OA 4CJTA 4CGGA 2P9UB 2ZUCA 1WWUA 3T19A 1KD1O 2ASJA 1SKWA 3CJCA 2LPEA 2K4HA 1KRPA 4FWNA 5CZ1A 1KVCA 3T1YK 3IAYA 4C8MA 3O80A 1NZBA 1VSDA 5DG9A 4RNOA 4O8KA 4M6WA 4M9HA 1NMDA 3O4QA 2X74A 4NB4A 4EYHB 2QWRA 2QWOA 3QU5A 4IBNA 2FLNA 4ILJA 3SNNA 5JTIA 4AH9A 5M1NA 3D2QA 3WK5A 7ICSA 2JGUA 8ICFA 4BGAA 1ZD4A 2YX8A 2MA1A 3HBTA 3QIOA 1RQLA 3I8BA 4FJIA 2BANA 1DRGA 4B9LA 3OYLA 4PGQA 5ALNA 4JLHA 3OA9A 5KT2A 5EE9A 1C0GA 2KHOA 4C8LA 2OANA 3EPIA 2W04A 1JCEA 3IRUA 1BCOA 3D6JA 1QZ6A 4JI7K 4F91B 3HILA 1NLVA 3KKRA 3HXMA 3SPZA 4DF4A 1TV6A 2AP1A 2HOEA 2W9BA 2PAVA 4H0YB 1J2MA 4LSNA 5M1OA 5T7BA 3Q8KA 2G8WA 5KG2A 3H1QA 2KIVA 3AO4A 3OS2A 9ICKA 4YFKA 4BUGA 9ICEA 4ELTA 1YJ9N 3DRRA 4H0TB 1ASWA 3O3FA 1L3SA 2PFQA 4J9NA 2F96A 2P9IA 2BPFA 5J2NA 2FPKA 5KFQA 1DK2A 2YNFA 4NY8A 5FDLA 3NE6A 2Q3SA 4R79A 4DOCA 3UM9A 3O9UA 4XQ8A 3EO3A 2P9KB 3F2KA 4KTWA 1P7DA 4GXIA 2A5XA 5KPTA 5HL7L 3K9JA 4B1WB 3CCUN 4RQ0A 3MABA 2C28A 2X78A 3RRGA 3HJEA 3WNHA 4DS4A 3N7PD 1YTUA 2K4IA 4KLDA 1ED1A 4F5RA 9ICOA 2RLTA 5KFEA 4AILC 5HOOA 2DUYA 4QWEA 3DV9A 4H4OA 3F5AA 3SYZA 2OHFA 4HUEA 3AY9A 2E8AA 5KFAA 1NGBA 3VEXA 3HO1A 4QWBA 3A5OC 2IAJA 1NGDA 3QICA 2E8NA 3UKRA 2YV0X 4US9A 4KKOA 1NBWA 2PKEA 2WHEA 9ICIA 4XUSA 1X9MA 2BE2A 4FCYA 2QB1A 2Q4TA 2FLLA 4LZGA 4CHQA 3H0RB 1Q3VA 1FK9A 3C1ZA 4DQRA 2FSKA 1IBMK 1SZPA 5AIAA 4O3RA 1HKGA 4ISGA 3U6FA 4YMOA 3TQ1A 4PWDA 1SZ2A 2C2RA 4CZEA 5EY4A 3VEZA 4M3TA 4RQ7A 2UXCK 2HW3A 4UATA 2NRWA 1BIUA 9ICJA 4DFKA 3V9SA 4O0IA 2IOFK 9ICXA 3DM2A 5C2FA 5CZ2A 4XIUA 3JPPA 3O3GA 1PK3A 2J4RA 4IO8A 2XGPA 2O8BA 4DFDA 1B9FA 4KPYA 2O8CB 4X5VA 4KLFA 4I2FA 4CRXA 3GFKB 1WCLA 2D0OA 2X6NA 3OYKA 1JL2A 1K9MO 4JYAK 2BPGA 3ZYYX 2ISPA 4B9QA 4GNIA 5J0YA 2HB5A 5M1FA 4DQSA 2H3ZA 1SIJA 3AVBA 1ZQNA 3L4IA 7ICRA 1UHUA 1SWVA 3C7NB 4HCCA 4KH4A 4JI8K 3RMAA 5J0UA 2UXDK 1BOTO 3WQTA 5AM3A 3KHRA 3LP2A 4FJGA 8ICLA 2AGOA 4FS2A 4M3RA 1CZAN 2A6AA 3BDPA 3HPGA 3Q7CA 5C12A 3CQ8A 3V1OA 4M04A 4IOXA 3C21A 3CNHA 4O0JA 1N56A 4OLBA 9ICBA 4ILGB 3NF6A 3RB6A 4IXCA 2E5SA 5DQGA 3SZ2A 4MQ3A 4JN4A 3A5LC 3SQIA 4BDYA 1S9GA 1GOBA 4JKBA 4JI6K 1VSIA 2ZJQL 1UWBA 5FPMA 3KOOA 2HNDA 4LH4A 1NK5A 4M0AA 4EX7A 3CJAA 2B0CA 3V1RA 4WFBL 2NRVA 3VQ4A 3LPTA 4JHDA 4NJ8A 1KAYA 1Q7YO 2G8UA 3R9KA 4QW8A 8ICKA 2OTLN 3L2WA 4BRDA 4FM0A 4ED1A 5IINA 1VQ6N 1HNVA 3WKEA 1HNXK 3MMVA 9ICUA 1SUQA 4UB8U 4Q43A 1LW2A 2KJ5A 1AROP 4PL1A 3OBWA 2LBOA 5H1SQ 4YR3A 5J2QA 1WAFA 2OZSA 4FK0A 1IBLK 1EP4A 2Q36A 3I0RA 3ISBA 1VQ5N 1L8LA 1XNQK 1YVUA 3MBYA 1WNSA 2VQEK 5CHGA 4DV6K 1NJWA 4YOYA 3H8MA 1S6QA 4CJWA 3CJ7A 3QEIA 3QUCA 2OH2A 2P6RA 1IH7A 1SQKA 4LD0A 1JCFA 4GMJB 5SWMA 8ICYA 4CF2A 5HRNA 4PHPA 5HHHA 3BQ1A 4FPAA 4CBUA 4JV5K 3C65A 4RCHA 2YNIA 4FZZA 3PW5A 2NRXA 3KKAA 2NLXA 4UBBA 3TWHA 3WU2U 5BREA 3UQ0A 3R1XA 4GKKK 4P4OA 5AI8A 4BC2A 4RQ5A 3CCSN 1NGCA 1FFUA 3K0SA 3QESA 3HPOA 3AVNA 3I0SA 2F1HA 3AVIA 1T03A 2ASDA 2E3TA 2R8HA 3V7JA 4AHRA 4I2HA 2ZTCA 5J0WA 5ALEA 3ISCA 1CZ9A 1KLNA 1WCNA 4DL2A 9ICAA 4DV4K 1QVGM 3PIOL 3FE1A 3OYCA 1OH7A 3KK2A 1HKCA 3LDLA 3HM8A 3M3ZA 1WSJA 2B4JA 3IFRA 4BRMA 4ZHRA 1OXJA 4I2IA 1BNPA 1MWMA 4JWNA 5J0QA 4OGCA 2FBVA 3MR3A 5IIMA 3DEEA 5KFJA 5AQPA 1LKYA 1XS9D 2G0AA 2A1SA 1QHAA 3MDQA 1W9HA 9ICNA 2KLAA 1N32K 5HMLA 5ALPA 3KLEA 2Y0SC 3RJHA 2DFLA 2W9AA 3SENA 4B3RK 2E1FA 3LM9A 4RW9A 4N56A 4DMNA 4P4MA 4B9MA 3TSQA 1T4GA 4BRFA 3FR0A 1EWQA 1RDAA 3CPEA 3C6TA 4NCGA 4AM7A 1BUPA 3NASA 3O4WA 1EETA 3U3GA 1CRXA 2H5XA 2HOFA 1KAXA 1JXLA 1RT3A 1XUPO 2H3GX 4FZYA 2W9MA 4CFAA 2ZM6K 5L1MA 4KHQA 1C0MA 3T3FA 2V7ZA 5ALYA 3ENOA 3MECA 3SUOA 5HP1A 4IL6U 1GLEG 3TAQA 3H7IA 4FWSA 3GU3A 4PZNA 2YNGA 1KFTA 1S76D 2WAQC 4Y1CA 3L4QA 2I5JA 4QZAA 3EPGA 3ULEA 4YXJA 1YVNA 1HLUA 2E20A 4O55A 3PSFA 3M6GA 4UB4A 4C1NK 3MX2A 3M6ZA 5AM5A 4IEIA 4NL9C 2VCPA 3KHYA 3EN9A 4W5QA 2R8IA 1ZD3A 4DTXA 2ATLA 4FJ7A 2OTJN 2CH5A 3LDPA 3AVGA 4MHVA 1ZJNA 1X3NA 3JPNA 1DXSA 4DQPA 1S0VA 4NYFA 4CJKA 1LWEA 4PKHA 1TFRA 1BI4B 1N5WA 1RQNA 3O9RA 3MN6A 2QEXN 4CERA 4EENA 1ZQAA 3RH4A 3SAHA 1RT6A 3B0XA 1J6ZA 3WNGA 5L1IA 4IG3A 1VSMA 4OJPA 5CA7A 4I6MB 1QH9A 3UXOA 3K1ZA 1RT4A 2K4EA 2FBXA 2OYYA 2P35A 4P0QB 3JPRA 3H1VX 1N61A 1NM1A 1SV5A 7ICTA 2WF7A 2Q2RA 2WTUA 4F2SA 4C1NI 4BVPA 1CZBA 4IO9L 4JKDA 3RWUA 1LWFA 4DTUA 4CK3A 2XY6A 2Y1IA 5AQRA 2ZJPL 1R59O 4M45A 4G9ZA 5AI9A 5J29A 2UYTA 4EHTA 4W5TA 5TZVA 2J6SA 1BDGA 5KQDA 4TURA 1VQ8N 5J2AA 3EY1A 3RMCA 1YF5L 3GL1A 4YD1A 3RJIA 4CJSA 1MU2A 4IC9A 3VENA 2LSNA 1W0HA 2KICA 4PQUA 2YB4A 3EYZA 2QWLA 2NV3A 3WKBA 1HX1A 4J2EA 1ZQXA 2KVSA 8ICZA 2NUBA 3FAHA 3SQ2A 3N4QA 4X66K 4F4YA 4B1VA 5KFWA 4WE1A 5BOMA 1ZQQA 1T44A 1RT7A 3VERA 1BPEA 1NGJA 1K6YA 1RDWX 2PBDA 4FLTA 4DL7A 2OCEA 3ASMA 4CZJA 1M1KO 4ECYA 4N76A 2D6FC 4AYBF 3O3HA 5C5JA 4P4PA 2WTFA 1N5XA 1U9LA 2YQEA 2IOFA 4NLBA 4F8RA 1IKYA 1A76A 1MN8A 3QE9Y 4H4MA 4XH1A 3LDNA 3NMUA 4IJAA 1S22A 2BPCA 3WQUA 3WEEA 3OPXA 4FJ8A 3JXUA 2ITMA 1UQVA 3TTCA 1Q46A 5FPDA 2A1AA 4J9MA 1MQ3A 5J2MA 1RDCA 4EELA 5KFDA 3I56N 5AKXA 3OYEA 1PVRA 4CW7B 3B0YA 2BDUA 2XY7A 4YOWA 4CBWA 5AFUH 5CR0A 3RB4A 1LWCA 4EP4A 4EEKA 3GBTA 1XNRK 3G10A 4X62K 4J9KA 2K8CB 3RJKA 3ID6A 1U6ZA 5GIOA 3CYMA 3C29A 3LDOA 2JXJA 5GTIU 3AVJA 2CGKA 4PL2A 4BGDA 3QO9A 4OPKA 2ZIWB 1ZBFA 2DFFA 2ZUBA 4H5WA 4ICAA 2QI2A 5KNIA 4BXOA 2PI5A 1W97L 2E8OA 4K4GA 1W7AA 4DKWA 3QIPA 4B6JA 2HHSA 2HF4A 2HVIA 5HRPA 2F4VK 4LF4K 2K89A 4OO1J 3V72A 7ICUA 1JLCA 2RN2A 3DOLA 2P5OA 1JL1A 4JKHA 1LV5A 3UXPA 5KFUA 3D2EB 4EBDA 3GILA 4E19A 3THVA 2VA2A 2HNYA 5B8HA 2HHXA 4BY9C 4DTOA 5AQKA 2VJ5A 2FC0A 1REVA 1ZETA 3OHBA 1BPYA 4O44A 2W42A 4CHNA 2KZZA 3WUHA 2EQYA 4F5PA 8ICTA 3AO5A 3G4SN 3WXKA 3HM9A 3TTFA 1FIQA 3NS1A 1RT5A 4A2AA 4FZNA 4Y2JA 3MFIA 4NLZA 1F44A 2NRRA 1T94A 1B0XA 4Z6CA 1XI1A 1FEZA 2E4LA 1K1SA 2FE9A 5DK5A 2O6KA 5ALIA 3S6JA 3C28A 5BPNA 1DOQA 1RM6C 1HJRA 4KLTA 1EXNA 1RTJA 4CESA 3CC7N 2ZIUA 3ZEUB 2IDOA 5KFZA 1TK8A 5KFFA 4K8ZA 3SLCA 4K42A 5GINA 5AKHA 5F1XA 5HNKA 2D5RA 3O9TA 2G06A 1ZQ1C 3DLKA 3ZX3A 4B08A 3AARA 3U26A 4C4TA 2V4RA 3NGZA 3ED5A 3GIJA 1P8ZA 2RF2A 1Q8KA 2E88A 5ALZA 4KREA 5DB8A 3ZT0A 4M3UA 3UQ2A 4N41A 4FK2A 3P5JA 1HYZA 3F5EA 2WF8A 3MXJA 5ALHA 3NGIA 4B1ZA 4LC9B 3AU2A 1ESVA 2E6MA 3TACB 4E89A 3ATVA 2A1JB 4CIEA 5DG8A 3F2DA 1EKEA 3SV3A 4IRCA 2DBYA 2VG6A 3OTOK 4WQ4A 1X9JA 4JD2B 3SUQA 2MSNA 5GAHP 1BISA 1V97A 4DSLA 2DKXA 3FLCO 2JZBA 2F1JA 4RT2A 4KLJA 2HVHA 1TKXA 4B9VA 3RJFA 1UAXA 3E9PA 3EKUA 3H46O 1HR0K 3BS5B 3LWMA 3RBEA 1U4BA 1K8KA 3FZLA 5LL6Z 2GWJA 4YORA 2X6SA 4A61A 3PVXA 4CEFA 4FPBA 3K59A 5DQIA 3VMFB 2GUIA 2HBMA 3THXA 1VQ9N 2ZJAA 4X65K 1VQLN 1S9EA 3J8AA 1ZOLA 3KD1E 3UMCA 4YY3K 1NK0A 5JICA 3QUTA 3QMLA 2DF4B 1C6VA 4J9PA 5AQGA 4IQWA 2ZTEA 5K4LA 4UQGA 5G5HA 4RU9A 3D2FA 3NTUA 3NH0A 1ZQLA 3PR5B 1B92A 1QCKA 3IS9A 1RTHA 2G5IB 5J8YC 2YHAA 2DL0A 1S10A 1XSPA 8ICGA 5D3GA 5JMVA 3MFHA 3CFPA 3HKZF 3V6HA 1RPLA 2A42A 2LYHA 1NGGA 4LSLA 1XSLA 1X2IA 4Q44A 4DS5A 4QWDA 1S8OA 1TYQB 2W6KA 2Z1GA 2PFNA 4HTLA 3WXJA 4AHSA 5I9EB 3JSMA 2RE2A 3WK8A 3A8YA 4I2GA 4KHSA 9ICHA 3SMPA 3MC1A 7ICMA 1UCVA 3E66A 4MFFA 4FLVA 5BR8K 4IWVA 3RR7A 4LJXA 3N7SC 3IDWA 4B9UA 5DB9A 3HSCA 4CEDA 2FSNA 2VA3A 3MEDA 4F3TA 4KLOA 3OSNA 4Y2UA 1KC8O 4JEPA 1ZQEA 3ZT3A 2P9NA 1IIPA 3RR8A 3GDQA 5JLFA 1L3VA 1BG3A 1HQUA 5ADXA 1I94K 1GLJO 2RQ5A 1VQON 1S0OA 4KHPK 1JIHA 7ICGA 3Q7BA 1VSJA 4FWOA 3NVZA 4C8NA 3VF6A 4QCLA 4KH5A 4QAGA 4GVMA 2P9SA 3WNEA 4M3ZA 3AL0B 3AGKA 3EW9A 3CCRN 5FRNA 2BCSA 1S3XA 3C95A 4QJFB 4IRDA 4Z6FA 2VGNA 5AKZA 1BVSA 4CIFA 4HTUA 3WK6A 1HUOA 4DU4A 4YG2A 4FJJA 2E2OA 2YMPA 4RPXA 1ZQPA 5EWEA 4KX5A 2YKNA 4H5RA 4WF9L 3OW2M 1WBBA 2PY5A 2GOLA 5E79U 3O9QA 4ZTJA 3NVMA 5AQVA 4A62A 4CFBA 1V85A 4RUCA 2QKQA 2PXIA 4B1UB 1V4TA 1HYSA 4RTFD 1UOCA 4CJFA 5KFSA 4KN7A 5FP0A 4BRLA 5MLCQ 5KRSA 4DLGA 4FM1A 3KFUF 3KZBA 1L3TA 3L5KA 4J9RA 4Z4IA 3O0FA 3AU6A 1OVYA 1HNZK 2BGGA 3PMNA 1JN3A 1TL3A 5TKWA 4WCEL 5DDYA 1KQQA 1XMQK 1PUZA 3I76A 2GELA 1JUDA 4A5BA 3QX7A 2EHGA 5CE3A 5DM7L 1J5OA 4CJVA 3S3OA 2EZXA 4QZDA 4UARA 5FROA 2D4WA 8ICEA 1TAMA 1ZD5A 4CZFA 2FJ6A 1NJZA 3ZI4A 3BF1A 1HQEA 4HUGA 2E2PA 4ECWA 4DV5K 1F5SA 4O5CA 7ICKA 1IG8A 2W9BB 2EAMA 1ZBUA 2KJ8A 2NZTA 4QS8A 2A19A 2ASLA 3TABA 3D2NA 1SL0A 3FZKA 4UY8O 4DSIA 4F4ZA 3AAPA 4J8FA 5C42A 4NM1A 2YJEA 3NUQA 4KB0A 5C25A 2HHWA 2W7PA 1NK6A 4M7XA 5DGAA 2GO7A 3B8AX 1BWFO 4J9SA 1ZQZA 4QW9A 5AZIB 4CGIA 1U47A 4CJRA 4KITB 4CEQA 4YNQA 9ICQA 5CYMA 4PKGA 4JKAA 3AEVA 2B6AA 4RQ2A 9ICGA 4RNNA 1VSFA 4I2JA 2CGJA 4DTSA 4ECZA 2GBZA 1ZRMA 4XH4A 4LFBK 2W55A 5EE3A 4IS7A 2D0AA 2PZSA 3NVYA 4Y1DA 4DTRA 2E8MA 4GXJA 4LF9K 2NRZA 3TR8A 4IQTA 2UVWA 1S5JA 3THYB 2F76X 5B66U 2AU0A 4Z4FA 1WSIA 3AAQA 1Y97A 3MN7A 5FRMA 2EANA 3PX0A 4Q45A 3MR2A 3RAQA 3CF5L 2WF6A 2EAPA 3FM9A 1IG9A 4Z6DA 4CVNE 4BR2A 3VQ7A 2PMZC 3BF3A 1IKWA 3CCLN 2Y0SF 4C8OA 1OKJA 1XC9A 1ZQMA 3IG8A 1C1BA 3Q8MA 4CF9A 2JWKA 2GV9A 2UVRA 4Z4GA 4P0PA 5G5GA 3GIIA 1JKHA 4F5OA 1NGEA 4B8CA 1M90O 1TGOA 1NMNA 5BN9A 2F9WA 2P6UA 4DLEA 3KHGA 3IDHA 5CP2A 2WUSA 1VQMN 4YR0A 4FO6A 3F53A 4IOCL 1KFSA 1BPBA 1KAZA 4M47A 5EU7A 1COOA 3QINA 1HJPA 5ALSA 1NGIA 4B9TA 3VQAA 4CK2A 1F0MA 2YMLA 2C22A 5KG1A 4DU1A 3C23A 1EX4A 5ELZA 1J2NA 2AQ0A 3HRDD 4RW7A 2KEYA 3ISDA 3VA3A 2G8FA 2BCRA 4N5SA 1NJXA 3J7YP 1NJIO 2VIXA 4CF8A 2ZJ5A 2QWMA 3QNMA 3QLHA 2QTDA 1L6NA 1N62A 4UB1A 4TSXA 3IG1A 1T05A 3PIPL 4DO9A 1X40A 4M9NA 3BJYA 3TTDA 1TVRA 1J54A 4KI4A 4O5EA 4KI6A 4EFHA 1OW5A 2HBKA 3WKAA 5HRRA 4E7JA 8ICIA 1TK0A 3L0QA 4IFEA 3M1FA 3RH6A 1Q9XA 3M9OB 2IA6A 3OYBA 3L3FX 5CJ7A 1WAJA 1RNHA 4IDKA 3IG5A 4FS1A 3DLLL 1WSGA 5AZJA 5KFOA 5AQLA 5J2IA 2DQNB 3PSTA 3U9ZA 5A2QO 4M9JA 2DKZA 4K43A 1HYVA 5JVHL 3AQEA 4JAXA 5CEHA 2AHOB 2DTUA 3K5NA 1U2VA 8ICRA 1UA0A 2UU9K 3SBTA 3QEVA 4KH6A 3U3YA 4M9GA 4DV3K 8ICXA 3PO4A 3QEWA 4YD2A 4M2YA 1CXQA 4UAYA 4OVLA 4FO0A 3ZT1A 1PZNA 4DSFA 2BH1A 4QWAA 1DGSA 1ZXOA 4BWJA 4DTPA 3H0MB 3VPZA 4GKJK 3NVKA 5ALUA 2M9NA 4DCCA 2GLEA 3JPOA 2HHUA 4AHUA 2D0CA 3VEVA 3V9UA 4AP9A 1KCFA 2JEGA 4CGFA 4Q0BA 1ZJMA 2EWSA 1KKXA 3VQQA 4UASA 2YNHA 5F0XA 4BR4A 5DB7A 4RZRA 8ICUA 3JAMO 3LDSA 4KB1A 1V9PA 4O3NA 1T8EA 1Q86O 4FM2A 4FJ9A 2P9KA 3SQ4A 1EXQA 1KSPA 1ATSA 2QB0A 4W5OA 2JGAA 3KKAC 4IQVA 2AQ4A 2E1ZA 5CYQA 2J6UA 3SI8A 2IHNA 3AA3A 4DV1K 3CQXA 2XC9A 9ICLA 5J2DA 2A40A 5EX5A 3LZJA 2ZXHA 1BPZA 3IMXA 4PGXA 3LAMA 1WWVA 3RMBA 1D5AA 3MGIA 4KTQA 3G6EN 3NAEA 2P1JA 1QSYA 1ZXIA 4YVZA 2H3VA 3V81A 1D9FA 7ICHA 3KLHA 1HPZA 1BHLA 2YHXA 1JLFA 3VOVA 3RTVA 3DXKB 3ZETB 3OYJA 4CZIA 2CH6A 2ASOA 2XY8A 4JK9A 5B5EU 3OYNA 3BGRA 4Q8EA 4BC5A 3E9OA 2WF5A 2IHMA 3MAQA 3QEBZ 3AMZA 4EZ6A 1QSSA 3HSTB 1SZHA 4Q5VA 5C10A 3CI5A 4I2QA 2QWQA 5BPLA 3PLAA 5F9LA 3MEGA 4BR0A 4GIBA 3N7RC 4JNEA 5KGXA 4OGEA 4WQ5A 4IR9A 3R6MA 4JI5K 1S1TA 5I3UA 5IWAK 1HPMA 2XI9A 2FF6A 1ASUA 5T14A 4M3XA 4KTZA 2F8LA 4E1MA 3UKUA 1QQ7A 1ZQKA 5A0LA 3RSEB 2QK9A 3TAMA 1LOTB 2YY6A 2VKQA 4OJLA 4K4IA 3H3NO 5ALQA 3AVFA 3PR4A 4BQLA 4ECSA 1TKDA 1C1AA 3ZSYA 2AGQA 2KG5A 3C7NA 5C24A 2RPIA 3ZSOA 1CXUA 3BQ7A 1KLMA 3DWLA 4I27A 4E3SA 3VGMA 5KFYA 2AGPA 3OYGA 5KPZA 5AQYA 3KZIU 5KG3A 2XY5A 2EZZA 1T3NA 7ICNA 1SL2A 2JWLA 4CJUA 3LPUA 3KWIA 5KFKA 3I8DA 3K2PA 4DQIA 3D7EO 2C2DA 4BRCA 4DFMA 4FE3A 1RXVA 3CC4N 4CF0A 4ECXA 8ICNA 4PL8A 3BQTA 3KWGA 5KFLA 2Q0UA 3FDSA 1ZQGA 2IGIA 4FLZA 4CHZA 5CRXA 3CJ9A 3HP9A 1ZBHA 2OM6A 1RBVA 1LAVA 5IIJA 5IIKA 2E1EA 1S1VA 4CFDA 1R0AA 5L9XA 1IKVA 5ALKA 3QYPA 3ZX2A 1MSWD 4TUQA 3VGLA 3CPWM 4E7IA 2FPMA 3THWB 3BY5A 3SR6A 9ICWA 4F71A 4U67L 5L1JA 1IJJA 1YITN 1IM4A 4FZMA 3V9WA 3PO5A 4QWCA 1Z26A 2QWPA 4CJLA 1TKTA 3ZD9A 2BCUA 3MR5A 5DB6A 1JXBA 2PFUA 3GIMA 2GWSA 3IKMA 1Z6RA 5M1QA 4MO5A 2UUBK 4BREA 4YOUA 4O5BA 4ZH4A 2W3SA 3LDAA 1RYRA 2Z1JA 1WUAA 2O8DB 1BIZA 1XHXA 3NRZA 2ES6A 4FLXA 3I28A 5ALGA 1ZQIA 1T3VA 1TUYA 2GEMA 4CZKA 2JEIA 3EEQA 1D8YA 2KZMA 3LYSA 3UPQA 3ALYA 1OH8A 4GV3A 2V4QA 1RBUA 3OYAA 3BQ0A 4Z94A 2G09A 1NZPA 4C4RA 4QZ8A 4E0DA 4NLNA 3H40A 2OPRA 3KD5E 3KIOA 4PHTX 2CN1A 2G5HB 1Q3UA 2AH5A 4GW6A 4ED8A 3OVNA 5LMUK 1Z25A 3SEIA 4G3IA 2ETJA 2JEFA 4O4GA 3PZPA 7ICOA 1NKCA 2D8CA 3MWPA 4IR1A 3QBXA 4CGDA 3HX0A 4WJ3B 5KFMA 4H03B 1CLQA 4MF2A 1Z05A 4JKFA 8ICHA 1ZBIA 2F3NA 3CW2C 3SD7A 3TPQA 4JUZA 4C80A 1IV8A 4ZOHC 3WEEB 5EWGA 3NRWA 4BJQA 5JU5A 8ICOA 1C0TA 1GOAA 3CHWA 4EHUA 4YOVA 3M8RA 3ORYA 4PL7A 4YOTA 5DBCA 4NWIA 1VSLA 2KKPA 4MLHA 2K4PA 3C2MA 2W11A 2E6LA 3VF4A 2HHVA 2W9CB 5KGWA 1KW4A 1X9WA 3M8QA 1TE2A 2RHKA 3K5LA 3OTQA 1B4FA 2VWJA 4AQYK 4F5QA 4O3SA 4DSKA 4O9MA 3ZSXA 4O8UA 4UB3A 1Z4OA 3C6HA 2W7OA 4Y2QA 4BR7A 2VYPA 2ZIVA 4DUYK 5J0SA 4DSEA 4C0ZA 4DF8A 2ZGYA 4KLUA 4YN4A 1NKBA 1KEJA 3ZDCA 1ZC6A 5AQHA 3GIKA 1RG6A 1S77D 3D2SA 3NGDA 2I6XA 2H3FA 4XA5A 4UB5A 3TFSA 2FDRA 3LP1A 3J81O 1S6PA 3CRXA 4JKEA 4O3OA 4GV9A 1XU4A 4F3OA 1ZQOA 3C94A 2BZFA 8ICVA 1F21A 4KHUA 3K75D 4EYIB 4I9QA 5J0PA 1IG6A 4FBUA 4FJMA 5ADXH 1FKOA 2V51B 2BCQA 4K0KK 4U7BA 1Q9YA 5LY3A 3OYHA 2HMIA 4MLEA 2WBNA 1SV0A 3VQ9A 2ZUDA 3TAGA 5AI0A 3AA5X 1RGIA 1BI4A 2AXTU 1WOQA 2IC3A 3NBPA 2UVUA 1O1WA 4ED3A 4DL4A 1RDUA 3ZT4A 4USAA 4NLKA 3AM9A 1RFQA 2MUTB 4TUPA 1TL1A 2Q1NA 1ZD2P 3AA4A 3SK3A 1YJWN 4Y2TA 2HOQA 4P0QA 5KG6A 1I3AA 2YHBA 5AQQA 4OKJA 2DY4A 1URJA 1ZQJA 4NV0A 1BCMA 4JK8A 4BACA 1YIJN 4LY7A 4BE2A 3M9MB 2W6LA 4B1XB 2I5HA 3IP4B 3KK3A 1E4GT 3OJSA 5LJWA 4FK4A 3KLGA 1PK1B 8ICSA 2D1KA 4KMUA 4PKIA 4DR2K 4DFPA 2LI6A 1M6YA 4ECTA 1BNOA 4LZDA 1QLNA 2WB1C 1S9FA 3ITHA 3KHHA 3TFRA 4FW2A 5TKYA 1NJYA 7ICQA 2KSOA 4CD3A 1K1QA 2B21A 4MO4A 4CECA 3HOTA 1L7PA 1Q82O 3MGHA 8ICAA 2IVOA 4KFBA 4B9SA 3AVKA 3T7ZA 4EP5A 3O4NA 5AQXA 2OZMA 4MFCA 3F5TA 3PNCA 4CI6A 9ICFA 1ZQCA 1T6DA 1DK3A 2E5LK 4WQ4C 5EOYA 2BQ3A 4CJ7A 1BPXA 4K41A 5CY4A 1Q81O 1ZQFA 9ICSA 1NK8A 4RW4A 3AN1A 5HMMA 4CF3A 3W3DA 2MRLA 1UPHA 1OVQA 5AKYA 5J2FA 4TUSA 3CCMN 3T69A 1ZBLA 3AO1A 1PVPA 4PHDA 2OPPA 2LYBA 1DEJA 4J9OA 4AHCA 1VAZA 4V19S 1UA1A 3AO2A 2F1IA 5AKGA 4ECUA 2ZIXA 4Y2SA 1A6SA 3QU9A 2YJFA 5BPMA 2P9PB 2OPQA 2KIWA 4CJ3A 5BRFA 2JH1A 4K8XA 3HYFA 2WFAA 4I2EA 4H5TA 4LFAK 4JKGB 3HJFA 3TADA 4HAIA 1XSNA 4RQ1A 4BDPA 4HWIA 3CMEN 2O8EA 3OS0A 1MA7A 2YB1A 3JS6A 2HCFA 3ICXA 2ZGZA 3NF7A 4DR1K 3IRXA 5HLFA 3QNNA 4CJPA 2ZIWA 4CE6A 4C23A 4FW1A 2AJQA 3DXMB 5BN8A 1COKA 3J7AP 3O1BA 3F9MA 5ALFA 4IG0A 4DTMA 2R18A 2ODGA 8ICJA 4H0PA 5AQIA 5ALMA 5GAEP 1JALA 2P9NB 2F8TA 1IXRA 3CCJN 4CGJA 4AM6A 5BOLA 1FJGK 4Y2PA 2P9LA 4RUAA 3LP0A 4GFJA 3V6KA 2V7YA 3D2EA 1K73O 4UAZA 2OWOA 2LM1A 1VRUA 3PW2A 3ZCMA 3A0HU 2OXOA 3WXLA 3V7LA 7ICIA 2UXBK 2P9SB 5GADP 1H38A 3CCEN 2Y1JA 1YXQA 3HWTA 1KL9A 3ZDBA 1BU6O 1L8OA 1RDBA 3BS7A 5KRTA 2EAOA 4CD1A 1GLFO 1WSFA 7ICVA 3GG4A 4CBXA 4CIGA 2IIRA 4KHNA 3PW7A 3TI0A 8ICPA 3R9PA 1N48A 4UBCA 5AIBA 3C1YA 3O5BA 2RRDA 9ICMA 2KNJA 3LWLA 1VSEA 2EX3A 2P66A 2ZE2A 2BR0A 1GLDG 5JS2A 4E1JA 4US8A 1TV9A 3SBGA 4BG9A 1Z00A 1DTTA 3NFAA 4GV6A 1K5OA 3AVHA 2KE7A 4OJRA 3ZD8A 3B6PA 4R8UB 3RB3A 3L2VA 4UAVA 1SXEA 5J2CA 2YMMA 3C0BA 2R8JA 4OPAA 3ZEUA 1QQOA 4MF8A 4B3SK 4BC3A 3M9NB 1GLLO 3ZSVA 2BUPA 1JMSA 4RQNA 4DL6A 3RB0A 1P90A 3QB0A 4HUFA 1MWKA 3OSPA 4BX9C 4J03A 4YMNA 1TUUA 4CF5A 1AQ6A 3LL3A 4PH5A 5KT3A 3A5MC 2O8FA 1GLBG 4JRPA 3QDKA 5CR4A 7ICLA 3EE9A 5ALVA 4QZFA 3V9XA 2FF3B 2DFEA 2PYJA 3KHLA 4EBEA 5M1KA 3MDAA 3MN5A 3RAXA 4ED0A 3RJGA 2QARA 2A41A 3N4PA 3T79A 3ISNC 3VC8A 3QFPA 4EEYA 4R5PA 3K57A 4IFVA 4I28A 1QQ6A 1DTQA 2HBLA 4KLMA 5EOZA 4DSJA 5CWRA 3O6WA 1SB3C 3TAPA 5KL1B 1IO2A 5BRDA 1NNLA 5SZTA 3I1YA 1ZRNA 3CD6N 1Z19A 4G9BA 3WXIA 4M3WA 5JUMA 1KXPA 5KTQA 4H5VA 3ZDAA 4NXMK 3K1RB 1JJ2M 2BHNA 3EL2A 3KK1A 4RQ3A 3QFUA 4E7HA 1WG8A 5F9NA 1ASVA 2FI1A 1JCGA 4W5NA 4FYDA 1VRTA 3OYMA 3EUB2 4AHVA 1QE1A 2W8KA 4GY2B 4M6WB 4P2HA 4IQUA 2WOMA 4WFNL 1U48A 2KV2A 4BE1A 2KHQA 4AYBC 2G8KA 2F77X 1NNEA 3CM5A 2VG7A 3C5GA 4YDUA 3SV4A 4IJNA 1G99A 1O03A 1MQ2A 1Q8IA 3K5MA 4Q8FA 4PZOA 4B3MK 4L8RB 1RDDA 4NXNK 1S1UA 2FXUA 2BTFA 2KKVA 2HNZA 2VGMA 3IUCA 4FZXC 3ETRA 1SWWA 1C20A 3F2CA 2IOCA 2VWKA 4C4SA 4FL9A 1BPDA 2N1RA 1XO0A 5DM6L 3HRGA 3K4GA 3FZMA 1GLAG 1YHQN 4BRPA 5AKJA 2IVNA 1YZ7A 3B6OA 1SS6A 2F8SA 4TQSA 2QLTA 4EBCA 2QM1A 5KFVA 1JLAA 3JPTA 1FW6A 3NH1A 1I39A 4DCHA 1C0UA 4PUOA 3WK4A 3VEOA 3EE8A 1PVQA 4BR9A 3BQ2A 1U45A 2OA8A 2P9IB 3VF2A 4O3PA 4ACOA 1QQNA 4BQZA 5C2DA 2ZJ8A 5ALRA 3L2RA 4NLGA 1ZYQA 3DLRA 3VQ5A 2P51A 5AKLA 1RTDA 1VDVA 4FJ5A 3CMAN 3H0LB 1KBUA 4CEEA 1WSEA 3SI6A 5ALWA 4XEIA 4DR3K 4HYKA 3H8WA 1EWRA 3C6UA 4CZMA 3R8EA 4RWTA 4I2CA 5KG5A 3T1AA 5AM2A 5GIPA 1WSHA 1FO4A 5KL8B 4O5KA 2K60A 2ESEA 2HHTA 4LVSA 3E01A 2A3VA 4OJ6A 2YCHA 3U4LA 4R64A 3UKRB 2LMRA 3H08A 1VHXA 3FFIA 1E3MA 4JWMA 3F73A 3TSUA 3R3LA 3E0FA 1KTQA 3Q8QB 5EVZA 4UB2A 1NK4A 3ETLA 3WXMB 3M5RA 5AZJB 1HRHA 4YFUA 5GTHU 3GQCA 2FBYA 2BDPA 1JXEA 1A5VA 1V4SA 2PYLA 4IKFA 4KLGA 3C2KA 3P4IA 3UMGA 4MFAA 1N8RO 3L4PA 5ALJA 1NOYA 2UUCK 4FVUA 3H4DA 2PFPA 1U2VB 4B1YB 1E4FT 3M1YA 2NRHA 1S97A 1Z3EB 3KD3A 1ZQHA 4BRIA 1RCHA 3QEXA 1QVFM 2O8BB 4QIWC 1A0PA 2LYAA 5JVGL 1QS4A 2ALZA 3QU2A 4OJOA 4U7CA 1RILA 1A5WA 4Y0WA 5KI6A 1ZQYA 1JX4A 4QS7A 5AQWA 2VWBA 3GOIA 2Z1IA 1L5UA 2F9TA 4GC6A 1ATRA 1RBSA 7ICFA 3H45C 3VQCA 4CHPA 4CHOA 2VQFK 3TAFA 1N34K 4DL3A 3OS1A 4F9OA 4LF5K 3PY8A 3FYHA 1NOMA 2RKIA 3QU7A 3HW8A 3P83D 4QZIA 3PSPA 5CHIA 3VA0A 4OX9K 1KQSM 4F50A 2WAQF 2GUPA 5D49A 3J80O 3TKAA 1QTMA 2F2AB 3VQEA 3PSIA 1XMOK 3CP8A 3Q8PB 3PV8A 4BR5A 5L1LA 4C8KA 4IOAL 4W5RA 4B8AB 5AI4A 1B9DA 2A3ZA 2P9UA 3LANA 4AHTA 5AZIA 1J53A 5AQOA 4KAZA 1J5EK 2EDUA 4CEZA 8ICCA 1HEKA 3P38A 2NO5A 4OD0A 5TISU 4GC7A 1NK9A 5AQZA 2XHBA 4GLXA 2HHHK 4DTNA 1N6QA 2QB0B 2PFOA 4CDGA 1IV0A 4QZCA 3DRPA 4J2DA 1VJ5A 5L1KA 3LP3A 3OBYA 4Y2VA 5KT5A 4FWQA 3THYA 1X6IA 4Z6EA 3G6YA 1ECWA 4U6PA 4I29A 4JHDB 4ED7A 1HKBA 4HVJA 2P5GA 3OHRA 3NGYA 1RTIA 1EQYA 5AQNA 3BEXA 3ZLJA 1N2XA 4UAWA 2KHVA 4XRHA 4Y2RA 4A5AA 4A8EA 3V6JA 3PX4A 5AI6A 4K4HA 1JLGA 4XH5A 3HKZC 4JK1A 4JV2A 1JLQA 3V9ZA 5LMNK 1BQMA 3MCPA 4ED6A 5J0XA 3RVCA 2HHQA 1Z1VA 4BRGA 1VSHA 2IS3A 2I7NA 3T5LA 4BRQA 1FFVA 4B9NA 2LM4A 3CG7A 4LFCK 2FMQA 5J0OA 4BDZA 5HBMA 5KFBA 4KLEA 4WQ5C 1ILYA 3CETA 4FWRA 3FZFA 3UKUB 3L2UA 1J97A 3P39A 4ID5A 4H8KA 3N28A 4I2PA 3W0LA 1U04A 4E1NA 3IN5A 5HR7A 1VQ4N 3OYFA 2R8GA 3SQ1A 4Z4EA 3AO3A 3ZSQA 3GV8B 3C2LA 2YI1A 3VESA 1Y64A 5E84A 4PY5A 4F2RA 3MCAB 3SPYA 3RMDA 3KLFA 2KW4A 4DOAA 4CK1A 2WC9A 3SCXA 5I42A 2E1YA 1VQKN 3PX6A 8ICWA 1SKSA 4IDHA 4DQ8A 4JV1A 1FKPA 3Q8SB 3OYIA 2OPSA 2HOIA 1TK5A 4IZ9A 2QXFA 2BCVA 4RNMA 1BGXT 2K8AA 2QA4N 4DR5K 1S1XA 5AK6A 3L8BA 1SGGA 3D0PA 4ECQA 1YI2N 8ICBA 2JV3A 4OJ5A 3SAFA 2WF9A 1BA1A 4BRHA 4UW9A 3JYTA 3HPHA 3ZDEA 1J9AA 2D0PA 1LKYB 2ZF5O 2YMQA 1Z4NA 4RQMA 4DG1A 1MDUB 3VQDA 4M3YA 4CZGA 1VQPN 1LVHA 3FGUA 3T5JA 3E9LA 3OJUA 2RHFA 4KLQA 1KFDA 4RT3A 4GVEA 4BRAA 1D4XA 4FLUA 4LF8K 3NCIA 4CF4A 3SJJA 1DGJA 2O8CA 2W43A 4ICLA 2ZWHA 5AQTA 4A2BA 3C6AA 3GZFA 1L7NA 2JH7A 2R7YA 3H4BA 3OY9A 1VK0A 1SV4A 3S3MA 1T3QA 2JHDA 4M9LA 2I7PA 4JI1K 3ZSRA 4FWKA 3SUNA 4FXDA 3VGKA 4AF1A 2WB1F 2FMSA 4JKCA 3A0IX 3QU4A 5IILA 4FLYA 2FLPA 1RBTA 1YUWA 4BG8A 2E2NA 4ID1A 3O1WA 3O08A 2KTQA 5HR6A 1S1WA 2YKMA 5DMRA 4Z0UA 5DG7A 2HBJA 2ISOA 3P31A 3V1QA 4QS9A 4Y2YA 1X6JA 2G8VA 3ULEB 1HNWK 3H6EA 5FPEA 5IT9O 1NGHA 4QZHA 4MDBA 4MDAA 4DHYA 3ATUA 5AQJA 2LKYA 5DKWA 3HL8A 3BUZB 3DLEA 4JV0A 3SMSA 2QWNA 4BWMA 1MC8A 4CCHA 5J2PA 4JB3A 5DBAA 4O5FA 4CJEA 3EKSA 1YTAA 5KAFU 3VQ6A 1ATNA 3QEAZ 1QQMA 3F9KA 2XGQA 4J2BA 5J2BA 2B6GA 1WBDA 3AUOA 3E2EA 3VCBA 3LDQA 1TAUA 5KAIU 1Y88A 4GXKA
chains in the Genus database with same CATH topology
3GV5B 3EWAA 2RDIA 1ZQUA 4L3QA 3G71N 4YQWA 9ICCA 3DXKA 3ZETA 5F2RA 2RDJA 2GX9A 4BGBA 3MWTA 3G25A 4KBOA 5KT4A 5CB1A 1C0FA 2F7TA 4DQQA 1ZQRA 3MN9A 3DAWA 5J2EA 3ENBA 3RH5A 3HI0A 1O13A 4BROA 3HP6A 5HP4A 5D46A 4QZ9A 3RSEA 4FOEA 2J6TA 4KLSA 2VA8A 1W2BM 2MAXA 2IMWP 7ICEA 4F4XA 4R66A 5KFRA 3ENHA 1ZQBA 5KQ8A 2V52B 1YAGA 4ELUA 1MA9B 3SJHA 3V7KA 4RQ6A 8ICMA 5KFHA 1EO1A 4DFJA 3RJJA 2ZJRL 3N97B 3MR6A 5D4BA 4J9QA 1L3UA 1XWLA 2VANA 4BRNA 5IIIA 5LJVA 4ECRA 3MX5A 4RPZA 2BGWA 3FZHA 3PW0A 2XO7A 4NM2A 3OGUA 5KFIA 4I2BA 9ICRA 5AQFA 4CZLA 3G6XA 3SAGA 3TSPA 1DGKN 1NGFA 4NLCA 3HZ6A 2AA4A 2YHYA 5KFXA 2YHWA 3H8SA 5J2JA 4KLLA 2FSJA 3L6QA 4FWLA 4ED2A 4IEEA 1ZQWA 5C0YA 4BVOA 3EZ5A 4IRKA 2GTDA 3UXNA 5DLFA 2I9GA 3IHQB 4BXOB 3CJBA 4R65A 8ICQA 1S0MA 3TARA 1HJOA 4DEZA 2BKEA 4J9LA 1K8AO 1H1VA 4RQ4A 2W41A 2FMPA 2HSTA 4DB3A 1U49A 2FPLA 7ICJA 5DLGA 3OHAA 7ICPA 3DJCA 4ILHA 2QW9A 4ISEA 2C2EA 3RBDA 3PMLA 5KFNA 1GLCG 5C15A 4QZGA 1ZQDA 3BP8A 5GAGP 1NK7A 5JLHA 3MDCA 9ICTA 4I6MA 3KK7A 5J2HA 2Q0ZX 5KG7A 1S72N 1TAQA 1VQ7N 4JK7A 4FWPA 2CGLA 3K9KA 3PW4A 4ISFA 1B22A 2GWKA 1RZTA 3QZ7A 3H8JA 3I55N 5KFGA 4ECVA 1RYSA 2W9CA 5KFPA 3KTQA 4DOBA 4H0XB 4WFAL 4YCXA 1RXWA 2ASMA 2YX6A 4YP3A 5J0RA 1CUKA 5KG0A 4K25A 5DBBA 3S41A 3HTVA 4EAHD 4EZ9A 1ZQTA 4ELVA 4F92B 3O9SA 1ZQVA 4YOXA 2JZBB 2P9LB 4H0VB 2Q97A 3VTIA 4NO7A 4TQRA 1XO1A 1CEZA 2XCAA 4KLIA 1K8KB 4FOIA 3JPQA 3MK6A 3A5NC 1NWKA 4F4WA 3HT3A 2DPIA 5BR9A 3M8SA 3LM2A 4F93B 3D2FB 5M1PA 4DL5A 2XCPA 1C7YA 2I1QA 4F4KA 3CIPA 1XC3A 4PGYA 1ZQSA 3N4MB 3U8XA 5HHIA 1Z00B 2KZ3A 2MUTA 9ICVA 2KFZA 5EWFA 3EZWA 1HUXA 4NXZA 3C5FA 9ICPA 2UVVA 1T6CA 2BQRA 2WFBA 4M7YA 4YXMA 1DT9A 3E1YA 5AQMA 3J7ZO 4OPHA 3T5HA 2V9WA 1QSLA 4RQ8A 2KFNA 3UB5A 5BRHA 1UT8A 1A77A 2NRTA 1D8LA 4FBTA 3CXCM 1B43A 1BA0A 4A57A 1DKGD 5IIOA 3ZDDA 2BQUA 1SKRA 1KDHA 3CCVN 3QZ8A 4KLHA 4PPXA 4YR2A 3ZX0A 5E26A 3Q8LA 1X9SA 2IBKA 5DGBA 4F5NA 4PHEA 1XQSC 4MEXA 2NNWA 3VEYA 1TVAA 5DDMA 3RRHA 2P9PA 3IM1A 3FFKB 4YDUC 3I33A 5EXWA 2PI4A 4JKGA 2KKZA 2KN7A 2E2QA 5AQSA 3RJEA 5BPCA 2Q31A 3VETA 4RPYA 4A59A 5AQUA 1UT5A 3KVGA 2A1JA 3DXMA 4FSVA 4BC4A 1VQNN 2IVPA 4WYBA 1NKEA 4JD2A 1D9DA 4PHAA 2HMPA 1T7PA 3HOSA 2Q0RA 3UE5A 5DQHA 3WT0A 5AR0A 1X3MA 2HF3A 3D6RA 5AFUA 3GE1A 4EIAA 2DPNA 5KFTA 5J0TA 1SAZA 2FLOA 1QZ5A 2R8KA 3VEWA 2QXLA 5FPNA 4QZBA 3LK9A 1HUZA 3G6VA 3CCQN 4I2DA 1NGAA 2W40A 3AGRA 4I2AA 3T5KA 2DPJA 4R8UA 1TYQA 3CC2N 4H5NA 4YMMA 4O3QA 2W8LA 3CJ1A 1LB2B 4CZHA 3U9DA 3GV7B 4M63C 3ID8A 1LCUA 3JPSA 5KFCA 4KN4A 3CERA 4MEYA 1Q18A 1ZBSA 1SL1A 2JEJA 3VTHA 4R63A 3H3OB 3TANA 5KPRA 3Q8RB 4FWMA 3CQYA 5J2KA 3QBWA 2ZTDA 1BO5O 2ASPA 3O8MA 1S0NA 4BRKA 5KT7A 1YJNN 5KG4A 5KT6A 5J2GA 4DWIA 4QZEA 3TU5A 3GDXA 4H0OA 2P9UB 2ZUCA 1KD1O 2ASJA 1SKWA 3CJCA 1KRPA 4FWNA 4C8MA 3O80A 5DG9A 4RNOA 4O8KA 4M6WA 4M9HA 1NMDA 4NB4A 4EYHB 2QWRA 2QWOA 2FLNA 4ILJA 5M1NA 7ICSA 8ICFA 4BGAA 3HBTA 3I8BA 4B9LA 4PGQA 3OA9A 5KT2A 1C0GA 2KHOA 4C8LA 2OANA 3EPIA 1JCEA 1QZ6A 4F91B 1NLVA 4DF4A 2HOEA 2AP1A 4H0YB 2W9BA 2PAVA 5M1OA 3Q8KA 5KG2A 3H1QA 9ICKA 4YFKA 9ICEA 4ELTA 1YJ9N 4H0TB 1L3SA 2PFQA 4J9NA 2P9IA 2BPFA 2FPKA 5KFQA 4NY8A 4R79A 4DOCA 3O9UA 4XQ8A 3EO3A 2P9KB 3F2KA 5KPTA 2A5XA 4GXIA 5HL7L 5JVGL 3K9JA 4B1WB 3CCUN 4RQ0A 2C28A 3MABA 3RRGA 4DS4A 4KLDA 4F5RA 9ICOA 5KFEA 5HOOA 4QWEA 3SYZA 3AY9A 2E8AA 5KFAA 1NGBA 3VEXA 4QWBA 3A5OC 1NGDA 3QICA 3UKRA 1NBWA 9ICIA 4XUSA 1X9MA 2FLLA 4LZGA 3C1ZA 4DQRA 2FSKA 1SZPA 4O3RA 1HKGA 4ISGA 4YMOA 3TQ1A 1SZ2A 2C2RA 4CZEA 5EY4A 3VEZA 4RQ7A 2HW3A 2NRWA 9ICJA 4DFKA 4O0IA 9ICXA 5C2FA 3JPPA 2J4RA 4IO8A 2XGPA 4X5VA 4KLFA 4I2FA 3GFKB 1WCLA 2D0OA 1K9MO 2BPGA 3ZYYX 2ISPA 4B9QA 4GNIA 5J0YA 5M1FA 4DQSA 1ZQNA 3L4IA 7ICRA 3C7NB 4KH4A 5J0UA 1BOTO 3WQTA 3KHRA 8ICLA 2AGOA 4FS2A 1CZAN 2A6AA 3BDPA 3Q7CA 5C12A 4M04A 4IOXA 3C21A 1N56A 9ICBA 4ILGB 3RB6A 4IXCA 5DQGA 3SZ2A 4JN4A 3A5LC 4JKBA 2ZJQL 5FPMA 1NK5A 4M0AA 3CJAA 4WFBL 2NRVA 4JHDA 1KAYA 1Q7YO 4QW8A 8ICKA 2OTLN 4BRDA 4ED1A 5IINA 1VQ6N 3MMVA 9ICUA 4Q43A 1AROP 3OBWA 5H1SQ 4YR3A 2Q36A 3ISBA 1VQ5N 3MBYA 5CHGA 1NJWA 4YOYA 3CJ7A 2P6RA 1SQKA 1JCFA 8ICYA 4PHPA 5HHHA 3BQ1A 4FPAA 4CBUA 3C65A 4RCHA 3PW5A 2NRXA 2NLXA 4UBBA 5BREA 3UQ0A 3R1XA 4P4OA 4BC2A 4RQ5A 3CCSN 1NGCA 3HPOA 2F1HA 2ASDA 2R8HA 3V7JA 4I2HA 2ZTCA 5J0WA 3ISCA 1KLNA 1WCNA 4DL2A 9ICAA 1QVGM 3PIOL 3FE1A 1HKCA 3LDLA 3HM8A 3M3ZA 3IFRA 4BRMA 4I2IA 1MWMA 4JWNA 5J0QA 3MR3A 5IIMA 5KFJA 5AQPA 1XS9D 1QHAA 3MDQA 9ICNA 2KLAA 5HMLA 3RJHA 2DFLA 2W9AA 3LM9A 4P4MA 4B9MA 3TSQA 1T4GA 4BRFA 3FR0A 3CPEA 4AM7A 1BUPA 3O4WA 2H5XA 1XUPO 1KAXA 1JXLA 2H3GX 2W9MA 3ENOA 3T3FA 2V7ZA 1GLEG 3TAQA 3H7IA 4FWSA 1KFTA 1S76D 3L4QA 4QZAA 3EPGA 3ULEA 4YXJA 1YVNA 1HLUA 2E20A 3M6GA 4UB4A 4C1NK 3MX2A 4IEIA 2VCPA 3KHYA 3EN9A 2R8IA 2ATLA 2OTJN 2CH5A 3LDPA 1ZJNA 1X3NA 3JPNA 4DQPA 1S0VA 4PKHA 1TFRA 3O9RA 2QEXN 3MN6A 1ZQAA 3RH4A 3SAHA 3B0XA 1J6ZA 5L1IA 5CA7A 4I6MB 3UXOA 3JPRA 3H1VX 1NM1A 2Q2RA 7ICTA 4F2SA 4C1NI 4BVPA 4IO9L 4JKDA 2XY6A 2Y1IA 5AQRA 2ZJPL 1R59O 4G9ZA 5J29A 2UYTA 4EHTA 5TZVA 2J6SA 1BDGA 5KQDA 4TURA 1VQ8N 5J2AA 1YF5L 3GL1A 4YD1A 3RJIA 3VENA 3EYZA 2QWLA 1HX1A 1ZQXA 8ICZA 3N4QA 4F4YA 4B1VA 5KFWA 5BOMA 1ZQQA 1T44A 1BPEA 1NGJA 1RDWX 2PBDA 4DL7A 4CZJA 1M1KO 4ECYA 5C5JA 4P4PA 2WTFA 1U9LA 4F8RA 4NLBA 1A76A 3QE9Y 4XH1A 3LDNA 3NMUA 4IJAA 1S22A 2BPCA 3WQUA 3WEEA 3JXUA 2ITMA 3TTCA 5FPDA 4J9MA 1MQ3A 5KFDA 3I56N 3B0YA 2XY7A 4YOWA 4CBWA 5AFUH 5CR0A 3RB4A 3GBTA 4J9KA 3RJKA 3ID6A 1U6ZA 5GIOA 3LDOA 2CGKA 4BGDA 2ZUBA 4H5WA 2QI2A 4BXOA 2PI5A 1W97L 4K4GA 4DKWA 2HHSA 2HF4A 2HVIA 4OO1J 3V72A 7ICUA 4JKHA 1LV5A 3UXPA 5KFUA 3D2EB 4EBDA 3GILA 3THVA 2VA2A 5B8HA 2HHXA 4BY9C 5AQKA 1ZETA 3OHBA 1BPYA 2KZZA 3WUHA 4F5PA 8ICTA 3G4SN 3WXKA 3TTFA 4A2AA 3MFIA 4NLZA 2NRRA 4Z6CA 1K1SA 5BPNA 1DOQA 4KLTA 1EXNA 3CC7N 3ZEUB 5KFZA 1TK8A 5KFFA 3SLCA 4K42A 5GINA 5F1XA 5HNKA 3O9TA 3ZX3A 3AARA 2V4RA 3GIJA 1P8ZA 2E88A 5DB8A 3UQ2A 4B1ZA 4LC9B 3AU2A 1ESVA 3ATVA 2A1JB 5DG8A 3SV3A 4IRCA 4WQ4A 1X9JA 4JD2B 5GAHP 4DSLA 3FLCO 2JZBA 2F1JA 2HVHA 4RT2A 4KLJA 4B9VA 3RJFA 3E9PA 3EKUA 3H46O 3LWMA 3RBEA 1U4BA 1K8KA 3FZLA 2GWJA 4YORA 4A61A 3PVXA 4FPBA 5DQIA 3VMFB 2HBMA 1VQ9N 2ZJAA 1VQLN 3J8AA 1NK0A 5JICA 3QMLA 4J9PA 5AQGA 4IQWA 2ZTEA 4UQGA 3D2FA 4RU9A 3NTUA 1ZQLA 3PR5B 1S10A 1XSPA 8ICGA 5JMVA 3MFHA 3V6HA 1RPLA 2A42A 2LYHA 1NGGA 1XSLA 1X2IA 4Q44A 4DS5A 4QWDA 3VERA 1TYQB 4HTLA 3WXJA 2PFNA 5I9EB 2RE2A 3A8YA 4I2GA 9ICHA 3SMPA 7ICMA 3E66A 4MFFA 4IWVA 3RR7A 4B9UA 5DB9A 3HSCA 2FSNA 2VA3A 4KLOA 3OSNA 1KC8O 4JEPA 1ZQEA 2P9NA 3GDQA 3RR8A 5JLFA 1L3VA 1BG3A 5ADXA 1GLJO 1VQON 1S0OA 1JIHA 7ICGA 3Q7BA 4FWOA 4C8NA 3VF6A 4KH5A 2P9SA 3AGKA 3EW9A 3CCRN 2BCSA 1S3XA 4IRDA 2VGNA 4Z6FA 1BVSA 1HUOA 4YG2A 2E2OA 4RPXA 1ZQPA 5EWEA 4H5RA 4WF9L 3OW2M 3O9QA 3NVMA 5AQVA 4A62A 4RUCA 2PXIA 4B1UB 1V4TA 4RTFD 5KFSA 4KN7A 4BRLA 5MLCQ 4DLGA 3KZBA 1L3TA 4J9RA 3AU6A 1OVYA 3PMNA 1JN3A 5TKWA 4WCEL 5DDYA 2GELA 4A5BA 5DM7L 5CE3A 4QZDA 2D4WA 8ICEA 4CZFA 1NJZA 3BF1A 2E2PA 4ECWA 1IG8A 4O5CA 7ICKA 2W9BB 2NZTA 4QS8A 2ASLA 1SL0A 3FZKA 4UY8O 4DSIA 4F4ZA 3AAPA 4J8FA 4NM1A 2YJEA 2HHWA 1NK6A 4M7XA 5DGAA 5AZIB 3B8AX 1BWFO 4J9SA 1ZQZA 4QW9A 1U47A 4KITB 9ICQA 4PKGA 4JKAA 4RQ2A 9ICGA 4RNNA 4I2JA 2CGJA 4ECZA 4XH4A 4GXJA 2NRZA 4IQTA 2UVWA 2AU0A 3AAQA 3MN7A 3PX0A 4Q45A 3MR2A 3RAQA 3CF5L 4Z6DA 4BR2A 3BF3A 3CCLN 4C8OA 1OKJA 1XC9A 1ZQMA 3Q8MA 2JWKA 2UVRA 3GIIA 1NGEA 4F5OA 1M90O 5BN9A 2F9WA 2P6UA 4DLEA 3KHGA 3IDHA 5CP2A 2WUSA 1VQMN 4YR0A 4FO6A 4IOCL 1KFSA 1BPBA 1KAZA 4M47A 1COOA 1HJPA 1NGIA 4B9TA 2C22A 5KG1A 3C23A 5ELZA 2AQ0A 3ISDA 2BCRA 1NJXA 1NJIO 2ZJ5A 2QWMA 2QTDA 4UB1A 3PIPL 4DO9A 4M9NA 3BJYA 3TTDA 4O5EA 4EFHA 2HBKA 8ICIA 1TK0A 3L0QA 4IFEA 3M1FA 3RH6A 3M9OB 2IA6A 5CJ7A 4FS1A 3DLLL 5AZJA 5KFOA 5AQLA 5J2IA 3U9ZA 4M9JA 4K43A 5JVHL 4JAXA 1U2VA 8ICRA 1UA0A 3SBTA 4KH6A 4M9GA 8ICXA 3PO4A 4YD2A 4M2YA 4UAYA 4FO0A 1PZNA 4DSFA 2BH1A 4QWAA 1DGSA 1ZXOA 4BWJA 3VPZA 3NVKA 2M9NA 3JPOA 2HHUA 3VEVA 2JEGA 1ZJMA 2EWSA 5F0XA 4BR4A 5DB7A 4RZRA 8ICUA 1V9PA 4O3NA 1T8EA 1Q86O 2P9KA 1KSPA 1ATSA 2AQ4A 2E1ZA 4IQVA 2J6UA 3SI8A 2IHNA 3CQXA 2XC9A 9ICLA 5J2DA 2A40A 5EX5A 1BPZA 3IMXA 4PGXA 3MGIA 4KTQA 3G6EN 1QSYA 4YVZA 1D9FA 7ICHA 2YHXA 3VOVA 3RTVA 3DXKB 3ZETB 4CZIA 2CH6A 2ASOA 4JK9A 4Q8EA 4BC5A 3E9OA 2IHMA 3QEBZ 4EZ6A 1QSSA 5C10A 3CI5A 2QWQA 5BPLA 3PLAA 5F9LA 4BR0A 4JNEA 4WQ5A 4IR9A 3R6MA 1HPMA 2FF6A 3UKUA 1ZQKA 3RSEB 1LOTB 4K4IA 3H3NO 3PR4A 4BQLA 4ECSA 1TKDA 2AGQA 3C7NA 3DWLA 4I27A 3VGMA 5KFYA 2AGPA 5KPZA 5AQYA 5KG3A 2XY5A 1T3NA 7ICNA 1SL2A 2JWLA 3KWIA 5KFKA 4DQIA 3D7EO 2C2DA 4BRCA 4DFMA 1RXVA 3CC4N 4ECXA 8ICNA 4PL8A 3BQTA 3KWGA 5KFLA 2Q0UA 3FDSA 1ZQGA 3CJ9A 5IIJA 5IIKA 5L9XA 3ZX2A 1MSWD 4TUQA 3VGLA 3CPWM 2FPMA 9ICWA 1YITN 4U67L 5L1JA 1IJJA 1IM4A 3PO5A 4QWCA 2QWPA 3ZD9A 2BCUA 3MR5A 5DB6A 2PFUA 3GIMA 2GWSA 3IKMA 1Z6RA 5M1QA 4MO5A 4BREA 4YOUA 4ZH4A 3LDAA 1RYRA 1WUAA 1N8RO 2GEMA 1ZQIA 1T3VA 1TUYA 4CZKA 2JEIA 1D8YA 2KZMA 3UPQA 4GV3A 2V4QA 3BQ0A 4Z94A 4QZ8A 4E0DA 4NLNA 3H40A 4PHTX 4ED8A 4G3IA 2JEFA 7ICOA 1NKCA 3MWPA 4IR1A 3QBXA 3HX0A 5KFMA 4H03B 4MF2A 1Z05A 4JKFA 8ICHA 3TPQA 4JUZA 3WEEB 5EWGA 8ICOA 3CHWA 4EHUA 4YOVA 3M8RA 3ORYA 4PL7A 4YOTA 5DBCA 4MLHA 3C2MA 3VF4A 2HHVA 2W9CB 1X9WA 2RHKA 4F5QA 4O3SA 4DSKA 4O9MA 4O8UA 4UB3A 3C6HA 4BR7A 2VYPA 5J0SA 4DSEA 4DF8A 2ZGYA 4KLUA 4YN4A 1NKBA 1KEJA 3ZDCA 1ZC6A 5AQHA 3GIKA 1S77D 3NGDA 3TFSA 4XA5A 4UB5A 4JKEA