2NRZA

Crystal structure of the c-terminal half of uvrc bound to its catalytic divalent cation
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrzA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrzA01
4I2JA 2XCAA 9ICXA 4DL7A 4GXJA 3C2MA 4PHDA 1NJWA 4B9SA 1KEJA 4XA5A 2F1HA 4GXIA 1SL0A 7ICQA 4TQSA 5HP4A 5J0UA 9ICMA 5D49A 2Y1IA 2KFZA 2B21A 4UB5A 5D46A 5J0SA 4R66A 2MAXA 3HT3A 5KFBA 3GIMA 4RQ5A 4DL2A 5L1JA 4M6WA 4IRCA 1ZQBA 4J9RA 4F2SA 4XQ8A 4YMNA 3EYZA 5KFPA 1ZQKA 5IIKA 4O3QA 2F1IA 4Z6EA 4DL4A 3H8JA 1LV5A 1ZQVA 3TFRA 3OSPA 9ICOA 2FPKA 1XSLA 3B0YA 2VANA 5L1LA 3V6KA 3NGDA 2ASLA 4R63A 1MQ3A 3UXOA 3KHHA 4M47A 4O5KA 4YXJA 4RZRA 4UB1A 1MQ2A 1C7YA 5BOMA 1BPYA 5CA7A 1N56A 2C2DA 5KT7A 5CWRA 1ZQLA 4MFFA 7ICHA 3PMNA 4JK1A 2W8KA 3KHRA 4UB4A 5DQHA 3LK9A 3PV8A 2PI5A 4QZEA 9ICGA 3C65A 1ZYQA 8ICUA 4J9NA 5EWFA 1S77D 4JUZA 4ECQA 3JPSA 4R65A 1S9FA 5DBBA 4I2AA 2HHWA 4R8UB 2BPCA 5J2IA 3HX0A 3Q8SB 3RBDA 1EXNA 5DG9A 3SYZA 4RUAA 5DGAA 1DOQA 4K4HA 3RJKA 3MGHA 4FBTA 5J0OA 5J2JA 1HUZA 4DSIA 9ICAA 2KTQA 5HMLA 3IHQB 1KDHA 1XWLA 1U45A 3MFHA 3UQ0A 1QSLA 4UB2A 2HHQA 3ISBA 4YCXA 4DO9A 1S97A 5CP2A 4JWMA 4I2FA 5DLGA 2Y1JA 4MEXA 5KFIA 3PO4A 1TAQA 2BKEA 7ICGA 4RNOA 4ELUA 4M2YA 5BOLA 2R8IA 3THVA 4PPXA 2J6SA 2ALZA 5J2BA 1H38A 3KHLA 4P4OA 2VA8A 1COOA 1WCLA 4DLEA 4MFCA 4RQ2A 4KMUA 4K4IA 5DDMA 1D8LA 4ECRA 3C2LA 1NJXA 1ZQFA 4YG2A 4ED8A 5KFHA 1SL2A 7ICIA 1UA1A 2AGQA 5KT4A 3EPIA 2C2RA 2KZMA 7ICRA 1ZQWA 3ETLA 1U9LA 3H8SA 2AQ4A 2R8KA 4KLMA 5J2EA 1NK9A 5J0WA 5KFMA 3C5GA 5EOZA 4M9HA 3SV4A 2BQUA 4YP3A 4Q44A 2DPIA 5C5JA 3PW5A 4EYHB 5KFEA 2AU0A 3GV8B 1ZQQA 4DQSA 4KTQA 5KFQA 5KFTA 4UBBA 3SI8A 3EPGA 4RT2A 1X9MA 1XU4A 2NRWA 5KG3A 3H4DA 4J9PA 1ZQDA 1NK4A 2A1JB 2P6RA 4B9UA 5J0XA 8ICQA 4P2HA 4EZ9A 8ICIA 4QWCA 2FLPA 4PH5A 5DB9A 2ZUCA 3OJUA 2C2EA 1S0NA 4KLSA 3BQ0A 4B9LA 5J0QA 8ICTA 2FPLA 3LWMA 3QEBZ 4BDPA 8ICGA 5J2DA 5CJ7A 2W9BA 3RRHA 1KFTA 4TUSA 1SZPA 3PX4A 5HHIA 5KFWA 4YN4A 5KT2A 1NKBA 3TFSA 4KLQA 1RZTA 3UXNA 5DDYA 2XCPA 5J2CA 3PMLA 1N48A 2KZZA 1UA0A 4O3RA 9ICEA 4DFPA 1S0VA 1IXRA 1QSSA 4UB3A 4ECWA 4BXOB 3ZD9A 3M9OB 1WCNA 3MDCA 3AUOA 3K4GA 4J9OA 4ED0A 3PY8A 2BR0A 2NRXA 4J9SA 2A1JA 2ZTDA 5KFRA 4RU9A 4YR2A 2NRZA 1D8YA 3MR5A 4G3IA 4DSFA 8ICHA 4YMMA 1QLNA 4DS5A 4E0DA 1A77A 3M8RA 4DSJA 9ICKA 2PFQA 4FS1A 5KFFA 7ICFA 9ICHA 3T5KA 1D9FA 3ORYA 8ICVA 1B43A 3MFIA 3PNCA 1S0OA 4KLJA 7ICVA 4ED3A 1HUOA 1KRPA 4NLGA 2PFOA 2BGWA 1A76A 4Z6CA 4NLKA 4RQ0A 5KT6A 4F92B 8ICJA 2JEJA 2PFNA 1BPBA 4F91B 3H8WA 5KTQA 2BDPA 4QZCA 4B9VA 9ICQA 2V4QA 3GDXA 1XO1A 4NM2A 2FMQA 1XSNA 3V6JA 2KFNA 4KN7A 2PXIA 4Q45A 2XY6A 4BXOA 4QWDA 5KT3A 1X9SA 5IINA 3ZDCA 4O5EA 3PR4A 3ISCA 3G6XA 4XUSA 5KG0A 4RQ6A 3GQCA 1ZQPA 3MR2A 4LZGA 7ICTA 4GC7A 4NLNA 3RH4A 3M8SA 8ICWA 1SKRA 3K75D 4DLGA 4TUPA 4K4GA 3UQ2A 8ICSA 4DSKA 1JIHA 3Q8PB 3BJYA 3PX0A 2BHNA 2ASDA 1L3TA 1RPLA 4YD1A 4F5OA 4YXMA 5KFDA 4M9GA 4IQWA 1SL1A 4LVSA 4TUQA 5DB6A 4NM1A 1XSPA 5L1KA 5KFOA 4M9LA 4KLOA 2AJQA 4ED7A 2AGPA 4DQRA 5KFJA 1NOMA 5J2GA 4RQ3A 4ED2A 1JXLA 3BQTA 4NY8A 4DQQA 4DWIA 4EEYA 1V9PA 4EBDA 3GIIA 5L1IA 4J9QA 9ICSA 4PGYA 3V7LA 4UAWA 9ICWA 4P4MA 3PW0A 4UAYA 1RYSA 2HVHA 2P66A 1MC8A 4DL3A 5KG6A 1S10A 4J9KA 1ZQTA 4ED6A 4J9LA 8ICZA 3BDPA 3RJIA 3JPTA 1NK0A 3NTUA 8ICYA 2JEFA 4KLDA 4J9MA 3KHGA 7ICEA 9ICNA 4RQ8A 1ZQUA 4BWMA 2DFLA 2ZTCA 5KFXA 3UXPA 3T5LA 2R8GA 4KITB 3OGUA 2XY5A 4F5NA 4MEYA 4KLEA 5CR0A 1T8EA 2JEGA 5HNKA 1ZQEA 3RAXA 1UT8A 4C8NA 4QWAA 2F1JA 5D4BA 3Q8QB 4Z6FA 2NRRA 5BPCA 4EBEA 4JV2A 5F9LA 2RDIA 4BWJA 4R8UA 1QTMA 9ICIA 5DQIA 2BQ3A 4MF8A 4I2IA 3FYHA 7ICLA 5KFVA 1ZQHA 5IIJA 1NK5A 1ZQXA 4O3OA 5DB7A 3UPQA 5DB8A 2JZBB 7ICNA 3H7IA 3G6VA 3OSNA 5KFKA 2RDJA 3N4MB 1XS9D 1L3UA 4KLHA 3AU6A 9ICPA 8ICAA 5DGBA 4MFAA 3RH6A 2ISOA 2UVRA 7ICOA 4TURA 4YFKA 3PR5B 3Q8LA 5KFAA 1HJPA 2UVUA 2XC9A 4UAZA 4R64A 1SKSA 4RPYA 3MR6A 7ICPA 2BPGA 4ECZA 2HW3A 9ICLA 1KSPA 4KLFA 2MUTB 3LWLA 5F9NA 2NRTA 4F93B 4KN4A 3C23A 4UBCA 4IQTA 4JV1A 4KLUA 3MABA 5DKWA 1JXEA 4O3NA 4HYKA 2FPMA 2Q0ZX 2ZUDA 4EBCA 1NK8A 4RPZA 5IILA 3QZ8A 1K1SA 2BCVA 4I2DA 4TQRA 1Z00B 3RB6A 5L9XA 4X5VA 1U48A 4RT3A 2JZBA 2XY7A 5KFGA 1AROP 2IHMA 4KLTA 2R8HA 4YMOA 4IQUA 3RJGA 2P6UA 3MGIA 2WTFA 5J29A 2HHUA 2FMSA 3B0XA 4PGQA 4QZFA 2ZJAA 5J2HA 3RJJA 3C2KA 4QWEA 3TAQA 3C21A 5JUMA 4QWBA 5CB1A 5TZVA 2M9NA 3JPQA 4F2RA 4O5CA 8ICOA 3SV3A 4I27A 2MUTA 5HHHA 3GIJA 1ZQSA 1X9WA 5J0TA 3GIKA 5KFSA 4QZAA 4PHEA 3OHBA 3JPRA 5KFNA 5DQGA 3PW4A 4I29A 1TKDA 4QZHA 3C1YA 4RNMA 5IIMA 4EZ6A 4ECUA 2NRVA 3GV5B 2KZ3A 2ASJA 4ECVA 1KFSA 3RR8A 3RH5A 3HWTA 3G6YA 3TARA 8ICBA 1Z00A 2ZTEA 5KFUA 1CEZA 3RAQA 5IIOA 5CHGA 2BPFA 1ZQOA 2BQRA 2BCSA 4FO6A 1JX4A 4PHPA 1Z3EB 3AU2A 2HHSA 2JEIA 5J0YA 4EYIB 2IHNA 4NLZA 4IR9A 4DEZA 4KLIA 3V7JA 4YD2A 3EZ5A 4F8RA 2V4RA 3RTVA 3H4BA 3OJSA 1ZQNA 3ZDBA 4F4ZA 4YR3A 2FLNA 1KFDA 4B9MA 4IQVA 4ELVA 5KG2A 4GLXA 1S76D 8ICCA 1NJZA 4PGXA 3OHAA 3M9NB 4F5RA 4I28A 1BGXT 4YQWA 1JMSA 2KN7A 4O9MA 1TVAA 2HHVA 4ECTA 2W8LA 4DSEA 2V9WA 3HP6A 3Q8KA 3Q8RB 2IMWP 1CUKA 1JN3A 8ICPA 3MBYA 4I2HA 4QZ8A 4I2EA 1UT5A 4RQ7A 3PO5A 1S0MA 1L3VA 8ICEA 9ICBA 1BPDA 9ICCA 1U47A 3V7KA 4DS4A 2BCQA 4DOBA 1SKWA 3RR7A 9ICJA 4FS2A 7ICJA 2I1QA 5DLFA 3PVXA 5KG1A 1NKEA 4B9TA 2HHXA 2J6UA 2ZUBA 4RPXA 2ISPA 3ISDA 4ECYA 1XC9A 1ZQIA 4DOAA 4DFMA 1T4GA 3GILA 3RJEA 2W9MA 4QZDA 1L5UA 3MDAA 1ZQMA 1ZQGA 1Y88A 5KFCA 1ZQCA 1T3NA 4F4KA 9ICUA 4DOCA 4GC6A 2HHTA 4QW9A 2H5XA 2FMPA 8ICKA 4F5PA 5KFYA 3RB0A 3QZ7A 2ZJ8A 4C8LA 2W9CB 4IRKA 9ICTA 1ZETA 1T7PA 9ICFA 8ICRA 4NXZA 1BPEA 1ZJMA 2DPJA 2I9GA 1NK6A 2GWSA 3RJFA 3EW9A 1RXWA 2PFPA 7ICSA 1ZQJA 3ZDEA 3PX6A 1TAUA 3JPPA 1RYRA 3T5HA 3ZDDA 4QZGA 2AQ0A 4PHAA 3M9MB 1K1QA 4DFKA 3TAPA 1BVSA 4F5QA 3IM1A 4ECSA 4BGDA 5KG4A 3RRGA 5HMMA 3SZ2A 3JPNA 5DBCA 4JWNA 4C8MA 5DG7A 4KLLA 8ICFA 4IRDA 3RJHA 8ICMA 4RUCA 4DQIA 4KLGA 4Q8EA 2W9AA 4C8OA 5J2AA 3HPOA 4I2CA 1TK8A 3E2EA 3QEAZ 1TV9A 2AGOA 1TK5A 2XGQA 4F3OA 1ZQAA 4DQPA 1D9DA 5IIIA 2W9CA 3Q8MA 3BQ1A 3TQ1A 1ZQZA 2W9BB 4C8KA 4DSLA 8ICNA 3PW2A 3N97B 1U4BA 1QSYA 1ZQYA 4DL6A 4M9NA 4RQ4A 4MF2A 4ECXA 4DFJA 4QZ9A 2VA2A 4M0AA 1KTQA 2IBKA 3C5FA 8ICXA 1PZNA 4FBUA 4DL5A 2LYHA 4Z6DA 1TK0A 3HW8A 4I2BA 1MSWD 4XRHA 7ICKA 1ZJNA 9ICVA 3GFKB 1BPXA 5J2FA 3EWAA 4DF4A 3TI0A 1U49A 2UVWA 4O3SA 4F4XA 3KTQA 4QW8A 1LB2B 3T3FA 4DF8A 1BPZA 5EWEA 4QZBA 2R8JA 7ICMA 1KLNA 3ZDAA 5J0PA 4ELTA 4O3PA 4F50A 3V72A 3BQ2A 2UVVA 7ICUA 5KFLA 3MR3A 3ZD8A 5KT5A 4F4YA 1L3SA 4UQGA 3PW7A 3RBEA 4CCHA 1IM4A 4YVZA 5EWGA 2XGPA 4F4WA 4B9NA 4Q8FA 1DGSA 2ZJ5A 2XO7A 3C1ZA 3GV7B 2ATLA 2FLLA 4YR0A 1RXVA 2J6TA 4M04A 2IA6A 5KFZA 3JPOA 2BCRA 4GXKA 2OWOA 5J2KA 1X2IA 2C22A 2VA3A 5J0RA 4QZIA 4M6WB 3T5JA 2C28A 4IR1A 4O0IA 2HVIA 9ICRA 5DBAA 1TFRA 2BCUA 1B22A 3LDAA 5KG7A 3QE9Y 8ICLA 4I2GA 4ED1A 4RQ1A 3RB3A 4M9JA 5DG8A 4P4PA 4Q43A 4RNNA 4LZDA 3V6HA 1NK7A 1NKCA 3TANA 3H40A 3FDSA 1ZQRA 3RB4A 5KG5A 2PI4A 1NJYA 4ZH4A 4JV0A
chains in the Genus database with same CATH superfamily
4I2JA 4OJRA 5LJWA 3QEIA 1O03A 2HNDA 3SAHA 3HJEA 4BR0A 4U67L 4XA5A 4FLZA 3PZPA 4K42A 5LL6Z 3ICXA 3L4IA 4DTRA 3VQ9A 5ALKA 2E2PA 5AQIA 5ALGA 9ICMA 2F9TA 1C0TA 5AKLA 2Y1IA 4FJ7A 1NNLA 5J0SA 4R66A 5EXWA 3IV6A 3GIMA 1RT4A 4JRQA 4RQ5A 4DL2A 5L1JA 3CQYA 3QERA 4M6WA 5AK4A 4DHYA 2KHQA 4J9RA 5G5HA 3EYZA 1ZQKA 4KX3A 4O3QA 3H8JA 1LV5A 5AFUH 4GW6A 4CHOA 3CC7N 3OSPA 2K8CB 1VSFA 2FPKA 1XSLA 2FF3B 3CETA 2VANA 4MO4A 5AKJA 1QZ6A 1FFVA 5AQYA 1MQ3A 3FLCO 1XNQK 1S5JA 3UXOA 5AQJA 4KPYA 4RZRA 4UB1A 4FW2A 5BOMA 3KD3A 4JI6K 1NI3A 2EZXA 1RBSA 1FW6A 4BC3A 3CFPA 2OZSA 3KHRA 3P4IA 1IBMK 3K0SA 3CJ9A 4NCBA 2YHXA 1OUQA 4J9NA 4LF6K 4ECQA 4O8UA 4WE1A 3O9RA 1S9FA 5CY4A 4I2AA 1QVGM 2FXUA 5AM5A 1BOTO 5J2IA 1SXEA 4RW9A 3HX0A 3Q8SB 3RBDA 1JALA 3GZFA 3DLLL 1TV6A 5DGAA 1Z19A 1DOQA 3VQCA 1FIQA 2CXYA 1IG8A 2YHWA 4BRLA 3RJKA 2OANA 4FBTA 1HUZA 1DEJA 2F7TA 3IHQB 2O8EA 3HSCA 1YUWA 3MFHA 1BIZA 3H1QA 3ISBA 4YCXA 3OVNA 2A19A 4LSNA 4UATA 5CP2A 2Y1JA 2XICA 4MEXA 1S1VA 2QWQA 1E3MA 2HDOA 2W11A 1TAQA 4BX9C 1P7DA 4FCYA 4OJPA 2MU2A 4RNOA 2KV2A 4M2YA 1DRGA 4JHDB 2J6SA 4BACA 3M8PA 1H38A 3MGVA 1VSJA 3SQ1A 4GMJB 2VA8A 3SMSA 1COOA 4DLEA 3TACB 4GV9A 5AI9A 4ECRA 3C2LA 3A8YA 3ZX2A 1VSEA 1SL2A 1NGBA 2BE2A 1JJ2M 2KZMA 4HCCA 3AVKA 3V81A 1ZQWA 3H8SA 5AK5A 2AQ4A 4KLMA 5J2EA 3L2VA 4FWNA 5AKZA 3TR8A 4QJFB 5KFEA 4DTXA 2O8CA 1Q3VA 1ZQQA 4DQSA 2IGIA 4FK0A 1IV0A 2OPRA 1NGEA 1Y64A 4RW6A 2NRWA 5KG3A 3WK4A 2B6AA 2FBVA 3B8AX 4XEIA 1YT3A 1OVQA 3RFAA 2A1JB 4EZ9A 5DB9A 3OJUA 4KLSA 3HPGA 2KMDA 3TTCA 1TUUA 3AM9A 2OYQA 2FPLA 5AIAA 4JD2A 4BDPA 4GNIA 5J2NA 4FM2A 2W9BA 3C28A 3D6RA 3BQ7A 1OH7A 4GKKK 4H03B 2V7YA 3S6JA 3LPUA 1SZPA 3PX4A 1NKBA 4HWIA 3OYFA 3TFSA 1Z05A 1C0UA 1RZTA 1UWBA 3UXNA 3TAMA 5DDYA 2XCPA 2EX3A 4MFBA 1NMNA 5CHIA 1S0VA 5CE3A 4UB3A 1GOBA 3LPTA 1WCNA 3AUOA 4DR6K 5ALDA 3EKUA 2NRXA 5FRMA 4F3TA 5KFRA 4DSFA 1HPMA 1WYGA 2W42A 1J9AA 1QLNA 3I56N 4DSJA 1MDUB 3SQ2A 2PFQA 2IVOA 4RW4A 4AHVA 2D0AA 4PWDA 2DGZA 3UIQA 2G5HB 1D5AA 5GAEP 4CF8A 5G5GA 3PNCA 2KQ2A 2ZE2A 7ICVA 2ZGZA 4NLKA 4QOZB 2VGNA 5KT6A 4F92B 1F21A 3FC4A 3NGYA 4M3RA 2BDPA 5HRSA 4WQ4A 3O1BA 1RTHA 2G06A 3VEOA 2BDUA 2V4QA 1XSNA 4C4TA 5TISU 3AGKA 2RKIA 4QWDA 4LFCK 3E58A 1TL1A 3O6WA 4F72A 4IG3A 3ISCA 3SMVA 4XUSA 5KG0A 3GQCA 1COKA 4LZGA 1E4FT 5I42A 4PUOA 1JLAA 3K75D 3CCVN 2DKZA 8ICSA 1JIHA 3BJYA 2ZIWA 3PX0A 2RLTA 4CIEA 2LBOA 2P9NA 1YITN 4JKHA 5AKKA 3U3YA 3S3NA 2WF6A 4FJ5A 1QQCA 1XSPA 2Q97A 5AICA 3I33A 2QB0B 4KLOA 4DV6K 4CF0A 2QKQA 2NYVA 5KL1B 4JN4A 4HUEA 4NYNA 4DQRA 2VCPA 2ZIUB 4ED2A 1SAZA 3BZKA 4DWIA 3HM9A 2E2OA 2AP1A 1RT7A 2LHTA 1NGCA 1BHLA 9ICSA 3IRXA 1RYUA 5GIPA 4KHSA 4GKJK 1JCFA 4JNEA 4IZ9A 3HVTA 5FLXO 1MC8A 1WUAA 4CJSA 4CHZA 5KG6A 2KE7A 2B5JA 4N56A 8ICZA 3BDPA 3KKAC 1NNEA 3KKAA 3M1FA 4KLDA 4X66K 3SK3A 1MA7A 4CESA 1ZQUA 4PY5A 2ZTCA 3VQBA 4BRGA 2HNZA 3ENHA 2R8GA 3DLHA 1JLQA 3OGUA 5LMNK 1K6YA 2KK0A 1HNXK 3MN5A 3RAXA 4LD0A 3QO9A 1DKGD 1N61A 5BPNA 4QWAA 1RDAA 4KO0A 3L3UA 2FSJA 2Q4TA 2NRRA 3L6QA 3EEQA 2HMIA 4B6JA 9ICIA 2ZJRL 1XHXA 3P1GA 3MN7A 5IIJA 1NK5A 1ZQXA 5DB8A 4Z4EA 1QQ7A 3H7IA 3L5KA 1L3UA 5KFKA 2BUPA 1YJNN 1XS9D 3IN5A 4KLHA 4IFEA 4W5RA 2QARB 1ATRA 2A42A 4JKGA 4MFAA 3D2SA 2W55A 4TURA 3PR5B 3Q8LA 2G8FA 5B8HA 2W43A 3OYKA 2WFAA 3HM8A 3LVWA 1KAZA 3J81j 2IDOA 4WQ5C 1U04A 2E5LK 4ECZA 4WQ5A 2RP5A 5CYQA 4OJOA 4KLFA 2MUTB 3E0FA 3LWLA 3EO3A 4M7XA 4FM0A 2QKBA 2WF7A 5AHXA 2A40A 2PMZF 4JHDA 5A0LA 4JV1A 4BRIA 3T1HK 3LDLA 1JXEA 4O3NA 2ZD1A 1NK8A 4FJ9A 5J2PA 4FJXA 4LY7A 5AQRA 3VEVA 2ZJQL 2BCVA 3OYLA 2IAJA 1Q86O 2G5IB 3NVVA 2EH9A 2OM6A 2JZBA 4RT3A 3V1RA 3NGZA 4BRPA 5KPTA 2A5XA 4YMOA 1K5OA 3RJGA 1C20A 1NGHA 3MGIA 1TUYA 3VERA 4C1NK 4JI5K 3IDHA 5HRPA 4B3RK 4OKKA 3UMGA 2PZSA 4JI7K 5CB1A 3HYFA 4JI4K 3DXMA 3SV3A 1WNSA 1B4FA 1RILA 3RMCA 1X9WA 4PHEA 1Q9XA 2P9PA 5DQGA 3R9KA 4I29A 5J8YA 4QZHA 3C1YA 4EZ6A 4N76A 4RQMA 1UAXA 3RR8A 3RH5A 3HWTA 4DR7K 4CEZA 5FRNA 2F3NA 5KFUA 3VEZA 5IIOA 4JRPA 3PLAA 4YOWA 4FZLA 2W3SA 2M0NA 2LYAA 4FO6A 1JX4A 2DKXA 2FC0A 1Z3EB 3AVCA 3O9UA 3QIPA 5AM0A 3G10A 4FWSA 4DEZA 1QZ5A 3ZDBA 4ELVA 4IQVA 5AQGA 5KG2A 1ZBFA 3VF2A 3SPZA 3RMAA 3G25A 1J5EK 4CZIA 4M3XA 2KN7A 4CF3A 2NO5A 4P0PB 2KJ5A 3DMJA 4Y2TA 1VQ5N 1CUKA 1JN3A 2X6NA 1VHXA 3PSFA 3T69A 4CK1A 4QZ8A 3O4QA 4RQ7A 1L3VA 1SV0C 2FF6A 3SAGA 5C24A 1SV0A 2AH5A 1EWQA 3VGMA 1EQYA 2Z1IA 1VK0A 1NKEA 5AKIA 4FJMA 1J53A 5KGXA 2HHXA 3FAHA 1U6ZA 4ISEA 4JKEA 5KI6A 3AVHA 4RPXA 2O6KA 1RFQA 5M1PA 4FZXC 2LSNA 4DFMA 2NV3A 3GILA 1RQLA 4MQ3A 3RJEA 3UMCA 1ZQMA 5E26A 3VOVA 9ICUA 3SI6A 2BGGA 1T3NA 4F4KA 2HHTA 1VQ6N 3T79A 4F5PA 1ZD3A 1PUZA 2GH1A 3QZ7A 3RB0A 3MAQA 9ICTA 3OS2A 5CEHA 1ZETA 2VYPA 4NXZA 3WKEA 4UB8U 1IJJA 2DPJA 4B1WB 2E1FA 4PZOA 3RJFA 2HBJA 4HTUA 5EE1A 3SUQA 1X66A 5ALFA 4Y2QA 7ICSA 1ZQJA 2JWLA 3A5LC 3CFOA 3OY9A 3ZDDA 4QZGA 3E9PA 1U2VB 1KQQA 3RVCA 2K4HA 3IM1A 1P90A 2NRHA 4ECSA 4BGDA 5KG4A 3RRGA 3MDQA 1N6QA 1JL2A 5AI6A 4NXMK 4Z4FA 5DBCA 3CC4N 5DG7A 5HRNA 1ZBLA 3ZETA 3OBWA 2ASOA 3RJHA 2K4EA 4Q8EA 3AV9A 5J2AA 4FWLA 2G8HA 3IS9A 2AGOA 2OH2A 2XGQA 4AH9A 3WNEA 2YJEA 4HCBA 1D9DA 4MDAA 2GTDA 2W9CA 1BO5O 4C8KA 3MEEA 2P5OA 3THWA 5JLFA 2E20A 2ESEA 1HKGA 5AQOA 3C29A 2EHGA 4H0OA 4DFJA 1LW0A 5CZ2A 5C2FA 1B0XA 1PZNA 3IRUA 4DL5A 3CCMN 3WQUA 1UOCA 1DXSA 4Z6DA 4EX6A 2VJ4A 3SAFA 2FSNA 5AQWA 1BUPA 3AVFA 4E7KA 4O3SA 2ODGA 3CYMA 4CJ3A 1IBKK 4OPAA 4YOYA 3CMAN 4QZBA 2R8JA 1QQ5A 3WK7A 4AYBC 4M42A 4ELTA 4O3PA 4F50A 1N60A 3V72A 7ICUA 3D2FB 5KFLA 1HUXA 3LANA 4B1XB 5KT5A 2E88A 3O3FA 1FFUA 5AI4A 5KL8B 4PQUA 1VQON 4CCHA 1IM4A 4NYFA 5EWGA 1T05A 4NB4A 5M1KA 2YMMA 4KX5A 2ATLA 3THXA 4C80A 4JI3K 4YR0A 3MXIA 1Q8IA 2IA6A 4FWRA 5I3UA 1RBTA 5J2KA 2RRDA 3DJCA 1X2IA 2VA3A 5J0RA 4IR1A 4M6WB 4JK9A 3VESA 2B4JA 4ID5A 4PA1A 2JH7A 3J7ZO 1KD1O 2OTLN 2UXCK 3ZT2A 4JLHA 1RTDA 5KG7A 3H6EA 3ATUA 4JS5A 1L8LA 4ED1A 3AA5X 1FKOA 1I94K 4Q43A 3IG1A 3M5RA 3HVRA 3V6HA 3H40A 1FKPA 3RB4A 3BY5A 4JKCA 1NJYA 4M3TA 5T14A 4JV0A 3EKSA 4CRXA 3U8XA 3O0FA 4GXJA 4FLTA 2YHAA 2A1RA 4OCZA 1KEJA 4AP9A 4H5TA 4PKHA 3LDSA 5HP4A 3DM2A 5JS2A 5D49A 2KFZA 2IOHA 5ALVA 4PL7A 1D4XA 2KKZA 5J1EA 2MAXA 2KLAA 2UUCK 5KGWA 4KHYA 2O8FA 3WNHA 4CJLA 4CZMA 4CGJA 1WSIA 2HBKA 1ZQBA 2Q2RA 4CECA 3TADC 5AIBA 3K9JA 4XQ8A 4CJVA 4M3ZA 3VQDA 3TADA 2YV0X 1N36K 1WAJA 4NCGA 2W03A 3TKAA 1BQNA 1I3AA 2I7NA 4DV3K 3TFRA 4TSXA 3L4PA 2L5YA 2JGUA 3E9LA 2PBDA 1HJRA 3DXKB 3NH0A 3CD6N 1MWMA 2ASLA 4R63A 3OTOK 4IO8A 1WBBA 4OX9K 3K9KA 5C25A 1ZRNA 4YXJA 3HPHA 4JAXA 4UAUA 2IOFK 5CA7A 5CR4A 2PFUA 4US9A 4ISGA 5AR0A 3P83D 1N62A 2WB1F 3OYNA 2W8KA 1F44A 1VSMA 1WLJA 4BRAA 1JROA 5BN9A 2PMZC 2PI5A 3HRGA 1TKXA 4YOTA 1KN5A 1QQOA 3UMBA 4ZTJA 1QVFM 1S77D 3C95A 2GUPA 2OPSA 4R65A 1KBUA 5DBBA 1X3NA 3ZCMA 2BPCA 4HUGA 1BU6O 4O55A 2NLXA 4O5BA 1EXNA 5DG9A 3SYZA 4CEEA 1LAWA 4X62K 3VEXA 3KK2A 3CPWM 3OW2M 1N5XA 3OYAA 4MO5A 5AQHA 3ZT3A 4E1MA 5FP0A 9ICAA 1C0FA 2PY5A 1MN8A 4LF8K 3UQ0A 1QSLA 2YMQA 2K8AA 1S97A 1CZAN 1W0HA 3IUCA 3PSIA 4JKBA 2WTUA 4I9QA 3TABA 1JXBA 5AM2A 3L2WA 1HEKA 2EZZA 4K25A 5GINA 2BKEA 3VETA 1J2NA 2XVTA 4ELUA 1NGDA 5BOLA 2R8IA 1VQ7N 1WG8A 2ALZA 4N5SA 4JD2B 5FPDA 1T3QA 4MLHA 4K4IA 5DDMA 1C6VA 3L2RA 5AQQA 4IOXA 4CGHA 3T1AA 3ULEB 4YG2A 5KFHA 7ICIA 1RT6A 4WFNL 3THYA 4GV3A 4IOAL 1UA1A 4DTUA 5KT4A 3ETLA 1U9LA 1NK9A 5J0WA 4M9HA 1N5WA 3I1YA 4YP3A 5HROA 3RMDA 2VIXA 3GU3A 1S6PA 2FE9A 4BRHA 1X9MA 5AM4A 3EPGA 1X9JA 2VGMA 3MXMA 2P6RA 3R9PA 5DM7L 4FLYA 4WF9L 4PH5A 4AM7A 2ZUCA 1PK1A 1C1CA 3WKAA 3LWMA 3IKMA 1LCUA 5FPNA 5CJ7A 3RRHA 1V4SA 1KFTA 3D45A 2F44A 4TUSA 1WSEA 3U3GA 5KFWA 5F1XA 4KLQA 3WXIA 3NDKA 4BRNA 4W5OA 3S3OA 4PKGA 1WN7A 5KNIA 4EELA 3LP2A 5J2CA 2AHOB 3PMLA 2K89A 4Y2XA 2A3VA 2KZZA 4O3RA 3SNNA 1VQ4N 4GIBA 2NUBA 1FJGK 4IG0A 4ECWA 2YTUA 3MDCA 3M9OB 1LWFA 2I7PA 4IEIA 4J2EA 1LVHA 4J9OA 1BA0A 1QQMA 4RU9A 4YR2A 8ICHA 2A1SA 4FZZA 4O3MA 4KTZA 4LC9B 3VQQA 2CPRA 5BPLA 3D2FA 4DS5A 1S1WA 3MX5A 3AO2A 3G6EN 2EAPA 3V4IA 5KFFA 9ICHA 3OPXA 4OKJA 4BR9A 2P9NB 3A0BU 1DK2A 1B43A 4H5VA 4J03A 3A2FA 4FJHA 4ED3A 1Z1BA 4FW1A 3VMFB 4NLGA 5J2QA 2BGWA 1A76A 1XC3A 4IFVA 1X1PA 4KKOA 4A59A 5J2MA 3JSMA 2HCFA 5KTQA 1IKVA 1WSFA 2I5JA 2KKPA 4FWMA 2F8SA 2Q1NA 4U6PA 2ZJPL 1ATNA 4NM2A 5DK5A 5MLCQ 1ZRMA 2KFNA 2Q31A 3LDPA 2KKVA 4Q45A 5KT3A 1X9SA 2RQ5A 1K8KA 4UB6U 4O5EA 3F5TA 3KVGA 1Q7YO 3HXMA 1NGFA 7ICTA 3DLEA 3RH4A 3M8SA 3L2QA 1F0MA 2LM4A 4DUYK 4TUPA 2E5SA 3NVWA 4K4GA 1HQUA 4K8XA 3UQ2A 1VSIA 5AKEA 1RDWX 3ZSWA 1SV4A 1MU2A 4YD1A 2IC3A 3RSEB 5H1SQ 5KFDA 4M9GA 4IQWA 2BANA 2E4LA 2VG7A 3WKBA 4ZOHC 3WK9A 1SL1A 4LVSA 4TUQA 1NWKA 1RBUA 3C7NA 4AM6A 5DB6A 4E89A 4I2PA 4M45A 5L1KA 3VQ7A 4ILHA 3LZJA 2E1YA 2ZXIA 1YJ9N 3MCAB 1SGGA 4YY3K 4KAZA 2YY6A 5KFJA 1NOMA 5J2GA 2QXFA 3BQTA 4NY8A 4DQQA 3U6FA 3CCLN 4J2DA 3OYIA 4FO0A 4E7LA 2E6MA 4Q5VA 3GIIA 2EAMA 1PVQA 1NOZA 4CJFA 4CK3A 1WBDA 1KVAA 1RNHA 4P4MA 4DTPA 2HVHA 2QWMA 4LSLA 3DLGA 3DXKA 4JKGB 4WFAL 2YHBA 3RJIA 1KAYA 1NK0A 4LH5A 4EHTA 1ASVA 1XI1A 4J9MA 3NGIA 4V19S 5ELZA 4H0VB 2DTUA 4BWMA 4I7FA 4BQZA 3UXPA 5SWMA 5EE3A 1MA9B 2DQNB 1GLCG 3T5LA 4CEDA 2WF9A 2F4VK 2JXJA 4KITB 2XY5A 4M3WA 4F5NA 4G1QA 1DGKN 1B92A 4KI4A 1T8EA 4JKFA 3N7SC 5HNKA 5IWAK 3KD5E 1S1UA 1CI4A 1T6CA 3TWHA 3KK3A 3Q8QB 2ITMA 4FM1A 4EBEA 4BWJA 5DQIA 3FYHA 4IS7A 1ZQHA 7ICLA 1BWFO 3VENA 5DB7A 2JZBB 2H3IA 3EY1A 2JHDA 3G6VA 3OSNA 2RDJA 3C6TA 3L4QA 4FSVA 3TAFA 1IG6A 3MMVA 3CC2N 2FJ6A 2UVRA 2D0CA 4CHNA 1XUPO 1L8OA 1HJPA 2UVUA 4CHYA 3DOKA 1IIPA 4R64A 2QEXN 4O5FA 4JKDA 2K4IA 3MR6A 4CEOA 3MN6A 3DXMB 2I5HA 2NZTA 2GO7A 1Z4OA 2NO4A 4KN4A 4F93B 2X74A 1EKEA 4XIUA 4KLUA 5ALRA 1TYQA 2P9PB 5GTIU 3SEIA 4F71A 5HR6A 4W5NA 5IILA 3ULEA 4DTJA 4CJEA 4OPKA 2VG5A 4I2DA 4TQRA 3W3DA 1HRHA 2G07A 4CNQA 3CQXA 3K2PA 4FWQA 3WXLA 1YTAA 3OYEA 3IDWA 4Z4HA 4KLTA 3HZ6A 1DTQA 5KQ8A 2P6UA 5ALTA 3FZFA 5AQPA 3VQ6A 2YNIA 5J29A 2ZJAA 3RJJA 3QUBA 3C2KA 1D8BA 1ZXIA 4UARA 5TZVA 4QWBA 2M9NA 2WB1C 3H08A 3GIJA 3CCJN 5J0TA 1JCEA 3JPRA 4FJ8A 2JMGA 4RNMA 2W7OA 3LM2A 2NRVA 2KZ3A 2ASJA 4ECVA 2DFEA 3C6HA 1VDVA 1Z00A 2HSTA 4W5QA 1CEZA 1C1BA 4Q0BA 5CHGA 1X40A 2BQRA 3TTDA 3D7EO 2Z1JA 3MN9A 4Y0WA 3WU2U 3QNMA 5C0YA 2JEIA 4H0YB 3LZIA 3QX7A 4EYIB 4NLZA 3ALRA 4CF1A 1Z25A 1Q9YA 4PL2A 3LP0A 3EZ5A 2A1AA 3BS5A 2HOIA 3ZSVA 2FLNA 1KFDA 4AYBF 4GLXA 3HRDD 2DF4B 5SZTA 2IOFA 3M9NB 4F5RA 4I28A 3Q7BA 3SENA 4FFDA 4NLBA 3MXJA 4O9MA 2HHVA 1TVAA 4ECTA 4DSEA 3TPQA 3D0PA 4I2HA 4E7IA 1GLFO 4FL9A 1UT5A 3H0MB 3MC1A 3J8AA 1Z26A 3AA4A 1BPDA 3N28A 4PL1A 1KXPA 4X64K 4BJQA 1U47A 3K5MA 5C42A 1SKWA 3RR7A 2ITGA 4N47A 7ICJA 1YI2N 5DLFA 2RF2A 4LFAK 5IT9O 2J6UA 2VKQA 3WXKA 5EVZA 2QA4N 4FJNA 4KHWA 1QQ6A 2ISPA 5AZJB 1ZQIA 1XC9A 4WJ3B 3E9OA 3ZETB 3GG4A 1T4GA 4IFYA 1OW5A 3HILA 4CZFA 2W9MA 1L5UA 2PI4A 3MDAA 1ZQGA 4NLNA 5KFCA 3CHWA 1J97A 3RSEA 2W9CB 4IRKA 1XQSC 8ICRA 1NLVA 3THWB 2K60A 2GWSA 3BS7A 1REVA 1RXWA 3O3HA 1T6DA 2JH1A 3MCPA 4NO7A 3ZDEA 5EE0A 2HMPA 1RYRA 3T5HA 3JYTA 1LWCA 1HIWA 4QS7A 3SQ4A 2Y9TA 4DFKA 1JI7A 3TAPA 2JLEA 4DR5K 2LPEA 1IKWA 1OH6A 5C12A 2PAVA 4E7HA 4C8MA 8ICFA 1O08A 1Q18A 2F8KA 2Q3SA 5AQFA 1RTJA 2E2QA 2HOEA 4DUZK 3N7PD 4DTSA 4I2QA 4MHVA 3HPOA 4OLBA 4I2CA 3OTQA 5HR7A 1TV9A 4F3OA 3ETRA 1KC8O 4UW9A 3M8QA 4DQPA 1NGGA 4J8FA 2ZGYA 8ICNA 2XI9A 3PW2A 3D2NA 1U4BA 4Z4GA 1ZQYA 4NL9C 1W9HA 1WSGA 3LAKA 4YOXA 3THXB 2YHYA 3DRPA 3DWLA 2VA2A 1KTQA 2E8NA 3DYAA 2IBKA 3C5FA 3FFIA 3KWIA 3N4PA 3VF6A 5JMVA 4A62A 4M3YA 4E1JA 2IS3A 2F8TA 4CBUA 2LYHA 2CH5A 2HF4A 1TK0A 7ICKA 3EUB2 3I8DA 1TAMA 2HI0A 2YX8A 3PIOL 3MX2A 1BPXA 3F5EA 3V1QA 4DF4A 1U49A 2RE2A 4QW8A 4CEFA 1LB2B 1VQKN 4DF8A 4M41A 1QQNA 4CGIA 1BPZA 3HOSA 3NF8A 5HL7L 3FFKB 3NFAA 4BRKA 2KICA 5FPEA 2MRLA 2OPQA 3BQ2A 2OHFA 4U7BA 5M1OA 3ZD8A 3BGRA 1L3SA 3PW7A 3LDQA 3MK6A 4EP4A 5BR8K 4B9NA 3JS6A 3AA2A 4FWOA 4H4OA 4KHQA 1DGSA 1RTIA 1TKTA 1YHQN 2W41A 5KRTA 4DV0K 2X78A 2J6TA 2CGJA 3V9UA 4XH1A 3CP8A 1KVBA 3F9MA 3DAWA 2O8FB 3ALYA 3L8BA 2QM1A 3T5JA 4DV2K 2C28A 4IO9L 1G99A 1Q82O 1EO1A 5DBAA 4YOVA 3BZCA 3LDAA 1FEZA 5AI5A 2IVNA 4I2GA 3BF3A 3RB3A 5DG8A 2OYYA 1NKCA 4BREA 3FDSA 5AQTA 2F2AB 3FM9A 4MDBA 1TVRA 4HYKA 9ICXA 2E8PA 4DL7A 3C2MA 4PHDA 1NJWA 1NZPA 2IIRA 4H5RA 4TQSA 2P9LA 3LVVA 4UB5A 4UASA 5D46A 4NV0A 3WEEA 2Q0RA 3VQ5A 1RBVA 3OYBA 3HT3A 5KFBA 3LAMA 1RCHA 2W3RA 3U26A 1T3VA 5AQXA 4IRCA 1SZHA 4GY2B 4KH6A 5JLHA 4JYAK 4YMNA 3NMUA 5IIKA 4Z6EA 2D0BA 5AFUA 3E01A 2QTDA 3F53A 3VA0A 4KV8A 3TSUA 2QXLA 4GVMA 3S41A 3V1OA 4BRQA 4QCLA 3V6KA 3NGDA 2XY8A 2G8UA 4M47A 1RGIA 1MQ2A 4PHTX 3NHGA 1BPYA 1YAGA 5GIOA 1ZBIA 4PKIA 4CEBA 3G4SN 2C2DA 3K59A 4HUFA 5KT7A 1S22A 5CWRA 4Y2VA 2FBYA 1L6NA 3T19A 4HTLA 2HOFA 3PMNA 4CGGA 3RF9A 4UB4A 5DQHA 3LK9A 1JLEA 4CHPA 4QZEA 9ICGA 4FZYA 3HTVA 3C65A 1ZYQA 3F2CA 2ES6A 3E66A 3OYHA 4BDZA 1RQNA 4JUZA 2W04A 3CM6A 1T94A 2E1ZA 3DDHA 3THYB 1N63A 1BNOA 1GLLO 3HKZC 5AM3A 2UYTA 3MEDA 1NBWA 4RUAA 5AQMA 2CH6A 3CCSN 3J7AP 1BI4B 1PK3A 4YHHK 4KTWA 5J2JA 5HMLA 5EE9A 1M6YA 4CF2A 1U45A 3D6JA 1IBLK 5AZJA 4I2FA 5DLGA 1X6IA 1ZD2P 5KFIA 1V85A 1OVYA 3PO4A 4A57A 4YDUC 7ICGA 5AQLA 4B8AB 2KHVA 2HMXA 3A0HU 5H2FU 3THVA 1PK1B 4PPXA 3QU7A 5KPRA 1JRPA 4P4OA 3DLBA 2FI1A 2YCHA 4MFCA 2EAOA 3OBYA 3H3OB 3BF1A 1OKJA 1D8LA 3GE1A 4KREA 1ATSA 2Y0SC 3M7DA 4ED8A 5K14A 1A5VA 3EPIA 3CJ1A 2WAQC 5KFMA 2D0PA 2YI1A 3NVYA 4KBOA 4DFDA 2HNYA 4Y2UA 3H0LB 5C5JA 2DPIA 3PW5A 4PZNA 4EYHB 2F8LA 1S9GA 3ONNA 1O13A 4I9LA 4KTQA 2GWKA 3SI8A 2G8IA 4RT2A 3SCXA 3UE5A 2IOCA 3H4DA 3OHRA 1UPHA 2P1JA 3C6AA 4QS9A 3H1VX 3TAGA 4KHNA 2UXBK 1NJIO 8ICQA 5J0XA 8ICIA 3B9JA 1A5WA 2VWJA 1N2XA 2KD1A 4QWCA 2LM1A 2FLPA 2WHEA 3M6KA 1ZD5A 1YVNA 3BQ0A 3IG5A 4B9LA 4FLWA 5J0QA 1B9FA 1RT5A 2ETJA 2KSOB 2OCEA 3QEBZ 3AA3A 4K41A 4CIGA 2W7PA 2CRXA 4OJ6A 3BUZB 1RBRA 1EWRA 5HLFA 1HNZK 3CW2C 4YN4A 1CRXA 5KAIU 5KT2A 2DL0A 3CIPA 4L8RB 4H0XB 2N1RA 3VTIA 5ALEA 1LW2A 4H5NA 1JLFA 3OYGA 3FZLA 2W6LA 4EFHA 2YB4A 1N48A 1UA0A 9ICEA 1P8ZA 1TL3A 3C6UA 1YTUA 4FWKA 1X9XA 1QSSA 4FVMA 1SV5A 3I28A 4CJTA 3CCQN 1L7PA 1K8KB 1VSDA 3FGUA 5T7BA 4KRFA 3EE9A 3K4GA 1SXDA 3PY8A 4DCHA 4DG1A 5LMUK 5AZIA 4J9SA 4K8ZA 2NRZA 4AHUA 5HOOA 3QFPA 4B1VA 1A77A 9ICKA 2D1KA 3T5KA 1D9FA 3ORYA 3QU2A 3C7NB 2ASMA 4KLJA 1S0OA 3QU5A 3KHYA 4CW7B 4PL8A 1KRPA 4Y2RA 2PFOA 4BRMA 4Z6CA 3P5JA 3QYPA 2K4PA 3T7ZA 4RQ0A 1S72N 8ICJA 2JEJA 1NGAA 2PFNA 2V7ZA 4CZHA 1BPBA 3M6ZA 3H8WA 4F91B 3EZWA 1N8RO 4DV4K 4IL6U 1ZBUA 1SB3C 1ZQ1C 3KLGA 2G08A 3GDXA 3NRWA 2FMQA 3ZX0A 4DMNA 3KK1A 3CNHA 4KN7A 4JB3A 2XY6A 4BXOA 1F5SA 4K43A 3WNFA 4CJ5A 1BISA 3K58A 1J5OA 2EQYA 5IINA 3ZDCA 3CJAA 2DFHA 1HYSA 4IKFA 3K5NA 3ULDA 1BG3A 2VWBA 2UU9K 1HYZA 4CK2A 4LF7K 4GC7A 1L7MA 5GTHU 8ICWA 4DLGA 1W97L 3CJCA 4DSKA 3CFRA 2ASDA 1IO2A 3F2BA 4IWVA 1RPLA 1HYVA 1FXXA 4OD0A 4NM1A 4M9LA 5KFOA 2AJQA 1GLEG 2WC9A 1RT2A 2ZXHA 4FZMA 4ED7A 2PYLA 4KB0A 3VC8A 2AGPA 4MLEA 3QB0A 2OPPA 4E19A 4FYDA 4EEYA 1E4GT 2XRIA 2JR5A 2YX6A 3DI6A 4J9QA 5AQUA 3K1ZA 5E41A 3ASMA 4PGYA 1R59O 2YKMA 3U4LA 3V7LA 1SWVA 2H3FA 2NNWA 3PW0A 2K8BB 2P66A 5JS1A 1RT1A 4DL3A 1S10A 1ZQTA 4ED6A 4J9LA 4OO1J 3GBTA 3OS0A 3JPTA 4HHTA 2PKEA 3NTUA 8ICYA 3U9DA 2DBYA 3SPYA 3HBTA 1EP4A 5KFXA 4IJNA 1ILYA 1CZBA 4DU1A 1URJA 2OEHA 2KW4A 3AQFA 4MEYA 4KLEA 3KWGA 5ALZA 5CR0A 3KZBA 2JEGA 1TYQB 1UT8A 1EETA 4C8NA 3F2KA 5D4BA 2F1JA 3EL2A 5KRSA 3F5AA 4JV2A 3NH2A 5F9LA 4CIFA 2RDIA 1T44A 4FPAA 4MF8A 4I2IA 1PVRA 1SS6A 5KFVA 2Z1GA 3WKDA 2YJFA 4O3OA 3ISNC 1JL1A 1HNVA 4CE6A 4DV7K 2HB5A 1BI4A 4CFBA 3UKRA 2R7YA 1ZOLA 3AU6A 3F73A 9ICPA 8ICAA 1K9MO 5CZ1A 3KZIU 7ICOA 3O08A 4YFKA 1YZ7A 5AKXA 3AVAA 1QCKA 1VAZA 3DRRA 2XC9A 3O1WA 4ILJA 1SKSA 3QMLA 4CZJA 3JXUA 9ICLA 1KSPA 4B3SK 2O8BA 2E8MA 3UM9A 3C23A 4IQTA 3MABA 5DKWA 3AL0B 4OPHA 3KK7A 2Q0ZX 2ZUDA 2P9UB 5TKYA 3E1YA 4B3OA 1RDUA 1K1SA 3AVGA 1NMDA 1Z00B 5E84A 2P9KA 3RB6A 3ID8A 3AEVA 5L9XA 4X5VA 1U48A 3MEGA 1A6SA 4AHRA 2XY7A 4KB1A 2IHMA 1ESVA 4E7JA 1VRTA 4DCCA 4LFBK 4IQUA 2P9IA 2WTFA 3VPZA 1RM6C 5ALLA 2FMSA 2H3GX 3B0XA 3BS5B 4QZFA 5AJ3K 5J2HA 4EP5A 4BQLA 3QFUA 3OYDA 3C21A 3A5NC 3JPQA 3WNGA 1J2MA 4UAVA 3MWPA 4JKAA 1WWUA 4CERA 2KVCA 1ZQSA 3SQIA 2KSOA 1NGIA 4ID1A 3QLHA 3SD7A 2GLEA 2DY4A 4BRDA 4E1NA 3CMEN 4ECUA 4H0PA 5EX5A 4U7CA 3GV5B 4CZGA 3NUQA 5C15A 1HNWK 1QH9A 3G6YA 1Y97A 2V52B 3RAQA 3L3VA 4BGBA 2BPFA 1ZQOA 4IBNA 1L7OA 2BCSA 5AQSA 5ALWA 2QB1A 4W5TA 3Q7CA 1SZ2A 2HHHK 1C1AA 5J0YA 4A2BA 3TAEA 4GV6A 4H5WA 4CF5A 5EOYA 1K73O 4B3TK 1WAFA 1GLJO 2D8CA 2GX9A 1OXJA 2H3VA 3KJVA 4A2AA 3H4BA 3OJSA 4IDKA 4AHTA 4F4ZA 3S9HA 4NJ8A 4Z4IA 1S76D 3AAQA 4O8KA 3P31A 2VJ5A 4FJIA 5EU7A 4CJQA 3QEWA 4JI2K 1BGXT 4YQWA 4FWPA 3TSPA 2QK9A 2BTFA 2D0OA 2Q36A 3B6PA 4CJRA 4P0QB 1ZC6A 2W8LA 3QXGA 3Q8KA 2IMWP 8ICPA 3VQ8A 1TE2A 3FE1A 3VTHA 3MBYA 4CE9A 5C2DA 3QEPA 3HJFA 4I2EA 4OPJA 3PO5A 1S0MA 3O4NA 9ICBA 3VQPA 9ICCA 5F0XA 1XNRK 5HRRA 3V7KA 2BCQA 4DOBA 4M7YA 9ICJA 1JLBA 4FS2A 2I1QA 1O1WA 4ZTFA 5ALOA 3SBTA 4B9TA 1RDCA 3R3LA 3PUFA 5I9EB 1FK9A 3O8MA 2D5RA 2QWOA 4AF1A 4CFCA 3DOLA 2VQEK 3ISDA 4CBWA 4OGCA 3QEVA 4BE0A 4QZDA 4RCHA 3VGKA 3QETA 3A5MC 2KIVA 5AQZA 2DUYA 1J54A 4DOCA 4QW9A 2WF8A 8ICKA 1DTTA 4Y1CA 1Q81O 4RG8A 3IMXA 2ZJ8A 4C8LA 3UKUA 4LF9K 4CFAA 4WFBL 2QWPA 9ICFA 2I9GA 2AXTU 3F9KA 1NK6A 3DEEA 5KQDA 4FLVA 2PFPA 1TGOA 5HBMA 1TAUA 1L7NA 1S5LU 3AVNA 2AQ0A 3LALA 4CJ4A 2JRZA 3M9MB 1K1QA 1BVSA 1AQ6A 3ZSYA 3QUCA 2GWJA 2Z7JA 2QW9A 5HMMA 2EWSA 3SZ2A 1S9EA 3JPNA 3SQ0A 5ALNA 1DK3A 4OVLA 3J81O 4IRDA 3AARA 3KLFA 3K57A 4RUCA 4DQIA 4KLGA 3D2EA 4NXNK 1WWVA 5B5EU 3AY9A 4FJGA 1TK8A 3PSTA 2B6GA 5GAHP 3CQ8A 1XHZA 2XIDA 3WK8A 2X6SA 5AM1A 3TQ1A 2FBXA 1QSYA 3EE8A 4CDGA 1GOAA 4DL6A 4BG9A 3A0IX 2CGLA 4ECXA 4CJUA 5ALQA 4QZ9A 4M0AA 3AO3A 3NS1A 4BDYA 2YNHA 8ICXA 3OYJA 4FBUA 1LOTB 5M1QA 5JTIA 3WXMB 2GOLA 4I2BA 1MSWD 1VQNN 2H3ZA 3QDKA 3HKZF 5J2FA 2UVWA 4DTNA 3VQ4A 3T3FA 2GBZA 3AVLA 4Z4CA 5EWEA 1NGJA 2VWKA 4DR4K 4C4SA 4DV5K 1DLOA 2MA1A 1KLNA 2P35A 3ZDAA 2E8OA 2GEMA 4CF4A 2KJ8A 4LF4K 2RHKA 3NF7A 3ZSZA 3NF6A 4A5BA 3CI5A 4F4YA 3QUQA 1WB9A 1QHAA 3VEWA 3RBEA 4XH4A 4Q8FA 4YVZA 5ALXA 2OXOA 2XGPA 4F4WA 1G15A 1VSKA 4IJAA 3H8MA 3OS1A 1NOYA 3S3MA 2KEYA 3MECA 5EY4A 4BG8A 2QLTA 2WOMA 3R6MA 2FLLA 2P9LB 3GV7B 5HP1A 1RXVA 3KOOA 4I6MA 4EEKA 3WEEB 2P9UA 4BRFA 5KFZA 3JPOA 4NWIA 4GXKA 2OWOA 1LAVA 5D3GA 2HVIA 2Y0SF 4FE3A 4QZIA 3KIOA 4BVPA 4O0IA 9ICRA 3NRZA 3LDOA 2P9SA 1B22A 3A5OC 3O9TA 4C23A 1NU0A 2WAQF 1BCMA 3ZEUA 3D2QA 1VJ5A 3G71N 4CEQA 1JKHA 1A0PA 1K8AO 3KBBA 2G0AA 3QUTA 1WSHA 4P4PA 3U9ZA 1NK7A 3SJJA 4J2AA 4DKWA 1SIJA 4JK7A 4A5AA 3V9ZA 1GOCA 4ZH4A 1ITGA 2Q0UA 3H3NO 2XCAA 3CRXA 1LKYA 4B9SA 4CJWA 2F1HA 2YNGA 4GXIA 1SL0A 5ADXH 7ICQA 1H1VA 4DQ8A 1N32K 2AA4A 3V6DA 5J0UA 4BUGA 2QWNA 2OZMA 2B21A 1NZBA 1MWKA 4WQ4C 3OYMA 3WK6A 3MWTA 5ALHA 4H8KA 3KLIA 4BR7A 4ICLA 4F2SA 4UY8O 1UHUA 4DTMA 1EXQA 5KFPA 2ATQA 1RG6A 2E3TA 2F1IA 4DL4A 2LYBA 4PJ0U 1ZQVA 2E2NA 9ICOA 4JI8K 3B0YA 3PSPA 2W6KA 1ASUA 5L1LA 2YKNA 4IXCA 1ZBHA 1UQVA 4AQYK 3AQEA 3KHHA 4O5KA 5AQKA 5FPMA 1C7YA 1N56A 1NM1A 4YFUA 1ZQLA 3P38A 2G8KA 1KLMA 4MFFA 1V4TA 7ICHA 3TTFA 4JK1A 3QIOA 3PV8A 4BVOA 4P0QA 1M90O 8ICUA 4CJPA 2KP7A 3VQEA 5EWFA 4CEAA 2R18A 1WOQA 5ALMA 4QIWC 3JPSA 2HHWA 3K5OA 3H0RB 3I55N 3VA3A 4R8UB 4M3UA 1Q8KA 4Z94A 1GO3F 4BC2A 4BC5A 1HNIA 4K4HA 3MGHA 1RDDA 5J0OA 4DSIA 2KTQA 3ZLJA 1KDHA 5BRDA 3QESA 5GADP 1XWLA 2HHQA 2RPIA 3HO1A 4UB2A 4DO9A 3B6OA 4YNQA 2VG6A 4OGEA 3J80O 5AI8A 4JWMA 2H3QA 4CFDA 4Z0UA 3O9SA 2BH1A 4IC9A 4BE1A 2PYJA 4KFBA 3H45C 4G9ZA 5J2BA 4G9BA 3KHLA 3I8BA 4O0JA 4CZKA 1WCLA 4RQ2A 4KMUA 3NVZA 3ENBA 1NJXA 4NL9A 1ZQFA 1HX1A 1VQMN 1BQMA 2AGQA 4BR5A 2C2RA 5AQNA 7ICRA 3SUOA 2R8KA 2D6FC 2GELA 3AVMA 5M1NA 3C5GA 2W54A 5EOZA 3SV4A 2BQUA 4Y2SA 4Q44A 4QAGA 3R1XA 2AU0A 3GV8B 1YF5L 3QU9A 1VQLN 4B8CA 2W40A 1KAXA 5KFQA 5KFTA 4UBBA 4IEEA 1WSJA 4BR4A 1XU4A 3DLRA 4J9PA 3IG8A 1ZQDA 1NK4A 5AZIB 4R5PA 1HQEA 1C0MA 3DLKA 3AN1A 4B9UA 4P2HA 4ICAA 1GLAG 3OA9A 3O3GA 4AILC 4USAA 2C2EA 1S0NA 1JCGA 3LP1A 1X3MA 3SUNA 4FJJA 2DPNA 4NLCA 2KVSA 8ICTA 3ZX3A 1BA1A 1VQ8N 8ICGA 5J2DA 4BRCA 4LF5K 4C4RA 2D4WA 4NCAA 1TKZA 3AMZA 1CZ9A 4N41A 4XH5A 4ILGB 5HHIA 4YOUA 4B1UB 4CF9A 4EENA 3ATVA 3CM5A 4FPBA 1QHTA 1KW4A 3R8EA 4C1NI 2KG5A 4KMOB 1S6QA 4DFPA 2ZIXB 4C7YA 1ED1A 1IXRA 4BXOB 4JEPA 3L2UA 2G8WA 3ZD9A 4JI0K 4H4MA 4BR2A 5F3XB 1V38A 2ZIVB 4ED0A 1Z6RA 3ID6A 2BR0A 3ZT0A 4IOCL 3GOIA 4RTFD 2A1JA 2ZTDA 1D8YA 4G3IA 3MR5A 4FJKA 3ZT1A 4YMMA 4E0DA 1HPZA 3M8RA 5E79U 5BPMA 4FS1A 7ICFA 1ZBSA 5AI0A 1CLQA 5J8YC 2HSZA 1BCOA 2HBMA 2Z1HA 1RT3A 3OYCA 8ICVA 3MFIA 1HUOA 3ZSXA 4FXDA 3ENOA 3O9QA 1GLBG 3QBWA 3EN9A 3IP4B 2E8AA 4FZNA 4B9VA 9ICQA 4QZCA 3LP3A 2ASPA 2JV3A 1XO1A 1Z4NA 1A5XA 3V6JA 4CGFA 2PXIA 2KHOA 5BREA 4JMUA 1IV8A 5CRXA 1UCVA 2BZFA 3PR4A 3G6XA 4RQ6A 3KKRA 1ZQPA 4FJLA 3MR2A 3G0ZA 2MSNA 1SKRA 3W0LA 3ZI4A 3HI0A 3O4WA 2G8VA 1XO0A 4JS4A 3CPEA 1L3TA 3Q8PB 1DGJA 2BHNA 3SR6A 1ASWA 4F5OA 2ZQBA 4YXMA 1HR0K 3LYSA 4FOEA 5ALPA 5JICA 4Y2JA 2ZF5O 2O4IA 2F96A 3AO5A 2D3DA 3N7RC 3P39A 3ZSRA 1VLBA 4Y1DA 4ZHRA 1KVCA 4RQ3A 1JXLA 4KH4A 1EX4A 2RHFA 4F9OA 1V9PA 3SMPA 2V51B 4EBDA 2F9WA 5L1IA 4ISFA 4GVEA 3SBGA 3L3FX 2A3ZA 2QWRA 3ITHA 4KH5A 4UAWA 2EDUA 9ICWA 3F2DA 3UKRB 5DMRA 2P51A 4UAYA 1RYSA 2YNFA 4CD1A 3IAYA 1WUDA 3KKSA 5JVGL 2FLOA 4J9KA 2ZWHA 3LM9A 4BC4A 3HSTB 2EANA 2JEFA 1VSHA 3CG7A 2WF5A 3KHGA 7ICEA 9ICNA 1C0GA 5FDLA 4RQ8A 3J7YP 2DFLA 3HP9A 5B66U 3CJ7A 4CZLA 4YDUA 2QB0A 4CBXA 2O8BB 4M63C 3T1YK 2CN1A 4K0KK 1ZQEA 1R0AA 5KPZA 5C10A 2ZIUA 3VQAA 2KJ9A 4DB3A 4Z6FA 4RW8A 5BPCA 4FOIA 1T03A 3KZXA 4RQNA 4R8UA 1QTMA 2OA8A 2P9KB 2BQ3A 5L1MA 2DWQA 1V97A 7ICNA 1J6ZA 1JLCA 3UPQA 1OH8A 3N4MB 1BL3A 3LDNA 4EHUA 3IFRA 5GAGP 4FK2A 5DGBA 3ZT4A 1ECWA 1SQKA 3RH6A 2ISOA 2P9IB 4IDHA 3V9SA 1QS4A 5KFAA 2G09A 3DRSA 4CD3A 4OLAA 4UAZA 3DV9A 2WONA 3ED5A 4RPYA 3QICA 7ICPA 4OJLA 2WUSA 1VQPN 4DU4A 2BPGA 3AAPA 5KAFU 2HW3A 3SUPA 5F9NA 2NRTA 4UBCA 1SWWA 4E3SA 2FPMA 4EBCA 2YB1A 1XMQK 4RPZA 4FLUA 3QZ8A 3CCRN 4J2BA 2RN2A 2O8DB 5LY3A 4A8EA 3CJBA 5BN8A 1CXUA 3QNOA 3ZSQA 3K1RB 4EAHD 1YJWN 5KFGA 1BDGA 1AROP 3UB5A 2B0CA 2QARA 2R8HA 1YVUA 3JAMO 2O4GA 4CI6A 3NASA 2HHUA 5CYMA 1YIJN 4PGQA 4QWEA 3AVBA 3TAQA 4O5CA 5JUMA 4F2RA 5BRFA 3VCBA 1YZ6A 1HJOA 8ICOA 4HVJA 4I27A 2MUTA 5HHHA 3WQTA 1N33K 2F77X 3GIKA 5KFSA 4QZAA 3OHBA 3VGLA 1QE1A 2F76X 5KFNA 4JI1K 1LWEA 2ZG6A 3PW4A 5AKYA 1TKDA 5IIMA 4AHCA 2A41A 4YORA 2FSKA 3H46O 2LKYA 4DR3K 1KFSA 1OH5A 3TARA 4CGZA 8ICBA 2ZTEA 1RDBA 4HAIA 3QINA 3CCUN 3CF5L 2YN4A 1VRUA 2YMLA 1DT9A 5LJVA 4PHPA 4CZEA 3AU2A 2ZIXA 2HHSA 3HK2A 3K5LA 4Y2PA 1SUQA 1S8OA 4C7ZA 2IHNA 4IR9A 4KLIA 3M6GA 3V7JA 2E6LA 2QKKA 2ZIVA 3M1YA 4YD2A 1S3XA 4F8RA 2A6AA 3NH1A 2V4RA 3FR0A 3RTVA 1ZQNA 3AO1A 4B9MA 1IG9A 4B3MK 4YR3A 3WUHA 8ICCA 1NJZA 3NVKA 4PGXA 3OHAA 5ADXA 3AVJA 1JMSA 5AK6A 3UKUB 2V9WA 4R79A 3HP6A 3QEXA 1FO4A 2Y9UA 3Q8RB 5AKGA 1S1XA 4QS8A 2VQFK 3AO4A 2UUAK 2WBNA 1Q46A 4JK8A 8ICEA 3V9XA 4X65K 3O5BA 1CXQA 4B1ZA 1I39A 5ALUA 4DS4A 5M1FA 3VN5A 3VEYA 5A2QO 3NAEA 5AQVA 3PVXA 5KG1A 3AVIA 5JU5A 2LMRA 3SLCA 3WT0A 2UXDK 4CHQA 1N5YA 5JRTA 2ZUBA 2O8EB 2OTJN 3VF4A 3TSQA 1RDFA 3CERA 5AKHA 4ECYA 2XHBA 4DOAA 3D2EB 1VSLA 5K4LA 1HLUA 3N4QA 1Y88A 1ZQCA 1Q3UA 2E1EA 3V9WA 4GC6A 2FMPA 2H5XA 1M1KO 4KHUA 4P0PA 5KFYA 1NG9A 3HL8A 1IH7A 3C0BA 5TKWA 1T7PA 1S1TA 4B9QA 4OJ5A 1BPEA 1ZJMA 4GFJA 2KNJA 2I6XA 1BIUA 1GLDG 3I0RA 5F2RA 3EW9A 4C0ZA 4H0TB 3TU5A 3GDQA 4CGDA 3PX6A 1N34K 5ALYA 3JPPA 4EIAA 1W2BM 3WK5A 3GL1A 3C94A 4DR2K 4WYBA 4BE2A 3KFUF 5AK3A 4PHAA 3NVMA 1KQSM 3NBPA 4F5QA 3QNNA 2O8CB 4DV1K 4BY9C 4KI6A 2QI2A 1JLGA 4KLLA 4JWNA 3ZYYX 3NE6A 4OKEA 8ICMA 1XNSA 1ZXOA 2W9AA 4JV5K 4C8OA 2FDRA 4WCEL 2DFFA 3E2EA 3QEAZ 1TK5A 3O80A 3CCEN 1ZQAA 1XMOK 1KKXA 5IIIA 4DSLA 3Q8MA 3BQ1A 3NF9A 1ZQZA 2W9BB 4CJKA 2FBTA 1HMVA 3N97B 1KCFA 4KHPK 3M3ZA 2GV9A 4M9NA 4DR1K 3I0SA 1KL9A 4RQ4A 3WKCA 1IKYA 3KLHA 2QWLA 3PIPL 4MF2A 1IKXA 4I6MB 2HOQA 4A61A 2KIWA 4QIWF 4B1YB 1ZD4A 4QNLA 1U2VA 3CXCM 2GUIA 3HW8A 2CGKA 4XRHA 9ICVA 1ZJNA 3GFKB 3QU4A 5JVHL 3EWAA 4FLXA 3TI0A 5ALSA 4F4XA 3KTQA 2P9SB 3ZSOA 3FZHA 4BGAA 3ZEUB 1BNPA 4FK4A 2KOBA 4O44A 2YQEA 7ICMA 4LH4A 3QBXA 2IVPA 5J0PA 1HKBA 3I76A 5ALJA 2UVVA 3NCIA 3MR3A 3RWUA 3L0QA 1YXQA 4EX7A 2HBLA 1HKCA 3BEXA 4UQGA 2JWKA 4L3QA 1LKYB 4CJ7A 2UUBK 4FVUA 2EZYA 5BRHA 2ZJ5A 1B9DA 2XO7A 3C1ZA 3SJHA 3FZKA 5DM6L 2ZM6K 4DU3A 4CVNE 4M04A 1X6JA 1JUDA 2JGAA 5FROA 5BR9A 4RWTA 2BCRA 1X42A 2C22A 3HOTA 2O8DA 2P5GA 1TFRA 1W7AA 2BCUA 4B08A 1Z1VA 2LI6A 2J4RA 2WFBA 3FZMA 5ALIA 4AHSA 4BROA 1VQ9N 4ACOA 3QE9Y 8ICLA 3RMBA 4DTOA 4M9JA 4Y2YA 4RQ1A 4O4GA 4RW7A 4RNNA 4LZDA 4US8A 3TANA 2YMPA 2ZIWB 3LL3A 3KLEA 1ZQRA 2HF3A 3BP8A 5KG5A 3KD1E 4LJXA 3WXJA 1PVPA 3AGRA
chains in the Genus database with same CATH topology
4I2JA 5LJWA 4BR0A 3SAHA 4U67L 4XA5A 4K42A 3L4IA 2E2PA 5AQIA 9ICMA 2F9TA 2Y1IA 5J0SA 4R66A 5EXWA 3GIMA 4RQ5A 4DL2A 5L1JA 3CQYA 4M6WA 4DHYA 4J9RA 3EYZA 1ZQKA 4O3QA 3H8JA 1LV5A 5AFUH 3CC7N 3OSPA 2FPKA 1XSLA 2FF3B 3CETA 2VANA 4MO4A 1QZ6A 5AQYA 1MQ3A 3FLCO 3UXOA 5AQJA 4RZRA 4UB1A 5BOMA 4BC3A 3KHRA 3P4IA 3CJ9A 2YHXA 4J9NA 4ECQA 4O8UA 3O9RA 1S9FA 4I2AA 1QVGM 2FXUA 1BOTO 5J2IA 3HX0A 3Q8SB 3RBDA 3DLLL 5DGAA 1DOQA 4BRLA 1IG8A 2YHWA 3RJKA 2OANA 4FBTA 1HUZA 1DEJA 2F7TA 3IHQB 3HSCA 1YUWA 3MFHA 3H1QA 3ISBA 4YCXA 5CP2A 2Y1JA 2QWQA 4MEXA 1TAQA 4RNOA 4M2YA 4JHDB 2J6SA 1H38A 2VA8A 3SMSA 1COOA 4DLEA 4GV9A 4ECRA 3C2LA 3A8YA 3ZX2A 1SL2A 1NGBA 1JJ2M 2KZMA 1ZQWA 3H8SA 2AQ4A 4KLMA 5J2EA 4FWNA 5KFEA 1ZQQA 4DQSA 1NGEA 1Y64A 2NRWA 5KG3A 3B8AX 4XEIA 2A1JB 4EZ9A 5DB9A 3OJUA 4KLSA 3TTCA 1TUUA 2FPLA 4JD2A 4BDPA 4GNIA 2W9BA 3D6RA 4H03B 2V7YA 4HWIA 1SZPA 3PX4A 1NKBA 3TFSA 1Z05A 1RZTA 3UXNA 5DDYA 2XCPA 5CHIA 1S0VA 5CE3A 4UB3A 1WCNA 3AUOA 3EKUA 2NRXA 5KFRA 4DSFA 1HPMA 1QLNA 3I56N 4DSJA 1MDUB 2PFQA 2IVOA 5GAEP 3PNCA 7ICVA 2ZGZA 4NLKA 2VGNA 5KT6A 4F92B 2BDPA 4WQ4A 3O1BA 3VEOA 2V4QA 1XSNA 3AGKA 4QWDA 3O6WA 3ISCA 4XUSA 5KG0A 3GQCA 4LZGA 1E4FT 3K75D 3CCVN 8ICSA 1JIHA 3BJYA 3PX0A 2P9NA 1YITN 4JKHA 1XSPA 2Q97A 3I33A 4KLOA 4JN4A 4DQRA 2VCPA 4ED2A 1SAZA 4DWIA 2E2OA 2AP1A 1NGCA 9ICSA 5GIPA 1JCFA 4JNEA 4IZ9A 1MC8A 1WUAA 5KG6A 8ICZA 3BDPA 3M1FA 4KLDA 3SK3A 1ZQUA 2ZTCA 4BRGA 3ENHA 2R8GA 3OGUA 3MN5A 3RAXA 1DKGD 5BPNA 4QWAA 2FSJA 2NRRA 3L6QA 9ICIA 2ZJRL 3MN7A 5IIJA 1NK5A 1ZQXA 5DB8A 3H7IA 1L3UA 5KFKA 2BUPA 1YJNN 1XS9D 4KLHA 4IFEA 1ATRA 2A42A 4JKGA 4MFAA 4TURA 3PR5B 3Q8LA 5B8HA 3HM8A 1KAZA 4WQ5C 4ECZA 4WQ5A 4KLFA 2MUTB 3LWLA 4M7XA 3EO3A 4JHDA 2A40A 4BRIA 4JV1A 3LDLA 1JXEA 4O3NA 1NK8A 5AQRA 3VEVA 2ZJQL 2BCVA 1Q86O 4RT3A 2JZBA 4BRPA 5KPTA 2A5XA 4YMOA 3RJGA 1NGHA 3MGIA 1TUYA 3VERA 4C1NK 3IDHA 5CB1A 3DXMA 3SV3A 1X9WA 4PHEA 2P9PA 5DQGA 4I29A 4QZHA 3C1YA 4EZ6A 3RR8A 3RH5A 3HWTA 5KFUA 3VEZA 5IIOA 3PLAA 4YOWA 4FO6A 1JX4A 3O9UA 1Z3EB 4FWSA 4DEZA 1QZ5A 3ZDBA 4ELVA 4IQVA 5AQGA 5KG2A 3VF2A 3G25A 4CZIA 2KN7A 1VQ5N 1CUKA 1JN3A 3T69A 4QZ8A 4RQ7A 1L3VA 2FF6A 3SAGA 3VGMA 1EQYA 1NKEA 2HHXA 1U6ZA 4ISEA 4JKEA 4RPXA 1RFQA 5M1PA 4DFMA 3GILA 3RJEA 3VOVA 1ZQMA 5E26A 9ICUA 1T3NA 4F4KA 2HHTA 1VQ6N 4F5PA 3RB0A 3QZ7A 9ICTA 1ZETA 2VYPA 4NXZA 1IJJA 2DPJA 4B1WB 3RJFA 2HBJA 7ICSA 1ZQJA 2JWLA 3A5LC 3ZDDA 4QZGA 3E9PA 1U2VB 3RVCA 3IM1A 1P90A 2NRHA 4ECSA 4BGDA 5KG4A 3RRGA 3MDQA 5DBCA 3CC4N 5DG7A 3ZETA 3OBWA 2ASOA 3RJHA 4Q8EA 4FWLA 5J2AA 2AGOA 2XGQA 2YJEA 1D9DA 4MDAA 2GTDA 2W9CA 1BO5O 4C8KA 5JLFA 2E20A 1HKGA 5AQOA 4H0OA 4DFJA 5C2FA 1PZNA 4DL5A 3CCMN 3WQUA 4Z6DA 3SAFA 2FSNA 5AQWA 1BUPA 4O3SA 4OPAA 4YOYA 3CMAN 4QZBA 2R8JA 4ELTA 4O3PA 4F50A 3V72A 7ICUA 3D2FB 4B1XB 5KFLA 1HUXA 5KT5A 2E88A 1VQON 4CCHA 1IM4A 5EWGA 4NB4A 5M1KA 2ATLA 4YR0A 2IA6A 4FWRA 5J2KA 3DJCA 1X2IA 2VA3A 5J0RA 4IR1A 4M6WB 4JK9A 3VESA 3J7ZO 1KD1O 2OTLN 5KG7A 3H6EA 3ATUA 4ED1A 4Q43A 3M5RA 3V6HA 3H40A 3RB4A 4JKCA 1NJYA 4JV0A 3EKSA 3U8XA 4GXJA 1KEJA 4H5TA 4PKHA 5HP4A 5D49A 2KFZA 4PL7A 1D4XA 2KKZA 2MAXA 2KLAA 4CZMA 2HBKA 1ZQBA 2Q2RA 3K9JA 4XQ8A 2I7NA 3TFRA 3E9LA 2PBDA 3DXKB 3CD6N 1MWMA 2ASLA 4R63A 4IO8A 3K9KA 4YXJA 4JAXA 5CA7A 5CR4A 2PFUA 4ISGA 5AR0A 2W8KA 4BRAA 5BN9A 2PI5A 3HRGA 4YOTA 1QQOA 1QVFM 1S77D 2GUPA 4R65A 5DBBA 1X3NA 2BPCA 1BU6O 2NLXA 1EXNA 5DG9A 3SYZA 3CPWM 3VEXA 3OW2M 4MO5A 5AQHA 9ICAA 1C0FA 3UQ0A 1QSLA 1CZAN 1S97A 3IUCA 4JKBA 4K25A 5GINA 2BKEA 3VETA 1NGDA 4ELUA 5BOLA 2R8IA 1VQ7N 2ALZA 4JD2B 5FPDA 4MLHA 4K4IA 5DDMA 5AQQA 4IOXA 3ULEB 4YG2A 5KFHA 7ICIA 4WFNL 4IOAL 4GV3A 1UA1A 5KT4A 3ETLA 1U9LA 1NK9A 5J0WA 4M9HA 4YP3A 4BRHA 1X9MA 3EPGA 1X9JA 2VGMA 2P6RA 3R9PA 5DM7L 4WF9L 4PH5A 4AM7A 2ZUCA 3LWMA 3IKMA 1LCUA 5FPNA 5CJ7A 3RRHA 1V4SA 1KFTA 4TUSA 5KFWA 5F1XA 4KLQA 3WXIA 4BRNA 4PKGA 5J2CA 3PMLA 2KZZA 4O3RA 1VQ4N 4ECWA 4IEIA 3MDCA 3M9OB 2I7PA 4J9OA 1BA0A 1QQMA 4RU9A 4YR2A 8ICHA 4LC9B 5BPLA 3D2FA 4DS5A 3MX5A 3G6EN 5KFFA 9ICHA 4BR9A 2P9NB 1B43A 4H5VA 4ED3A 3VMFB 4NLGA 2BGWA 1A76A 1XC3A 4A59A 5KTQA 4FWMA 2Q1NA 2ZJPL 1ATNA 4NM2A 5MLCQ 2KFNA 2Q31A 3LDPA 4Q45A 5KT3A 1X9SA 1K8KA 4O5EA 3F5TA 3KVGA 1Q7YO 1NGFA 7ICTA 3RH4A 3M8SA 4TUPA 4K4GA 3UQ2A 1RDWX 3RSEB 4YD1A 5H1SQ 5KFDA 4M9GA 4IQWA 1SL1A 4LVSA 1NWKA 3C7NA 4AM6A 4TUQA 5DB6A 5L1KA 4ILHA 2E1YA 1YJ9N 3MCAB 5KFJA 1NOMA 5J2GA 3BQTA 4NY8A 4DQQA 3CCLN 4FO0A 3GIIA 4P4MA 2HVHA 2QWMA 4JKGB 3DXKA 4WFAL 3RJIA 1KAYA 1NK0A 4EHTA 4J9MA 5ELZA 4H0VB 4BWMA 4BQZA 3UXPA 1MA9B 1GLCG 3T5LA 4KITB 2XY5A 4F5NA 1DGKN 1T8EA 4JKFA 5HNKA 1T6CA 3Q8QB 2ITMA 4EBEA 4BWJA 5DQIA 3FYHA 7ICLA 1ZQHA 1BWFO 3VENA 5DB7A 2JZBB 3G6VA 3OSNA 2RDJA 3L4QA 4FSVA 3MMVA 3CC2N 2UVRA 1XUPO 2UVUA 1HJPA 2QEXN 4R64A 4O5FA 4JKDA 3MR6A 3MN6A 3DXMB 2NZTA 4F93B 4KN4A 4KLUA 1TYQA 2P9PB 5IILA 3ULEA 4I2DA 4TQRA 3W3DA 3CQXA 4FWQA 3WXLA 4KLTA 3HZ6A 5KQ8A 2P6UA 3FZFA 5AQPA 5J29A 2ZJAA 3RJJA 3C2KA 5TZVA 4QWBA 2M9NA 3GIJA 3CCJN 5J0TA 1JCEA 3JPRA 4RNMA 3LM2A 2NRVA 2KZ3A 2ASJA 4ECVA 3C6HA 1Z00A 2HSTA 1CEZA 5CHGA 2BQRA 3TTDA 3D7EO 3MN9A 4Y0WA 5C0YA 4H0YB 2JEIA 4EYIB 4NLZA 3EZ5A 2FLNA 1KFDA 4GLXA 3M9NB 4F5RA 4I28A 3Q7BA 4NLBA 4O9MA 2HHVA 1TVAA 4ECTA 4DSEA 3TPQA 4I2HA 1GLFO 4FL9A 1UT5A 3J8AA 1BPDA 1KXPA 1U47A 1SKWA 3RR7A 7ICJA 1YI2N 5DLFA 2J6UA 3WXKA 5EVZA 2QA4N 5AZJB 2ISPA 1ZQIA 1XC9A 3E9OA 3ZETB 3GG4A 1T4GA 4CZFA 4NLNA 2W9MA 1L5UA 3MDAA 1ZQGA 2PI4A 5KFCA 3CHWA 3RSEA 2W9CB 4IRKA 1XQSC 8ICRA 1NLVA 2GWSA 1RXWA 1T6DA 3MCPA 4NO7A 3ZDEA 2HMPA 1RYRA 3T5HA 4QS7A 4DFKA 3TAPA 5C12A 2PAVA 4C8MA 8ICFA 1Q18A 5AQFA 2E2QA 2HOEA 3HPOA 4I2CA 1TV9A 4F3OA 1KC8O 4DQPA 1NGGA 4J8FA 2ZGYA 8ICNA 3PW2A 1U4BA 1ZQYA 4YOXA 2YHYA 3DWLA 2VA2A 1KTQA 2IBKA 3C5FA 3KWIA 3N4PA 3VF6A 5JMVA 4A62A 4E1JA 4CBUA 2LYHA 2CH5A 2HF4A 1TK0A 7ICKA 3PIOL 3MX2A 1BPXA 4DF4A 1U49A 2RE2A 4QW8A 1VQKN 1LB2B 4DF8A 1QQNA 3HOSA 1BPZA 5HL7L 3FFKB 4BRKA 5FPEA 3BQ2A 4U7BA 5M1OA 3ZD8A 1L3SA 3PW7A 3LDQA 3MK6A 4B9NA 3JS6A 4FWOA 1DGSA 1YHQN 2W41A 2J6TA 2CGJA 4XH1A 3F9MA 3DAWA 2QM1A 3T5JA 2C28A 4IO9L 1G99A 1Q82O 1EO1A 5DBAA 4YOVA 3LDAA 2IVNA 4I2GA 3BF3A 3RB3A 5DG8A 1NKCA 4BREA 3FDSA 5AQTA 4MDBA 4HYKA 9ICXA 4DL7A 3C2MA 4PHDA 1NJWA 2IIRA 4H5RA 4TQSA 2P9LA 4UB5A 5D46A 3WEEA 2Q0RA 3HT3A 5KFBA 1T3VA 5AQXA 4IRCA 4GY2B 4KH6A 5JLHA 4YMNA 3NMUA 5IIKA 4Z6EA 5AFUA 2QTDA 3TSUA 2QXLA 3S41A 4BRQA 3V6KA 3NGDA 4M47A 1RGIA 1MQ2A 4PHTX 1BPYA 1YAGA 5GIOA 4PKIA 3G4SN 2C2DA 5KT7A 1S22A 5CWRA 4HTLA 3PMNA 4UB4A 5DQHA 3LK9A 4QZEA 9ICGA 3HTVA 3C65A 1ZYQA 3E66A 4JUZA 2E1ZA 1GLLO 2UYTA 1NBWA 4RUAA 5AQMA 2CH6A 3CCSN 5J2JA 5HMLA 1U45A 5AZJA 4I2FA 5DLGA 5KFIA 1OVYA 3PO4A 4A57A 4YDUC 7ICGA 5AQLA 3THVA 4PPXA 5KPRA 4P4OA 2YCHA 4MFCA 3OBYA 3H3OB 3BF1A 1OKJA 1D8LA 3GE1A 1ATSA 4ED8A 3EPIA 3CJ1A 5KFMA 2D0PA 2YI1A 4KBOA 2DPIA 5C5JA 3PW5A 4EYHB 1O13A 4KTQA 2GWKA 3SI8A 4RT2A 3UE5A 3H4DA 3OHRA 3C6AA 4QS9A 3H1VX 1NJIO 8ICQA 5J0XA 8ICIA 4QWCA 2FLPA 1YVNA 3BQ0A 4B9LA 5J0QA 4K41A 3QEBZ 3BUZB 4YN4A 5KT2A 3CIPA 4H0XB 3VTIA 4H5NA 3FZLA 4EFHA 1N48A 9ICEA 1UA0A 1P8ZA 4FWKA 1QSSA 3CCQN 1K8KB 3FGUA 3EE9A 3K4GA 3PY8A 4DCHA 5AZIA 4J9SA 2NRZA 5HOOA 3QFPA 4B1VA 1A77A 9ICKA 2D1KA 3T5KA 1D9FA 3ORYA 3C7NB 2ASMA 4KLJA 1S0OA 3KHYA 4PL8A 1KRPA 4BRMA 2PFOA 4Z6CA 3T7ZA 4RQ0A 1S72N 8ICJA 2JEJA 1NGAA 2PFNA 2V7ZA 4CZHA 1BPBA 4F91B 3H8WA 1N8RO 3EZWA 2FMQA 3GDXA 3ZX0A 4KN7A 2XY6A 4BXOA 4K43A 5IINA 3ZDCA 3CJAA 1BG3A 2VWBA 4GC7A 8ICWA 4DLGA 1W97L 3CJCA 4DSKA 2ASDA 4IWVA 1RPLA 4NM1A 4M9LA 5KFOA 2AJQA 1GLEG 2WC9A 4ED7A 2AGPA 4MLEA 3QB0A 4EEYA 1E4GT 2YX6A 4J9QA 5AQUA 4PGYA 1R59O 3U4LA 3V7LA 2NNWA 3PW0A 2P66A 4DL3A 1S10A 1ZQTA 4ED6A 4J9LA 4OO1J 3GBTA 3JPTA 3NTUA 8ICYA 3U9DA 3HBTA 5KFXA 4IJNA 1ILYA 4MEYA 4KLEA 3KWGA 5CR0A 3KZBA 2JEGA 1TYQB 1UT8A 4C8NA 3F2KA 5D4BA 2F1JA 3EL2A 4JV2A 5F9LA 2RDIA 1T44A 4FPAA 4MF8A 4I2IA 1SS6A 5KFVA 2YJFA 4O3OA 3UKRA 3AU6A 9ICPA 8ICAA 1K9MO 7ICOA 3O08A 4YFKA 1VAZA 3O1WA 2XC9A 4ILJA 1SKSA 3QMLA 4CZJA 3JXUA 9ICLA 1KSPA 3C23A 4IQTA 3MABA 5DKWA 4OPHA 3KK7A 2Q0ZX 2ZUDA 2P9UB 5TKYA 3E1YA 1RDUA 1K1SA 1NMDA 1Z00B 5E84A 2P9KA 3RB6A 3ID8A 5L9XA 4X5VA 1U48A 2XY7A 2IHMA 1ESVA 4IQUA 2P9IA 2WTFA 3VPZA 2H3GX 2FMSA 3B0XA 4QZFA 5J2HA 4BQLA 3QFUA 3C21A 3A5NC 3JPQA 3MWPA 4JKAA 1ZQSA 1NGIA 4BRDA 3CMEN 4ECUA 4H0PA 5EX5A 3GV5B 4CZGA 5C15A 3G6YA 2V52B 3RAQA 4BGBA 2BPFA 1ZQOA 2BCSA 5AQSA 3Q7CA 1SZ2A 5J0YA 4A2BA 4GV6A 4H5WA 5EOYA 1K73O 1GLJO 2GX9A 4A2AA 3H4BA 3OJSA 4F4ZA 1S76D 3AAQA 4O8KA 3P31A 1BGXT 4YQWA 4FWPA 3TSPA 2BTFA 2D0OA 2Q36A 1ZC6A 2W8LA 3Q8KA 2IMWP 8ICPA 3VTHA 3FE1A 3MBYA 5C2DA 4I2EA 3PO5A 1S0MA 9ICBA 5F0XA 9ICCA 3V7KA 2BCQA 4DOBA 4M7YA 9ICJA 4FS2A 2I1QA 3SBTA 4B9TA 3R3LA 5I9EB 3O8MA 2QWOA 4AF1A 3ISDA 4CBWA 4QZDA 4RCHA 3VGKA 3A5MC 5AQZA 4DOCA 4QW9A 8ICKA 1Q81O 3IMXA 2ZJ8A 4C8LA 3UKUA 4WFBL 2QWPA 9ICFA 2I9GA 1NK6A 5KQDA 2PFPA 1TAUA 2AQ0A 3M9MB 1K1QA 1BVSA 2GWJA 2QW9A 5HMMA 2EWSA 3SZ2A 3JPNA 4IRDA 3AARA 4RUCA 4DQIA 4KLGA 3D2EA 3AY9A 1TK8A 5GAHP 3TQ1A 3EE8A 1QSYA 4DL6A 4BG9A 3A0IX 2CGLA 4ECXA 4QZ9A 4M0AA 8ICXA 4FBUA 1LOTB 5M1QA 3WXMB 4I2BA 1MSWD 1VQNN 3QDKA 5J2FA 2UVWA 3T3FA 5EWEA 1NGJA 1KLNA 3ZDAA 2GEMA 2RHKA 4A5BA 3CI5A 4F4YA 1QHAA 3VEWA 3RBEA 4XH4A 4Q8FA 4YVZA 2XGPA 4F4WA 4IJAA 5EY4A 4BG8A 3R6MA 2FLLA 2P9LB 3GV7B 1RXVA 4I6MA 3WEEB 4BRFA 2P9UA 5KFZA 3JPOA 4GXKA 2OWOA 2HVIA 4QZIA 4BVPA 4O0IA 9ICRA 3LDOA 2P9SA