2NRZA

Crystal structure of the c-terminal half of uvrc bound to its catalytic divalent cation
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrzA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrzA01
2UVUA 2JZBB 4Z6CA 2AU0A 4EYHB 3V6JA 2XGQA 3PO4A 4I29A 2VA3A 2XCPA 7ICPA 4YG2A 4C8NA 1A76A 1ZQKA 5DQIA 2ATLA 5DB8A 1Y88A 2NRWA 3ZD8A 2KTQA 4R8UA 2XC9A 2C22A 4B9TA 3TARA 4BWJA 3JPRA 1T7PA 4IRCA 4QZDA 4NM1A 4YP3A 4DS5A 2A1JA 3H8WA 2PXIA 2AGQA 2FLPA 2ZUBA 4RPZA 2PFQA 3RJFA 2HHVA 3ZDEA 3FYHA 4M47A 8ICFA 8ICGA 2PI5A 3H4DA 4GLXA 3PX6A 2F1JA 1L3VA 3GV8B 3PW2A 1S0MA 3TFSA 2XGPA 3SV3A 4ED7A 3JPTA 3RB4A 3HW8A 1XU4A 5KFJA 1HJPA 3EPGA 8ICBA 4RPXA 1S77D 2KZ3A 4TQRA 1RPLA 5KFUA 3ISBA 3RJIA 2PFNA 5KG6A 4QWAA 3EW9A 3QZ8A 5HNKA 1ZQAA 1IM4A 1NK6A 9ICJA 4O3PA 4ECUA 4KLFA 2AQ4A 7ICJA 1KFDA 4RT3A 5KFCA 4P4OA 5KFXA 5KFVA 4JV1A 2C2EA 4YCXA 5KT6A 5J29A 9ICQA 2VANA 1LV5A 4Q45A 4UAYA 4J9NA 3TAPA 3EPIA 1Z3EB 4R66A 2NRVA 2BCUA 5C5JA 5KFQA 3OGUA 4F5NA 3UXOA 4NLZA 4KITB 4QZEA 5KT2A 2ZTCA 1CUKA 5F9LA 3C5FA 3TI0A 2KN7A 8ICLA 1MQ2A 1HUZA 4M9LA 3ORYA 4F5OA 4DFPA 1X9MA 2XCAA 1WCLA 4YMOA 4BGDA 5D46A 4DF4A 1NKEA 2HHSA 4B9MA 3H8JA 4Z6FA 3JPPA 9ICXA 4KMUA 8ICZA 1ZQQA 4KN7A 3HX0A 1X2IA 5KFOA 4EZ9A 2KZZA 3BQ0A 4JWMA 3SI8A 4JWNA 3H4BA 3NTUA 4DL3A 7ICVA 4JV2A 1JMSA 4KLDA 4UB2A 9ICGA 2PFOA 3GV5B 3Q8PB 4DSEA 4PGXA 4K4IA 4KLIA 4DFJA 7ICFA 7ICTA 9ICWA 4KLQA 1BPYA 1BPXA 8ICEA 3H40A 5KFYA 5KFZA 4K4GA 4YD1A 4M0AA 3MABA 4J9PA 5KG0A 5KFSA 4NM2A 4PHPA 2J6UA 8ICQA 1TK8A 4GC7A 4CCHA 4IQWA 3BJYA 4F4ZA 7ICRA 1L3UA 1KLNA 1SKSA 2HHTA 5JUMA 1KFSA 5J2AA 2B21A 4I2GA 1UT5A 5BPCA 3T5JA 4ECSA 4J9RA 2FPMA 5EWEA 3G6XA 1ZQCA 5DGBA 2ASLA 5KFDA 4UB5A 1ZJMA 4I2HA 5EOZA 4UB3A 4J9QA 1S0VA 7ICMA 3C65A 2PI4A 8ICJA 3RRHA 3TAQA 4ECXA 1ZQJA 3EYZA 3RJEA 3RJJA 2DFLA 1QSYA 5J2HA 7ICSA 5DG9A 1ZQYA 4LVSA 4Z6EA 2I1QA 4KLTA 3MR5A 1MQ3A 4F8RA 5DLFA 5DBBA 3RJHA 5F9NA 4PHDA 1BGXT 2Y1JA 4KLUA 5L1KA 2AGPA 4IQUA 5L1JA 2JEFA 4YXMA 3RJGA 4EBEA 4PPXA 3GIKA 3OHAA 4LZDA 4P4PA 1XS9D 1TVAA 4BXOB 1NKCA 4XA5A 2BCVA 3BQ1A 3C2KA 4MEYA 3Q8RB 4DO9A 4DFKA 3MR2A 2BPFA 3TFRA 3SV4A 3K4GA 2BQUA 8ICTA 2UVRA 4M6WA 4RQ7A 4DL7A 2KFZA 3RRGA 3IHQB 4ZH4A 5CHGA 5KFBA 4ECYA 3HP6A 1JIHA 1S0OA 5DBAA 3V72A 4GXIA 4RQ3A 4DSFA 4ED0A 3MR3A 3PW7A 1S10A 1ZQOA 1T4GA 2R8GA 4R8UB 2BQRA 4E0DA 3KHRA 2NRTA 3QZ7A 4GXKA 1X9SA 2JEIA 3HWTA 3C2LA 1D8YA 4RQ2A 2Y1IA 4YMNA 3HT3A 5HMLA 4ECZA 4C8KA 1KTQA 4C8MA 4RQ1A 1DGSA 3AU2A 3QEAZ 3RAQA 1K1SA 4XUSA 2R8JA 2FMQA 4I27A 3Q8QB 3PW4A 1ZQUA 5J2KA 8ICYA 3GQCA 1ZQRA 1SL0A 3C23A 8ICNA 9ICOA 1ZQPA 2NRZA 4UBCA 3BQ2A 4KLSA 1ZQBA 4M6WB 3PW0A 4EEYA 2IMWP 3UQ0A 3BDPA 3V6HA 5DDMA 4XRHA 3OSNA 1T8EA 2UVWA 9ICUA 4RQ5A 9ICRA 2JEGA 4UBBA 4I2JA 4QZBA 4RQ6A 1BPDA 3PNCA 1N48A 7ICIA 1CEZA 4B9VA 4DLGA 2ZJ8A 4YXJA 1NKBA 5J0QA 4F4YA 1ZQTA 5J2BA 4YQWA 3C2MA 3UXPA 4J9MA 4R63A 1NOMA 9ICVA 3ZDBA 1TKDA 1ZQEA 4O5KA 5J0SA 4QZGA 4DL4A 3JPOA 2ZTDA 2W9CA 2BCRA 5CWRA 4TUPA 2GWSA 3ZDDA 4KN4A 1TFRA 5DB9A 4J9LA 4ED1A 4M9NA 3ZD9A 5BOMA 2RDJA 2BPGA 3LWMA 4NLKA 3ZDAA 2ZJ5A 4EBDA 1JXLA 4DSLA 4MF2A 4DOCA 3MDCA 4M04A 4P4MA 3UPQA 1U4BA 2KZMA 1BPZA 8ICSA 3PR5B 4IQTA 7ICEA 4B9NA 8ICMA 4I2DA 5KFIA 3KTQA 4UAWA 3T5LA 5J0WA 1TAQA 5DB6A 3IM1A 3G6VA 3ISCA 1D9FA 4RUAA 2KFNA 7ICLA 5KTQA 5L1IA 4F5PA 4ED2A 1U47A 1NJWA 2BR0A 2FPKA 2ZJAA 4MEXA 1ZQDA 8ICIA 1WCNA 4ED8A 4YR2A 4TQSA 4KLOA 1HUOA 2V4QA 4QZ8A 4I28A 5J0PA 2C28A 1TV9A 4JV0A 2W9BB 1ZQLA 2XO7A 8ICHA 4F91B 5KFMA 3T5KA 4NLNA 1ZYQA 9ICTA 4J9SA 5L9XA 1QSSA 2J6SA 7ICGA 2ALZA 2FLNA 3GFKB 3PX0A 7ICOA 4DF8A 3MDAA 3MFHA 2W9AA 4RNNA 4QWCA 8ICAA 3KHGA 4DSJA 1NJYA 2AGOA 3M9MB 4QW9A 1S0NA 1TK0A 1A77A 2XY6A 3RBEA 4P2HA 5KFHA 4DS4A 3OJUA 4IQVA 1L3SA 2W9MA 3LWLA 2BGWA 2BCQA 4B9UA 9ICCA 4DSKA 5J0TA 4Z6DA 3FDSA 5HP4A 1NJZA 5KG4A 4O9MA 3RB3A 3UXNA 4ED3A 4B9LA 4R64A 4DQRA 1RZTA 1U49A 3GILA 2BDPA 9ICSA 2W9BA 2MAXA 3JPNA 3RR8A 4KTQA 2P66A 4ECQA 4NXZA 2BPCA 4EYIB 4M9GA 2ISOA 4C8LA 4PGQA 3RH4A 3SZ2A 3PMLA 4QZHA 1Z00A 4UB1A 9ICMA 4KLGA 2XY7A 3QE9Y 1X9WA 3M8SA 2M9NA 4FO6A 1UA1A 4DQQA 3Q8SB 5IIMA 3OHBA 4BXOA 5KFNA 2ASJA 4QWBA 4JUZA 3ETLA 3PVXA 4BDPA 4UQGA 2UVVA 2C2DA 9ICHA 1BPBA 4RPYA 5HMMA 4GC6A 3Q8KA 1N56A 3TANA 5J2GA 4O3OA 3JPQA 8ICKA 9ICNA 2BKEA 5CJ7A 4RNMA 1QLNA 4I2AA 4JK1A 4ECRA 3Q8MA 2V9WA 2NRXA 3GIJA 5J0RA 3MGIA 5L1LA 4DWIA 4QZIA 1RXWA 4IRKA 3KHHA 5KFEA 5J0XA 1XWLA 1TAUA 5DG8A 4Q8FA 3GIIA 3TQ1A 5KT7A 4EZ6A 1U45A 1MC8A 4J9KA 1D8LA 3C1YA 2PFPA 3C5GA 1KDHA 2AQ0A 4ECVA 2NRRA 2JEJA 4RZRA 5CP2A 3OSPA 5KG3A 4G3IA 1ZJNA 1ZQWA 3H8SA 1JN3A 5DQHA 4F5QA 4KLHA 5KT5A 3V7LA 5DB7A 4YR0A 4DQIA 1BPEA 3E2EA 1COOA 8ICRA 2F1HA 4RUCA 4M9JA 2IHNA 2ISPA 5KT3A 3K75D 5DBCA 3JPSA 1S9FA 4DL2A 1JX4A 1H38A 2WTFA 3AU6A 2JZBA 4MFAA 3NGDA 4TURA 2DPIA 4QWDA 5DDYA 3RAXA 3M9NB 4O5EA 7ICNA 4DLEA 4I2BA 5J2FA 9ICPA 3THVA 2W8LA 2FMSA 8ICXA 3EZ5A 5IINA 3M8RA 1C7YA 5KG1A 5CB1A 1ZQVA 4DEZA 4I2FA 2RDIA 2HHWA 1ZQXA 5J2CA 2ZTEA 4O3SA 4FBUA 4F4XA 2BHNA 2XY5A 5D49A 4Q8EA 1NK0A 1PZNA 5KFTA 4YMMA 4R65A 4F5RA 1L5UA 3GV7B 2ZUDA 3B0XA 4X5VA 3SYZA 1UT8A 5KG5A 2W9CB 4LZGA 4ELUA 1NK5A 2R8HA 3RTVA 2DPJA 3PMNA 4O5CA 3V7KA 1MSWD 4QZAA 2OWOA 3ISDA 5KFGA 4ELVA 5HHIA 3PY8A 2I9GA 1K1QA 1S97A 3C21A 3BQTA 2HHQA 4O0IA 2HW3A 4HYKA 4PGYA 1L3TA 3ZDCA 8ICVA 4TUSA 2C2RA 3RB0A 3PR4A 8ICUA 5DGAA 5D4BA 5DLGA 3RH5A 1T3NA 4DQPA 4F2SA 3H7IA 4PH5A 1ZQZA 3V6KA 4F3OA 2VA8A 4RQ0A 2P6UA 4RU9A 1NK7A 4I2IA 4QZCA 5IIOA 1SKWA 4PHEA 4M2YA 5J2EA 4KLMA 7ICKA 1RYRA 4QZ9A 4I2EA 3V7JA 3B0YA 2IHMA 9ICEA 8ICOA 3MGHA 2BQ3A 4KLEA 2MUTA 4YR3A 4B9SA 1B43A 3MBYA 5KG7A 1RYSA 9ICBA 3AUOA 2HVIA 4O3NA 1NK9A 1NK4A 3PW5A 4F2RA 4RQ8A 4DOBA 1SKRA 7ICUA 1XSLA 2HHUA 5EWGA 3MR6A 4DQSA 1KSPA 4ELTA 4MFCA 1BVSA 4QW8A 1XO1A 2W8KA 5J2DA 4YD2A 2BCSA 4F93B 2HVHA 5KFFA 4IR1A 4TUQA 3EWAA 4DOAA 4BWMA 5KG2A 1XSPA 2AJQA 4UB4A 4MF8A 2J6TA 4O3RA 9ICKA 9ICIA 4DL6A 1ZQIA 1ZQHA 1IXRA 5DKWA 4J9OA 2P6RA 5CR0A 3MFIA 5J2IA 7ICQA 5J2JA 4DFMA 2IA6A 5HHHA 4FS1A 5KFRA 4EBCA 3RH6A 1ZQMA 1EXNA 5IIKA 4IRDA 2FPLA 4Q44A 4F92B 2MUTB 4NY8A 4UAZA 5CA7A 5KFPA 4I2CA 4Q43A 1SL2A 4K4HA 2ZUCA 5EWFA 1XSNA 4F50A 3HPOA 4DL5A 2IBKA 4YN4A 1ZQNA 5J0UA 3GDXA 1U9LA 3N4MB 4YVZA 1V9PA 4DSIA 1Z00B 1KFTA 1AROP 3RB6A 2H5XA 2ASDA 3M9OB 9ICLA 1UA0A 3T5HA 4GXJA 2LYHA 5KT4A 1DOQA 4NLGA 4M9HA 4F4KA 4QWEA 4YFKA 3GIMA 4FS2A 1ZQSA 1LB2B 4F4WA 5DG7A 5KFWA 4KLJA 2HHXA 4XQ8A 3RJKA 4O3QA 8ICPA 3QEBZ 5IIIA 1NK8A 1SL1A 7ICHA 2Q0ZX 4FBTA 3Q8LA 4RQ4A 9ICFA 5J0OA 1RXVA 2FLLA 1ZETA 3UQ2A 3N97B 1ZQGA 5J0YA 4KLLA 5TZVA 4RNOA 1NJXA 4MFFA 1B22A 4RT2A 3RBDA 1D9DA 5BOLA 4ECWA 5DQGA 2R8IA 9ICAA 1KRPA 2FMPA 1S76D 2VA2A 4QZFA 4IR9A 3G6YA 5KFKA 5KFLA 4ED6A 4PHAA 5IIJA 1XC9A 3PV8A 2A1JB 1QSLA 3LK9A 5IILA 1U48A 3PX4A 2R8KA 4ECTA 8ICCA 1SZPA 5KFAA 4C8OA 3LDAA 1TK5A 3KHLA 1QTMA 8ICWA 3OJSA 2V4RA 3T3FA 1KEJA 2F1IA 3PO5A 3RR7A 1ZQFA 1JXEA 3C1ZA
chains in the Genus database with same CATH superfamily
4RWTA 4Z6CA 5ALIA 4EX7A 2AU0A 3V6JA 3PO4A 3HM8A 5FROA 4CEAA 2W41A 1XNRK 2VA3A 3OYFA 3O5BA 4C8NA 2HBLA 5DK5A 1A76A 2DBYA 3CW2C 4E3SA 4B3SK 4WFNL 4H4MA 1OVYA 3V81A 5E79U 1J53A 1K8KB 3CJ9A 4QS8A 1JCFA 4R8UA 3TPQA 4GV3A 3TAMA 4NL9C 2HBMA 4IRCA 4QZDA 3FM9A 4KI6A 2WOMA 1YJNN 2B6AA 4ILHA 2AGQA 3QEWA 3NVKA 3NGYA 3KKAA 4RPZA 2PFQA 1K5OA 3TKAA 4M47A 1YVUA 5ALRA 3UMGA 3O4NA 2EAMA 4DR5K 2OPPA 3VQCA 3NHGA 3UIQA 4USAA 3H4DA 4GLXA 2PI5A 4KBOA 2F1JA 4WQ4C 3D2FA 1S0MA 1YAGA 2QARB 3TFSA 3MMVA 3QIPA 1JI7A 4JI2K 1P7DA 3EPGA 1IKXA 5GIPA 4RPXA 4JS4A 3R1XA 4FW1A 3AN1A 1RPLA 4JI5K 4QWAA 2ZIUB 1RYUA 3HPHA 4M41A 3EW9A 2ITMA 4CFBA 4B3MK 3ZX2A 1JCGA 3VEXA 4BRMA 1SQKA 4CHYA 3O3FA 3HILA 9ICJA 3SNNA 1J6ZA 2EZYA 4UAUA 5AQFA 3TAFA 4DR2K 1CXQA 5J29A 3E1YA 5BR8K 1LV5A 2WF8A 5AI0A 4CHPA 4QJFB 1C0UA 2NRVA 4FFDA 2E1FA 3K5OA 4FWMA 3G10A 3UXOA 4BRHA 5EY4A 2ZTCA 4GKKK 3TI0A 1WSJA 1MQ2A 1D5AA 3SJJA 1JJ2M 3KD3A 1X9MA 4BJQA 5C25A 4J8FA 3WXJA 3CCLN 4Y2VA 4DF4A 4YOVA 5LMNK 3PSPA 4B9MA 3H8JA 4Z6FA 3JPPA 1W2BM 2W7PA 1N5WA 1X2IA 4HCBA 2KIVA 3AA3A 2D0BA 2Z1HA 1K73O 3SMVA 5AM1A 1ASVA 1W7AA 7ICVA 1Z19A 4DTSA 4JV2A 1JMSA 2K4HA 3GV5B 3EEQA 5T14A 3Q8PB 4DSEA 3FZHA 3OHRA 5AKKA 2P9NA 3OBYA 2I7NA 4KLQA 2H3QA 1BPYA 3ZT0A 3V6DA 1XI1A 2GOLA 4IG0A 4H0VB 2VJ4A 4C80A 2KV2A 3M1YA 2YKMA 3QEIA 1Q18A 4BRLA 4B6JA 5KRSA 4DTXA 5F2RA 8ICQA 4GKJK 1TK8A 3F2BA 4QS7A 2G8IA 4F4ZA 1KLNA 1IG9A 4KX5A 4O8UA 4H5VA 2EDUA 3SMSA 3OS0A 4FZYA 1KFSA 4YNQA 2B21A 4BREA 1UT5A 1XUPO 2FPMA 3VN5A 3KWGA 1TL1A 1Y64A 2F9TA 5KFDA 1PK3A 4ZTJA 3DM2A 1OH8A 3THXA 3MAQA 1T03A 2QWLA 2A40A 1LAVA 3LL3A 3U9DA 5AQZA 5HRPA 8ICJA 3RRHA 3TAQA 3KZXA 3RJEA 3K2PA 3RJJA 1MU2A 4U67L 3DDHA 5J2HA 5DG9A 4DR1K 1ZQYA 5GTIU 5T7BA 1A5WA 2CGKA 3C6TA 3MR5A 1CZAN 3L8BA 3MK6A 5DLFA 2A3VA 4MDBA 2I5JA 4PHDA 3WEEA 4A2BA 1BIUA 4FJ5A 2JEFA 2FBYA 1I94K 1BCMA 3OHAA 2VWBA 4LZDA 1XS9D 1TVAA 4BXOB 3NVYA 2BCVA 2OXOA 1WAFA 1DKGD 1I39A 2YY6A 2A6AA 4AYBF 1X3MA 4DFKA 3MR2A 1RNHA 1FFVA 3K4GA 3THXB 2FSNA 2V7ZA 3QFPA 4A5BA 4RQ7A 1JL2A 2AP1A 2D0OA 3NF7A 4FLWA 1ZBHA 2X78A 3IHQB 2P9KB 3ITHA 5CHGA 3DLBA 3I8DA 3CC2N 1TUUA 2YHYA 2P9IA 5KL8B 1UHUA 4WYBA 5KI6A 3UMCA 4LFCK 2XVTA 4G9ZA 1X9SA 1WSIA 2WB1F 3VF6A 1HLUA 3M6GA 1BISA 3I33A 2DFEA 4LF8K 3RAQA 1DTTA 2NRHA 1JXBA 5FRMA 4BE1A 5AQXA 4Z4FA 3GQCA 3AARA 4FLTA 4GVMA 9ICOA 1C1AA 1WOQA 1ZQPA 4UBCA 3IV6A 4KLSA 3MEEA 1SV0C 2K8CB 3V6HA 3JAMO 5DDMA 1DEJA 3OSNA 1M1KO 1T8EA 2UVWA 9ICUA 1OVQA 3U3GA 2JEGA 1RT5A 2Q97A 4RQ6A 2WONA 1BPDA 4KHYA 1Y97A 5ALQA 5HBMA 4H0OA 5AKZA 4FWPA 4JI3K 5J0QA 3EE9A 5J2BA 1NGHA 3C2MA 2HF4A 2CGLA 1O13A 1NOMA 9ICVA 2YV0X 4E7JA 2PYLA 2H3VA 4CF3A 5J0SA 4QZGA 4DL4A 3JPOA 5M1KA 3A8YA 4O55A 4OJ6A 2BCRA 4BGBA 2FBTA 4DTPA 1VQKN 3MXJA 3IDHA 1RDBA 4FWKA 4KN4A 3V9WA 1TFRA 5FPNA 4ED1A 2KHQA 3H0MB 2RRDA 4JKGA 4OCZA 2ZJ5A 2B5JA 3VQ7A 1FIQA 3C94A 4MF2A 1JCEA 3H3OB 4DOCA 4FWOA 2ES6A 1RBTA 4P4MA 4ILGB 1BPZA 3PR5B 2OZSA 2F4VK 4WJ3B 8ICMA 4EENA 3BF3A 3B6OA 3KTQA 4UAWA 4CZKA 3G6VA 4CEEA 4DTUA 1ILYA 2EAPA 4QIWC 5B5EU 7ICLA 1IV8A 2XICA 5AK4A 4ED2A 1U47A 1NJWA 5M1PA 3OYCA 4ED8A 1VSDA 4WF9L 2V4QA 3SPYA 2VQFK 4QZ8A 3VQ6A 3M6ZA 2C28A 3MEDA 4Z4GA 1TV9A 5AQGA 4DTOA 4JV0A 3LDOA 4C7ZA 2W9BB 2XO7A 2E8AA 3HXMA 5AK5A 4A5AA 1E4FT 5JTIA 5EOYA 2QK9A 4J9SA 3L0QA 1MA9B 5L9XA 4CHNA 2ALZA 3GFKB 3QLHA 2Q1NA 2E2OA 4O0JA 5AQYA 3ULEA 8ICAA 4AHTA 3KHGA 3F9KA 1IG8A 5D3GA 3L4PA 3VQPA 2O8BB 4BR7A 1TK0A 1A77A 3RBEA 1LW2A 5KFHA 2W9MA 3CQXA 5FLXO 3AVKA 5KPRA 1NJZA 3R6MA 3RB3A 4B9LA 1KVAA 4Z94A 3CETA 1RZTA 1N62A 3GILA 4X65K 1X42A 1SZ2A 3JPNA 3RR8A 4CBWA 3SAGA 1S72N 2E8OA 4LJXA 2WF9A 4M9GA 2YHAA 4DFDA 2Q31A 4ZHRA 4DTRA 2H3GX 3HPGA 4PGQA 3RH4A 3PMLA 4QZHA 4Z4HA 2RLTA 3SQ0A 2CN1A 3F53A 2QB0A 3CP8A 2M9NA 4FO6A 4CZIA 4OGCA 2K8BB 3OHBA 2OANA 1SV4A 2ASJA 1NI3A 2QM1A 3VGLA 4AYBC 9ICHA 1BPBA 4BRQA 4GC6A 4RQMA 3JPQA 2OYQA 2BKEA 5CJ7A 1NGIA 3CI5A 3ZYYX 4IDKA 4J2BA 4ECRA 1RT2A 3R9KA 5AHXA 3MGIA 3WXIA 4PUOA 4A59A 1WB9A 3MWTA 3KHHA 5KFEA 4U6PA 5J0XA 1XWLA 4YDUC 5DG8A 4FZXC 5KPTA 3GIIA 2P9IB 3VTHA 4CGGA 1U45A 2PMZF 1D8LA 2IOFK 3C1YA 1YTAA 2Q3SA 2AQ0A 4JI6K 2JEJA 2I7PA 3OSPA 5F0XA 3TR8A 1CZ9A 4DU1A 4IFYA 4AQYK 1ZJNA 4CJRA 1J5EK 3ALYA 1JN3A 2A3ZA 1QZ6A 1BPEA 5AQPA 2G8HA 4E1JA 1GOAA 2Q4TA 1P8ZA 1JX4A 5DBCA 4KTZA 2HB5A 2RE2A 5KGWA 3BS5A 3CFOA 3AVNA 2JZBA 4MFAA 3SBGA 5AFUH 4TURA 1ATNA 2ETJA 3ENBA 3ZSRA 2G06A 5DDYA 5KL1B 3HJEA 4O5EA 7ICNA 2VKQA 1NGBA 4K43A 5J2FA 3M8PA 4RW6A 3VERA 4CEFA 4DV4K 2W8LA 2QKBA 5C12A 4U7BA 1ZQXA 3O0FA 4E7KA 4DUZK 1ATSA 2XY5A 1SV0A 2K4EA 5D49A 4PJ0U 4AF1A 4R65A 3GV7B 4X5VA 2KJ9A 4LZGA 4ELUA 1NK5A 1IKWA 2E2QA 4EIAA 5LJVA 5TKWA 3M8QA 4MLEA 3QYPA 2YHBA 1S9EA 2D0CA 4M7YA 4Y2YA 5EE1A 5KFGA 2KEYA 4ELVA 4OGEA 5E41A 4LF4K 1MA7A 3G71N 4B3TK 4LH4A 3C21A 4KHQA 2O8CA 2HHQA 2KHOA 4MHVA 2WC9A 4LD0A 3WKCA 2HW3A 1IJJA 1N36K 2C2RA 3LYSA 3PR4A 3UB5A 4C4RA 2A41A 1SV5A 3OYAA 3V6KA 4CZEA 1X40A 1NK7A 4BACA 4I2IA 4JK9A 3VF4A 4PHEA 4M2YA 5J2EA 7ICKA 2QWMA 1JROA 1S8OA 1HNVA 5AKYA 4CI6A 4CZHA 3B0YA 5AIBA 2IHMA 4E19A 3QU9A 3ZETB 4KLEA 4AH9A 4YR3A 4CJ3A 2BDUA 1RYSA 2VG7A 4CFDA 7ICUA 2OTLN 1NK4A 4RQ8A 1SKRA 3VCBA 2HHUA 3MR6A 4DQSA 4MFCA 5DMRA 2VQEK 1NLVA 1GLLO 3THWA 5J2DA 4BRNA 3BP8A 4IR1A 2DKXA 2ZM6K 4FK4A 2HNZA 3UE5A 4JKBA 3FFKB 2J6TA 4N41A 3G0ZA 4OJLA 1ZQIA 1K9MO 1IBLK 5BRDA 3ISNC 3L5KA 5JRTA 5J2IA 4G1QA 5J2JA 4DFMA 3KD5E 1V85A 1C0MA 3CF5L 4K8XA 3OA9A 3E9LA 4KB0A 2F2AB 2GUIA 4MO4A 4J03A 4M3UA 4F92B 2MUTB 3D2QA 4UAZA 4H4OA 4Q43A 3DLKA 2WB1C 4EEKA 1T6DA 4CJTA 4ACOA 5AKEA 3THWB 4OLAA 4BR4A 2J4RA 1ZQNA 2OEHA 3J80O 3CC4N 3QERA 3GDXA 1U9LA 4K41A 5F1XA 4NCAA 4DSIA 4W5QA 3DYAA 1QVFM 1ZD4A 3SLCA 5ALWA 3IRXA 5GAGP 5EXWA 4CZJA 3ZEUB 1UA0A 4C4TA 4WCEL 2D3DA 3U9ZA 3E01A 4OO1J 4F4KA 3QX7A 4QWEA 4YFKA 1GLAG 4UARA 1LB2B 2HHXA 1DGKN 5ALHA 4XQ8A 1ZBFA 3RJKA 2EZXA 5L1MA 2KKZA 3EKSA 2VIXA 5J1EA 4GFJA 4OLBA 2D8CA 1NK8A 7ICHA 1S6QA 3J7AP 4KH6A 1DK2A 4B1VA 2NO5A 3Q8LA 5GADP 3OYBA 1A5XA 4BE2A 4CBUA 4EFHA 3ZSQA 3IDWA 1YF5L 4WE1A 3IKMA 3AV9A 5TZVA 4MFFA 1B22A 5FPDA 2H3IA 1D9DA 2QWPA 4ECWA 3A0IX 4FWNA 2R8IA 1K8KA 3FLCO 1GLJO 2JGUA 2FF3B 5AK6A 3DLGA 1JLFA 2WFBA 2OPQA 5KPZA 1RT4A 3M5RA 5IIJA 4NCGA 5FPEA 5IILA 3P39A 1Z25A 4W5OA 4YDUA 4MFBA 1TK5A 1N61A 1YHQN 3T3FA 2KQ2A 2B6GA 1XC3A 2QARA 5ALLA 2F1IA 3PO5A 2FSJA 3NBPA 3RR7A 3KJVA 2XHBA 4FK0A 3ID6A 1JXEA 5JS1A 2JZBB 3VPZA 3OTQA 4O5FA 4CHOA 5AQTA 2XCPA 1BWFO 4IFVA 3P38A 4YG2A 1GO3F 1QZ5A 3QBXA 1ZQKA 5A0LA 2ATLA 1M6YA 5DB8A 4I2QA 3P83D 3M7DA 2NNWA 2NRWA 2KTQA 3KKRA 4NXNK 2Z1IA 2WHEA 4P0QA 2C22A 3DLEA 3PSFA 5AQWA 4CBXA 4BWJA 2A19A 2ASPA 2ZQBA 4MDAA 2QWRA 4YP3A 4OPKA 2QWQA 3LDNA 2A1JA 3RVCA 5AK3A 2FLPA 2QW9A 2ZUBA 3ZSXA 3DXMA 3VGKA 4ILJA 3FYHA 3TWHA 3ID8A 3PX6A 3H1VX 3GV8B 1FW6A 3HKZF 3A2FA 1E3MA 3UM9A 4Y2JA 4BR5A 2GEMA 3F5TA 3VQEA 3RFAA 1XU4A 2A5XA 1HJPA 2UUAK 5CY4A 3F73A 3F2DA 1BNOA 3ISBA 3RJIA 4DV3K 5E26A 4IZ9A 3TSUA 3G25A 5HNKA 4FJMA 1ZQAA 3CHWA 5LY3A 1NK6A 5I9EB 3QFUA 4O3PA 4ECUA 4KLFA 2I5HA 1RBVA 4PQUA 3A5MC 5KFCA 2LSNA 5KFVA 4YHHK 4JKAA 2VANA 5GINA 1ZD3A 4J9NA 3CG7A 1Z3EB 3MGVA 5KFQA 3OGUA 4F5NA 4JRPA 1YI2N 3O4QA 5F9LA 5AZIA 4FOEA 1DLOA 3RF9A 4M9LA 4IKFA 4BG9A 4DFPA 1NGEA 3NMUA 3PZPA 1IBMK 3IMXA 2PKEA 2YMPA 4QCLA 1FO4A 1YZ6A 3CFRA 3DLLL 5CE3A 4KN7A 4CJSA 1F0MA 3CD6N 4LFBK 2KOBA 4GVEA 3C6AA 4EZ9A 1W97L 4JWMA 3SI8A 3KK2A 4FM0A 3TABA 5CZ2A 3ZT2A 2ZWHA 1VQ5N 4JNEA 3H45C 4UB2A 9ICGA 3SAHA 2GH1A 2DFFA 1LKYB 4PGXA 4KLIA 3C7NA 7ICFA 3VQAA 3N7PD 5ALKA 1HYVA 3TTCA 1KD1O 1RT1A 1JRPA 5KFYA 5KFZA 1YTUA 4K4GA 4YD1A 2BANA 2UUBK 2G5IB 5KG0A 4I7FA 2RHFA 4B8CA 2J6UA 1B9DA 4I2PA 3NAEA 1LWFA 3BJYA 4FYDA 1MDUB 4CJ5A 1L3UA 3PLAA 2W6LA 1YITN 4LFAK 4FZNA 4KMOB 3MN5A 5J2AA 5BPCA 4JB3A 4ECSA 3I55N 4FCYA 1J2NA 2ASLA 1UOCA 4I2HA 3KBBA 5EOZA 1NWKA 2YNIA 5AQQA 3C65A 4HUGA 3OYEA 4ECXA 5ALOA 2KNJA 1RT7A 1S22A 3AA4A 4FZLA 1VHXA 1IV0A 1P90A 2I1QA 3NF9A 4CVNE 4IG3A 4Y2SA 1LVHA 1MQ3A 4F8RA 4UASA 5AKGA 5DBBA 3SQIA 4EX6A 4KLUA 4IQUA 1MWKA 3ZSYA 4PPXA 4YXMA 3GIKA 2YX6A 1W9HA 3K1ZA 5EVZA 2KMDA 2BTFA 2LPEA 4NB4A 2NLXA 5LL6Z 4W5TA 1QVGM 2QTDA 3MN7A 4AP9A 3J7ZO 3UMBA 2UVRA 4DKWA 4ZH4A 3BEXA 3LANA 1VSIA 5AQRA 1ITGA 3DRSA 3LZJA 3V72A 4GXIA 3PW7A 1ZQOA 3AVAA 1T94A 5H2FU 1Z4NA 2D5RA 3G4SN 3KHRA 1NGCA 4GXKA 2JEIA 5BRHA 3HWTA 5ELZA 3BF1A 2QKQA 3J81j 3KHYA 4NLBA 1VQ8N 3VMFB 4X64K 3NFAA 2MRLA 2HDOA 2R8JA 3LVWA 4F3TA 3NH0A 1DGJA 1SL0A 1BDGA 2G09A 5HOOA 1HRHA 3KZBA 4DV2K 4B1UB 4QOZB 2YX8A 3PW0A 4EEYA 3AGRA 3ASMA 2UUCK 4UATA 3MN9A 4Z0UA 1Q9YA 4XRHA 9ICRA 5HRSA 4H8KA 7ICIA 1N48A 4XIUA 4DLGA 1YVNA 3DLHA 5AIAA 4J2DA 3EZWA 4M3RA 2LMRA 3K5MA 2O8DA 1UAXA 4RW4A 3ZDBA 1TKDA 1ZQEA 1F5SA 3KZIU 3BUZB 1JLBA 3VTIA 4KHPK 3MXMA 4JKHA 3V9ZA 5DB9A 3KLIA 1C1CA 4GMJB 3ZD9A 3CCRN 5BOMA 2BPGA 4NLKA 3TTDA 3NF6A 3ZDAA 4AHUA 4QNLA 4EBDA 1VRTA 3EE8A 5ADXH 3IG5A 3UPQA 2QWNA 4BROA 1B0XA 4PY5A 1PK1B 1EO1A 1TAQA 4PL8A 2DTUA 4OKJA 3ISCA 3Q7BA 1G99A 3ULEB 3VOVA 4KHSA 2KFNA 3LDQA 4EAHD 1KVCA 1D8BA 4F5PA 1K8AO 2ZJAA 1ZQDA 3LVVA 1IKVA 2VWJA 4HHTA 2E88A 2P51A 3TSQA 4JKDA 1WWUA 4KLOA 1J2MA 1BIZA 4DU4A 4M63C 2KHVA 5J2MA 4I28A 4H0PA 3F9MA 4F91B 4FJKA 5MLCQ 5ALMA 4NLNA 2IOHA 1ZYQA 9ICTA 1WUAA 5ALYA 4WQ5A 1BG3A 1WSGA 2J6SA 2E1ZA 4JV5K 1FK9A 4NYNA 1JLEA 3MECA 4EHUA 4BRKA 5CR4A 2KICA 2W9AA 3LDLA 3V9UA 2GTDA 3CJ1A 2YJEA 3FGUA 1ECWA 4C0ZA 1S0NA 3AM9A 4K42A 3AA2A 2ATQA 4DS4A 1BI4A 1U2VB 5JLFA 1KXPA 1ZBUA 2EWSA 9ICCA 4A8EA 4DSKA 3ENHA 3CNHA 1Q46A 2LYAA 3QO9A 5AKLA 5KG4A 4Z4IA 4ED3A 4R64A 4DQRA 2CH5A 2BDPA 9ICSA 2W9BA 1BQMA 2MAXA 2E1YA 2IGIA 1EQYA 2P66A 4ECQA 3ZSVA 1C1BA 1S5JA 4C8LA 5ALGA 4E89A 4CFCA 5AZJB 3SZ2A 5EE9A 4FL9A 4LSLA 1Z00A 2DWQA 3OYNA 3SI6A 4NV0A 3RWUA 3CFPA 3QETA 4CEOA 5KQ8A 3M8SA 1YIJN 1GOBA 2XY8A 3V1RA 5I3UA 4DQQA 4OJ5A 1N33K 3PSTA 1WWVA 3ETLA 4BDPA 1C0FA 5BR9A 3ZX0A 3V9XA 1N2XA 4JAXA 5HMMA 4RPYA 3LDPA 1N56A 3TANA 2W42A 9ICNA 5AKHA 4DUYK 3Q8MA 4LC9B 5L1LA 3QU4A 1JLAA 4BC4A 1RXWA 3KFUF 1T3QA 1UPHA 3CCSN 4HWIA 1RG6A 4CW7B 2OA8A 4CF1A 2W55A 2PFPA 1ZRNA 4ECVA 3AQFA 3L3FX 2IVOA 4DV6K 2DF4B 2GWJA 3QBWA 3T69A 3OTOK 5KG3A 4QIWF 1D4XA 4B3RK 2GWKA 2YKNA 3T19A 3HRDD 5DQHA 4F5QA 4E7IA 4AM7A 1OW5A 3V7LA 2F3NA 5DB7A 4YR0A 5AKJA 1COOA 4RUCA 1J5OA 2D1KA 2ISPA 1HKBA 5AQMA 4M45A 4IFEA 1TKTA 3AO2A 2Y0SC 4KHUA 1VQPN 1RDDA 3KIOA 2Y9UA 4QWDA 2E5SA 1KW4A 2UXDK 1VJ5A 4UW9A 3VQ4A 4JS5A 3SQ4A 3EZ5A 1C7YA 5M1NA 3PSIA 2RDIA 3O9SA 2ZTEA 2F8KA 1DRGA 4DMNA 5KFTA 1L5UA 2KG5A 4C1NI 3HO1A 3SYZA 1Z4OA 2GO7A 5KG5A 2W3RA 2W9CB 3F2CA 4KH4A 1SIJA 3D45A 3PMNA 1WN7A 2YMMA 4P0PA 1MSWD 4JI0K 3ISDA 1T44A 4CGDA 2ZJPL 1QS4A 2ASMA 1PUZA 1RT3A 4FJ7A 3R8EA 3SPZA 4Y1DA 4DR7K 2KSOB 3BQTA 3VETA 1ZD5A 4HYKA 3DLRA 1XMQK 5AI4A 3ZDCA 1JLQA 8ICVA 3AVCA 1Q82O 3RB0A 5DGAA 5D4BA 1HMVA 5DLGA 3ZCMA 3RH5A 5JMVA 1T3NA 4F2SA 4PH5A 5CEHA 1ZQZA 3L2RA 3OYHA 4F3OA 4NWIA 2YNHA 4HTLA 4KLMA 4YOTA 3NVWA 4AHRA 4QZ9A 3U8XA 3L4QA 3H0LB 3IG1A 8ICOA 4B9SA 3WNEA 3RSEB 4GW6A 5EE0A 2HVIA 9ICBA 2YB1A 4O3NA 1NK9A 3FAHA 4DOBA 3U6FA 1XSLA 3RMAA 1L6NA 1KSPA 2CXYA 3KD1E 1BVSA 3CCUN 2G0AA 2DUYA 4IDHA 4CJKA 3CC7N 2ASOA 3N28A 2OPRA 4DOAA 3EUB2 5KG2A 1XSPA 2Z1JA 1TYQA 4I9QA 2F8LA 4MF8A 2QXLA 3SBTA 5C2FA 3DV9A 2KIWA 3EL2A 4WQ5C 4YY3K 4Y2XA 2G8WA 4E1MA 1NBWA 4FS1A 4IXCA 5KFRA 4EBCA 1KKXA 3QU2A 1SWVA 5CRXA 3K1RB 4RTFD 2F44A 3ZSZA 3NUQA 1B4FA 3L4IA 4DHYA 4IRDA 2EANA 5ALFA 5CA7A 5EU7A 5KFPA 3SMPA 2WF7A 1VDVA 2ZUCA 4K4HA 3C28A 4FWRA 4F50A 1RDWX 3HPOA 1Q8IA 2QEXN 1QQCA 4ID1A 4XH1A 4L8RB 2LM1A 3HRGA 2X74A 2W6KA 1N5YA 2HCFA 3D2EA 3N4MB 1X6JA 2XRIA 1V9PA 4BRFA 2HF3A 5FDLA 1AROP 3T79A 2OTJN 3RB6A 3OS2A 2ZJRL 2H5XA 2ASDA 4FJ9A 3M9OB 3AO4A 3OYKA 3TSPA 2LHTA 4GXJA 3T5HA 1SUQA 4M9HA 3GIMA 4FS2A 4CGJA 4CK2A 4HVJA 4GV6A 3IFRA 2OZMA 1KAYA 4FLXA 3QEBZ 1E4GT 5IIIA 1DT9A 5ALEA 1RILA 2IS3A 3GOIA 3VEOA 3SUNA 3KWIA 5J0OA 1ASWA 1RXVA 4J2EA 1HKGA 2W40A 3N97B 3OS1A 4Q0BA 3C6UA 3WQTA 2HBKA 3RMCA 4RT2A 5AI5A 1KBUA 3OYDA 3A0HU 3O08A 4Y2TA 9ICAA 4NLCA 3D2EB 3ED5A 3NASA 1KRPA 2CGJA 1S76D 1HX1A 4QZFA 3R9PA 2MU2A 3G6YA 3TTFA 1VK0A 4CZFA 5C15A 1VSKA 1XC9A 1RQLA 3PV8A 2ZGZA 3CM5A 1SGGA 1U48A 3K58A 3QESA 1L8OA 4CK1A 4ECTA 1T05A 2QLTA 3MC1A 4C8OA 1QTMA 2E20A 1VQNN 5K4LA 2FJ6A 1KEJA 2P9UA 3I56N 3TAEA 4DTJA 2HOQA 2UVUA 3CPWM 1FKOA 3P1GA 3OYGA 3VQ9A 4I29A 4WFBL 7ICPA 1L7NA 4C23A 1ASUA 4KX3A 1QE1A 2YHXA 3U4LA 4QAGA 1J97A 3VEVA 2XC9A 3MEGA 1F44A 4B9TA 4IJAA 4IEIA 3TARA 2EZZA 3KKSA 2RP5A 1T7PA 3IUCA 4NM1A 5HRRA 3O3GA 3CJCA 3H8WA 2JMGA 2P5OA 2HMPA 3RJFA 2HHVA 3IG8A 1S1TA 8ICGA 3C0BA 3ZX3A 3QUBA 2JWLA 3NCIA 3FZMA 1IBKK 3G6EN 1ESVA 5HR7A 2OM6A 3DWLA 1NMNA 1QQOA 2BGGA 3B9JA 3JPTA 3RB4A 3HW8A 3C95A 4NL9A 5KFJA 2W43A 4AHVA 4US9A 2KZ3A 3AVLA 2ZXIA 4TQRA 5KFUA 1KL9A 5KG6A 4CNQA 1BOTO 3EN9A 4YOYA 3AVMA 2QI2A 5JVGL 3QZ8A 2Q36A 3KVGA 4B8AB 3PIPL 1V4TA 4UB6U 1KFDA 4RT3A 4P4OA 5KFXA 1EKEA 2C2EA 1TGOA 4YCXA 5KT6A 5KRTA 4FOIA 4CD1A 2ZE2A 3TAPA 4UAYA 4KTWA 5JVHL 4CIGA 5CZ1A 3S3OA 4LF6K 4TSXA 4R66A 2I6XA 1EXQA 1N63A 2K60A 2LBOA 2H3ZA 3ZI4A 4KITB 2PMZC 1CUKA 8ICLA 1S6PA 4O4GA 3KLGA 1YJWN 2PZSA 2Y9TA 3ZT4A 2XI9A 4PWDA 1WCLA 4YMOA 4BGDA 5D46A 4ID5A 1RQNA 3HVTA 4FJNA 2HHSA 4OX9K 1JALA 1GLDG 3RMDA 3SQ1A 4KMUA 4B1ZA 4CDGA 4CRXA 1ZQQA 3HX0A 2JHDA 1ZBLA 3H0RB 4CERA 5KFOA 2KZZA 3BQ0A 3TU5A 1NGJA 3S6JA 3E9PA 3IAYA 1XO0A 4BR9A 1NM1A 1WYGA 4KLDA 3DMJA 4BY9C 4M3WA 2AH5A 2PFOA 5JS2A 4N47A 1ZOLA 3CYMA 1NGFA 4DFJA 5C0YA 5LJWA 1Z05A 4ISEA 4JI8K 5ALJA 3H40A 3QU7A 5KNIA 5AM3A 3NDKA 3MABA 1SAZA 4J9PA 1Z26A 5KFSA 4KH5A 1KN5A 4CGHA 4GC7A 4CCHA 1S1VA 3CM6A 5BN8A 1ZBSA 7ICRA 3D2NA 1SKSA 2A1SA 4HUEA 1Q8KA 1O1WA 2CH6A 4EHTA 5JUMA 4H0XB 4E7HA 4I2GA 3T5JA 4J9RA 3AO1A 5HL7L 5EWEA 3G6XA 4UB5A 1ZJMA 2KJ5A 2YQEA 4UB3A 1S0VA 1LKYA 1EWQA 2PI4A 5AQJA 3AO3A 3VC8A 1ZQJA 3NE6A 2G8UA 1ZBIA 2DFLA 2JXJA 4H5WA 1QSYA 3WNHA 4CFAA 1Q3UA 3I28A 3UKUB 4BDZA 4LVSA 2VYPA 4Z6EA 4KLTA 4BE0A 4DR4K 3RJHA 5F9NA 2E2NA 5DM7L 3OY9A 1BGXT 2Y1JA 2AGPA 5L1JA 1UCVA 5BN9A 4EBEA 4BX9C 4XA5A 4FZMA 3WKAA 3BQ1A 3WKDA 1BHLA 4MEYA 5SZTA 4DO9A 2EHGA 4X66K 4BDYA 3SV4A 2BQUA 2QWOA 4PA1A 3HTVA 4M6WA 1FEZA 4BVOA 5EX5A 2KFZA 2NO4A 2WFAA 4PL1A 1KLMA 3OPXA 2GELA 2DGZA 1RFQA 2NUBA 5AQNA 5KFBA 4ECYA 1OUQA 4L3QA 3VQ8A 3HP6A 1HQUA 1JIHA 4JD2A 5C10A 4ED0A 2YB4A 9ICMA 3CCJN 1S10A 3WQUA 3MR3A 3L3UA 5M1FA 2R8GA 2BQRA 4E0DA 4P0QB 3CCMN 2EX3A 4JKFA 3I8BA 5BRFA 3C2LA 1D8YA 1IH7A 3CJBA 3T1AA 3WEEB 4YMNA 1URJA 3HT3A 5HMLA 1N5XA 4ECZA 2FLOA 1S1XA 5IWAK 4C8MA 4CJ7A 1VLBA 1XQSC 3QU5A 4RQ1A 3A5OC 2F8TA 2FMQA 2FC0A 4BUGA 3Q8QB 5J2KA 3PW4A 8ICYA 3KK3A 4FJLA 4K8ZA 1ZQRA 3C23A 8ICNA 2Q2RA 2XIDA 2P35A 3NVMA 3CXCM 5J2QA 4V19S 3ENOA 3QINA 3OYJA 1KQQA 5I42A 3UQ0A 3BDPA 5AR0A 5ALNA 5KGXA 3GDQA 1G15A 4RQ5A 4UBBA 3DOKA 4I2JA 3PNCA 5JICA 1PK1A 2O8FA 4F4YA 5AJ3K 1TKZA 3O9RA 3WT0A 4JHDA 3K9JA 4CEZA 3UXPA 4J9MA 4R63A 1BCOA 3VEZA 4CJQA 1NOYA 3HSCA 4RG8A 2E3TA 2W9CA 3IRUA 3QNOA 2GWSA 3QXGA 2W7OA 3ZDDA 3QDKA 3FC4A 4J9LA 4FE3A 2AXTU 4FLZA 2Q0RA 2WTUA 3LWMA 4I9LA 5B66U 4DSLA 5AFUA 2YI1A 3MDCA 1U4BA 4KHWA 1RTHA 8ICSA 4IQTA 7ICEA 3D6JA 2KLAA 3I0SA 4A2AA 2WAQC 5KFIA 2DKZA 5GAHP 1HYSA 5J0WA 3P5JA 1V97A 1RT6A 1ZXOA 1D9FA 2LYBA 1QHAA 4RUAA 4BRGA 5GAEP 5L1IA 4K25A 4MEXA 5C2DA 2BR0A 2E5LK 1WCNA 4YR2A 3VA3A 3T1HK 4TQSA 4DCCA 4BRDA 3O1BA 5SWMA 2KK0A 4O5BA 1TL3A 3LZIA 3FZLA 5J0PA 4CJVA 1KCFA 2K4PA 3ZT1A 4FXDA 3CCEN 2D4WA 4AHSA 1KAXA 4DR3K 2HSTA 2W03A 1NGAA 3SR6A 2KJ8A 3PX0A 1WLJA 2O4GA 4DF8A 3MDAA 3LP0A 5K14A 1HNXK 5AM4A 4RNNA 1CRXA 2P5GA 4FWQA 4CECA 4DSJA 1TYQB 3DRRA 4C4SA 1UWBA 1NJYA 2P9PA 2ZGYA 3M9MB 1A0PA 2XY6A 4A57A 3CQ8A 4FVMA 3OJUA 4IQVA 1L3SA 3QUCA 4BC2A 1KVBA 2BGWA 3P31A 2MA1A 3L2QA 4FLUA 4E1NA 3FDSA 3WK4A 3UXNA 4OVLA 2HBJA 5C42A 1JLCA 4H0YB 3LM9A 4KTQA 2PAVA 3EO3A 5TISU 3ULDA 4KV8A 3O8MA 2BPCA 2GBZA 3HK2A 1L7MA 5IT9O 1VRUA 2VGMA 4RCHA 2WF5A 1X6IA 5BPLA 1NMDA 2W11A 4UB1A 1VAZA 4GNIA 3BGRA 4KO0A 1S9GA 1WNSA 4JMUA 1X9WA 2P9LB 4JK8A 3H08A 3ZEUA 3MWPA 4LH5A 3Q8SB 4FJHA 3WU2U 3QICA 5JLHA 3S9HA 4OJOA 2W04A 2IC3A 1PVQA 2UVVA 2C2DA 1RTJA 3ZSWA 5KQDA 3Q8KA 4GIBA 5J2GA 8ICKA 1QLNA 4RNMA 1A5VA 3MX2A 3JS6A 1VSMA 4JK1A 1LWCA 2NRXA 2ZIVA 4CF9A 4U7CA 1LWEA 4QZIA 4BC5A 5AZJA 1TAUA 4NYFA 3S3NA 3TQ1A 5KT7A 2JH1A 4EZ6A 5ADXA 3NH1A 4J9KA 1MC8A 1SXDA 1XNSA 3LAKA 3L2WA 1KDHA 1N6QA 3TACB 2Z7JA 5AM2A 2NZTA 4DV7K 3WXLA 3NVZA 1TV6A 2Q0UA 3A5LC 1ZQWA 3NRZA 3H8SA 4ICAA 3FR0A 1SXEA 3UKRA 1OH6A 1Z6RA 5AQVA 4CZMA 4KLHA 5KT5A 5A2QO 4DQIA 4M3TA 1FFUA 5ALZA 4ISFA 4FJJA 2IHNA 3K75D 4DL2A 1H38A 4CE6A 2WTFA 4IO8A 4Y2PA 3NGDA 3WKBA 1YXQA 4N5SA 2DQNB 2DPIA 1X1PA 2F96A 3VEYA 3HSTB 3M9NB 2O8CB 3L3VA 4DLEA 4AHCA 1RDFA 1N8RO 1HJRA 2FMSA 3AEVA 8ICXA 3M8RA 2PFUA 5KG1A 3OYLA 1ZQVA 3WK9A 4DEZA 2GV9A 3OVNA 3NRWA 4O3SA 5AQLA 4FBUA 2BHNA 4Q8EA 1NK0A 1PZNA 4F5RA 3LP1A 3LPUA 3M1FA 2KW4A 3A0BU 2ZUDA 3B0XA 3MCAB 3H3NO 4O8KA 3AMZA 4RQNA 2R8HA 3RTVA 3CCVN 1MWMA 4FM1A 4HUFA 3I76A 2RKIA 1VQ7N 3NGIA 4B3OA 1WAJA 2DPJA 3A5NC 4O5CA 1VSFA 3OBWA 3VQBA 4X62K 1NZPA 1H1VA 4QZAA 2D0PA 2OWOA 3B6PA 4CD3A 3BQ7A 3DEEA 3QUTA 1S1UA 3I1YA 2UU9K 5HHIA 4AM6A 3ZLJA 5EE3A 1S97A 1W0HA 3MN6A 4NO7A 4A62A 2IVNA 3QEPA 2ZIUA 1L3TA 1HYZA 1TVRA 1QQMA 4FJIA 8ICUA 4CJPA 3AAQA 1T6CA 4DQPA 1VQLN 4YFUA 5FPMA 2YTUA 3H7IA 3O4WA 4LY7A 1K6YA 2VA8A 4RQ0A 4EELA 4RU9A 2NV3A 3GE1A 4CEQA 3LDSA 2R7YA 1SKWA 3ATVA 5AICA 1Z1VA 3VEWA 2HSZA 1BUPA 9ICEA 3ALRA 4C1NK 3MGHA 2BQ3A 2ITGA 2MUTA 1HNIA 5KG7A 2NYVA 3M6KA 3PW5A 2YCHA 2IOFA 1FXXA 2KP7A 2EAOA 4ELTA 2KSOA 2BCSA 1NG9A 1XO1A 2W8KA 1J54A 1RBRA 4F93B 4W5NA 4TUQA 3EWAA 4OJRA 1JUDA 5KAFU 1YT3A 2AJQA 3WUHA 9ICKA 2P9PB 1XNQK 9ICIA 4N56A 4IWVA 1ZQHA 1IXRA 5DKWA 4J9OA 2P6RA 3ICXA 5ALUA 3I0RA 2IA6A 1N32K 1YUWA 3N4PA 3J8AA 1ZQMA 3JXUA 3SUQA 5IIKA 4JI7K 3AVJA 4XEIA 3SQ2A 2FPLA 4Q44A 4PKGA 3RSEA 1VQON 4M3ZA 2UXBK 1SL2A 4FWLA 4OD0A 3DJCA 4DV1K 4JEPA 4DL5A 4FW2A 3N7RC 2O8EA 4CEBA 4FLVA 3HP9A 2GX9A 3LP3A 4YVZA 2YNFA 4FPAA 1Z00B 3H1QA 3KLFA 5J2NA 2YHWA 1HKCA 1XHXA 4M3XA 3DXKB 2F9WA 2K89A 5G5GA 1NNEA 1C0TA 4FVUA 2LYHA 5KT4A 1DOQA 4NLGA 2OCEA 4BRIA 2WAQF 4E7LA 1B9FA 1ZQSA 4MO5A 1COKA 5DG7A 2QKKA 3AVGA 4KI4A 2RF2A 1HJOA 3QNNA 8ICPA 1SL1A 3ZSOA 3WNFA 4B1XB 3P4IA 2Q0ZX 3SAFA 2E6MA 5DM6L 2CPRA 4RQ4A 1N60A 1ZETA 2FLLA 1ZQGA 2ZJQL 3THYA 2B4JA 3GZFA 4KLLA 3GBTA 1VQ4N 3CJAA 2OH2A 2O8EB 5BOLA 1X9XA 1HPMA 2FMPA 4OKEA 2VA2A 1GLBG 3VQQA 4G9BA 2ZIWB 5M1QA 1QSLA 3IP4B 3LK9A 2FF6A 3E66A 2R8KA 2P1JA 4JK7A 3UKRB 1S5LU 1SZPA 3LP2A 3L2VA 3LDAA 3CQYA 3OJSA 3B8AX 5J8YA 3NVVA 2JRZA 1KAZA 4FLYA 5AM5A 4EYHB 2XGQA 4Y2QA 4CJWA 3EKUA 3K9KA 1XHZA 4KAZA 4PHTX 2FBVA 5DQIA 2ZXHA 3TADC 4CK3A 1Y88A 3ZD8A 3SK3A 1ZRMA 3S41A 3D2SA 2ZG6A 3JPRA 4DS5A 4XH5A 4FJGA 2PXIA 2GUPA 5AI8A 2P9SA 1SZHA 3ZDEA 3HVRA 3K57A 2JH7A 2K8AA 3L2UA 4JYAK 8ICFA 1GLEG 1L3VA 1I3AA 3PW2A 3AA5X 3QNMA 4H0TB 2A1AA 2P9UB 2XGPA 3SV3A 1Q7YO 4ED7A 3AVIA 2HMIA 3PIOL 1OXJA 8ICBA 1GLFO 1S77D 4KPYA 2PFNA 3K5NA 2E8NA 4FJXA 1OKJA 1IM4A 1PVPA 1Q3VA 2YNGA 3VENA 2AQ4A 7ICJA 4CIEA 4OPJA 2B0CA 4JV1A 2FDRA 4F9OA 9ICQA 3DXMB 5AQSA 3MDQA 4Q45A 3KK7A 1NJIO 2IIRA 3EPIA 1FJGK 4DG1A 2A42A 2BCUA 5C5JA 4DTMA 1AQ6A 4C7YA 3ZETA 4NLZA 3AVBA 5KT2A 4QZEA 3C5FA 2KN7A 2P9NB 2N1RA 1HUZA 4ISGA 3VQ5A 4YOXA 3ORYA 4F5OA 2HOFA 4BQLA 4H5TA 2EH9A 1L7OA 3D7EO 3O9QA 1HNZK 2XCAA 4CHZA 1NKEA 1BA1A 4IL6U 3U26A 1JLGA 1DTQA 4DV5K 3HZ6A 4K0KK 9ICXA 5AQIA 3O3HA 4N76A 1X66A 8ICZA 3MCPA 3OYMA 3SUOA 2G5HB 1BNPA 3AO5A 4B08A 4US8A 2F8SA 1BU6O 5HRNA 3N4QA 5G5HA 4F71A 2QXFA 4WQ4A 3RMBA 4JWNA 4LF9K 3H4BA 3NTUA 4RW9A 3CERA 3K59A 1ED1A 4DL3A 2BZFA 4EP4A 1Z1BA 3K0SA 3J7YP 2M0NA 4UY8O 4K4IA 7ICTA 9ICWA 3WK6A 1VSEA 4CF4A 3T7ZA 2F7TA 1BPXA 1O08A 8ICEA 2IOCA 2R18A 2GLEA 1ZXIA 3GU3A 4M0AA 4J2AA 4B1YB 4NM2A 4CGZA 4PHPA 4YORA 1NNLA 4PL2A 3FE1A 4CF2A 4IQWA 2CRXA 2O8BA 1ATRA 4IJNA 3QEVA 2HHTA 1RCHA 3QIOA 2E2PA 1ZQCA 5DGBA 2D0AA 3VA0A 1RGIA 1HQEA 4J9QA 4CZLA 3T1YK 7ICMA 2ZD1A 2ODGA 1L7PA 4O3MA 3EYZA 3THYB 3CMEN 4CE9A 4IOCL 4JD2B 1TUYA 3QB0A 3K5LA 2A1RA 3QMLA 2X6NA 2QB0B 3LAMA 3KK1A 5L1KA 3HI0A 3CJ7A 3D6RA 3RJGA 1HUXA 1ZQ1C 2AHOB 5CYQA 3IS9A 4P4PA 5LMUK 1NKCA 4KKOA 3C2KA 1MN8A 3ONNA 1A6SA 3Q8RB 4DR6K 1C6VA 5AQUA 4JI4K 4BR0A 2BPFA 4CZGA 4LF5K 3TFRA 8ICTA 4Y0WA 4B1WB 3O1WA 4KB1A 4DL7A 2D6FC 1V4SA 4ICLA 3V1OA 2VGNA 1IO2A 3HM9A 3RRGA 4H5NA 1S0OA 2G08A 3UKUA 5DBAA 2VG5A 3HYFA 4RQ3A 4DSFA 2O6KA 1UQVA 1T4GA 4BRCA 5J8YC 4R8UB 1IIPA 4O44A 4KRFA 2NRTA 3QZ7A 2JR5A 1EP4A 1M90O 4RQ2A 2Y1IA 1WSHA 3WXKA 1CZBA 4C8KA 1KTQA 4IC9A 1Q81O 3QEAZ 1DGSA 3AU2A 3HBTA 1JKHA 1K1SA 4XUSA 3GG4A 4I27A 1ZQUA 3TAGA 1Q86O 1RDAA 1QHTA 5AQKA 1RBSA 3KLEA 2NRZA 3BQ2A 3CIPA 2HHHK 1ZQBA 4M6WB 2WUSA 3HOSA 2IMWP 3W0LA 3DRPA 4IS7A 2P9KA 1N34K 2ZIXA 4QZBA 1CI4A 1F21A 4CESA 1CEZA 5AKXA 4B9VA 4Y2UA 3L6QA 1X3NA 2ZJ8A 4YXJA 1NKBA 5ALDA 1FKPA 5M1OA 1ZQTA 4HAIA 4QS9A 4CGIA 4YQWA 1SB3C 4YOWA 3HKZC 1BQNA 3V9SA 1VQ6N 1EETA 1ZC6A 4O5KA 4FSVA 4IOXA 2WBNA 2ZTDA 4B9QA 3AL0B 5CYMA 3JSMA 5CWRA 1NGDA 4TUPA 3OYIA 1O03A 4M9NA 2WF6A 2RDJA 1J9AA 2JGAA 3WK5A 2IDOA 5AZIB 1QH9A 3GL1A 1JXLA 3BZKA 2L5YA 3MX5A 4WFAL 4M04A 4IEEA 3R3LA 2KZMA 4PL7A 1HIWA 4OJPA 4B9NA 4GY2B 4I2DA 5ALTA 1KC8O 2PYJA 2OPSA 4DB3A 4CHQA 3T5LA 1RDUA 4OKKA 3IM1A 3WKEA 5DB6A 2VJ5A 3VF2A 1VQMN 3QUQA 4JHDB 1VSJA 4H03B 1NU0A 5KTQA 1NZBA 3AY9A 4RW7A 8ICIA 2FPKA 2OYYA 3VQDA 4IO9L 1YZ7A 4M3YA 2E8PA 4ZOHC 2HOIA 3NF8A 4FO0A 4MQ3A 2KKPA 4M7XA 5ALXA 1HUOA 3CMAN 1WG8A 2JLEA 4BVPA 4HTUA 1ZQLA 4JI1K 8ICHA 2FBXA 3C7NB 1QQ6A 2VG6A 5KFMA 3S3MA 3T5KA 1U04A 5TKYA 1WSFA 3LALA 1REVA 7ICGA 1QSSA 2DPNA 3BS7A 1QQ5A 4FM2A 2FLNA 7ICOA 2V7YA 5ALVA 1RM6C 2RQ5A 3MFHA 5GTHU 4QWCA 1S3XA 2FE9A 2KKVA 2AA4A 2AGOA 1EWRA 4QW9A 3AVFA 3EY1A 2Y0SF 4P2HA 5BPNA 2G8FA 1LAWA 3FZFA 1VSLA 3LWLA 3F2KA 4BQZA 2BCQA 4B9UA 3MXIA 4CJFA 5J0TA 4Z6DA 5HP4A 2ESEA 1ZD2P 4O9MA 2DFHA 3NGZA 4CIFA 1U49A 2V51B 5AQHA 4Y1CA 2DY4A 3SENA 4NXZA 1EX4A 4EYIB 1YJ9N 4FPBA 5J2PA 4UAVA 2ISOA 2ZIVB 2W3SA 2KVSA 1C0GA 1HR0K 3E0FA 3QEXA 1GOCA 2LI6A 1TAMA 4KLGA 3CPEA 2XY7A 3QE9Y 4DCHA 4Y2RA 4PZOA 5JU5A 2E4LA 4KFBA 1UA1A 5IIMA 4BXOA 3JYTA 4F72A 5KFNA 3E9OA 4QWBA 4JUZA 3PVXA 2FI1A 1SS6A 2IAJA 2G07A 4UQGA 4PKHA 4NCBA 1DK3A 4O3OA 3HL8A 4I2AA 1HNWK 2V9WA 2W54A 3SEIA 1NGGA 3GIJA 5J0RA 4DWIA 1NOZA 3DOLA 4BR2A 4IRKA 2HI0A 4FWSA 1QQ7A 4Q8FA 2QB1A 3V4IA 4OPAA 4AILC 1QQNA 3Q7CA 2E1EA 3C5GA 2NRRA 2ZIWA 5CP2A 4RZRA 4H5RA 2HNDA 3H6EA 2BE2A 2VCPA 4G3IA 1LCUA 4XH4A 5FP0A 5E84A 4DQ8A 3D0PA 3E2EA 1IG6A 8ICRA 4P0PB 2F1HA 4M9JA 3AVHA 4DU3A 3NS1A 3DAWA 5KT3A 1S9FA 3JPSA 2RPIA 2K4IA 3OW2M 1RTIA 2RN2A 3AU6A 4CF8A 1OH7A 1R59O 3O9TA 2F77X 3HJFA 3KKAC 3RAXA 2ZF5O 2YMLA 4I2BA 1V38A 9ICPA 2ZIXB 1Q9XA 3THVA 4HCCA 4LF7K 2OHFA 7ICSA 4I2FA 5IINA 2BH1A 3O6WA 1VQ9N 2YMQA 5CB1A 2HHWA 3BZCA 3W3DA 2O8FB 1DXSA 5J2CA 4BRAA 4F4XA 3KOOA 2O8DB 4CJ4A 4YMMA 1GLCG 2JV3A 1X9JA 3LPTA 3C6HA 2PBDA 3H46O 1UT8A 5B8HA 2KD1A 1QCKA 1U6ZA 4JN4A 5KAIU 3V7KA 4JKGB 2JWKA 1LOTB 4I6MB 3PY8A 3NH2A 2I9GA 2G8KA 1K1QA 2PY5A 3SUPA 2IVPA 4DV0K 4LSNA 4O0IA 2HNYA 5CHIA 1TE2A 4PGYA 3SCXA 4TUSA 1WSEA 2LKYA 3WK7A 2HOEA 5HP1A 4OPHA 3VGMA 2E6LA 4NJ8A 1RTDA 2G8VA 4PKIA 1OH5A 5F3XB 1C20A 4IBNA 5FRNA 2P6UA 1T3VA 2O4IA 5IIOA 4QZCA 2KE7A 3F5EA 4JKEA 4W5RA 1RYRA 4I2EA 2UYTA 4CGFA 3V7JA 2MSNA 3SD7A 2X6SA 1B43A 3MBYA 4I6MA 3AUOA 3WNGA 4F2RA 2BUPA 3O80A 5EWGA 1L8LA 1KQSM 2LM4A 2HVHA 4QW8A 1BA0A 2QA4N 4YD2A 5KFFA 4RW8A 2FXUA 3F5AA 5H1SQ 4BWMA 4CJUA 4UB8U 4KHNA 4NXMK 4UB4A 1TKXA 1XMOK 3H8MA 4O3RA 1HEKA 4DL6A 4A61A 2KVCA 3AGKA 4BRPA 5CR0A 5BREA 3WK8A 3MFIA 7ICQA 1BI4B 1U2VA 4CJEA 1IKYA 3KLHA 5HHHA 4JKCA 3SJHA 3RH6A 3CCQN 3AQEA 3N7SC 3V1QA 1EXNA 2H3FA 2UXCK 5AM0A 4BC3A 4NY8A 4Q5VA 1HPZA 4FK2A 5C24A 4I2CA 1RBUA 4JLHA 1VSHA 5EWFA 1PVRA 3PUFA 5BPMA 1XSNA 2FSKA 2YN4A 2IBKA 4YN4A 1BL3A 4MLHA 5J0UA 5ALSA 5HR6A 3C29A 2RHKA 1KFTA 3TADA 5AKIA 5ALPA 3U3YA 2P9LA 4JRQA 5HLFA 5HROA 9ICLA 4CF5A 2F76X 2DL0A 4ZTFA 1LW0A 4YOUA 4R79A 3M3ZA 3VESA 4R5PA 4IOAL 2Z1GA 4DTNA 4Z4CA 4F4WA 5GIOA 5KFWA 4KLJA 1SWWA 2V52B 3WXMB 3CRXA 2HMXA 4O3QA 1WBBA 4Z4EA 1BO5O 4CJLA 1R0AA 2YJFA 3DI6A 4FBTA 3BY5A 9ICFA 3ATUA 3UQ2A 3ZT3A 1WUDA 1RDCA 3ETRA 1S1WA 5J0YA 3FFIA 4M42A 3O9UA 2E8MA 4RNOA 1NJXA 1B92A 1CLQA 3RBDA 3IN5A 4CF0A 1WBDA 5DQGA 4IR9A 4KREA 5KFKA 3E58A 3DXKA 5KFLA 4ED6A 3FZKA 4PHAA 1JL1A 4EP5A 2A1JB 2EQYA 4CEDA 4GV9A 5AI6A 3PX4A 2P9SB 8ICCA 3AAPA 5KFAA 4FJ8A 4FZZA 2VWKA 3LM2A 3KHLA 1ZQFA 8ICWA 3J81O 2V4RA 3D2FB 5AI9A 1CXUA 4BGAA 3HOTA 4BG8A 5AQOA 3BS5B 4PZNA 3C1ZA
chains in the Genus database with same CATH topology
4RWTA 4Z6CA 2AU0A 3HM8A 3V6JA 3PO4A 2W41A 2VA3A 3O5BA 4C8NA 2HBLA 1A76A 4WFNL 1OVYA 4QS8A 1K8KB 3CJ9A 1JCFA 4R8UA 3TPQA 4GV3A 4IRCA 2HBMA 4QZDA 1YJNN 4ILHA 2AGQA 3NVKA 4RPZA 2PFQA 4M47A 2PI5A 3H4DA 4GLXA 4KBOA 4WQ4C 2F1JA 3D2FA 1S0MA 1YAGA 3MMVA 3TFSA 3EPGA 5GIPA 4RPXA 3R1XA 1RPLA 4QWAA 3EW9A 2ITMA 3ZX2A 1JCGA 3VEXA 4BRMA 1SQKA 9ICJA 1J6ZA 5AQFA 5J29A 3E1YA 1LV5A 2NRVA 4FWMA 4BRHA 3UXOA 5EY4A 2ZTCA 3TI0A 1MQ2A 1JJ2M 1X9MA 4J8FA 3WXJA 3CCLN 4DF4A 4YOVA 4B9MA 3H8JA 4Z6FA 3JPPA 1W2BM 1X2IA 1K73O 7ICVA 4JV2A 1JMSA 3GV5B 3Q8PB 4DSEA 3FZHA 3OHRA 2P9NA 3OBYA 2I7NA 4KLQA 1BPYA 4H0VB 1Q18A 4BRLA 5F2RA 8ICQA 1TK8A 4QS7A 4F4ZA 1KLNA 4O8UA 4H5VA 3SMSA 1KFSA 2B21A 4BREA 1UT5A 1XUPO 2FPMA 3KWGA 1Y64A 2F9TA 5KFDA 2QWLA 2A40A 3LL3A 3U9DA 5AQZA 8ICJA 3RRHA 3TAQA 3RJEA 3RJJA 4U67L 5J2HA 5DG9A 1ZQYA 2CGKA 3MR5A 1CZAN 3MK6A 5DLFA 4MDBA 4PHDA 3WEEA 4A2BA 2JEFA 3OHAA 2VWBA 4LZDA 1XS9D 1TVAA 4BXOB 2BCVA 1DKGD 2A6AA 1X3MA 4DFKA 3MR2A 3K4GA 2FSNA 2V7ZA 3QFPA 4A5BA 4RQ7A 2D0OA 2AP1A 3IHQB 2P9KB 5CHGA 3CC2N 1TUUA 2YHYA 2P9IA 4WYBA 4G9ZA 1X9SA 3VF6A 1HLUA 3M6GA 3I33A 3RAQA 2NRHA 5AQXA 3GQCA 3AARA 9ICOA 1WOQA 1ZQPA 4UBCA 4KLSA 3V6HA 5DDMA 1DEJA 3OSNA 1M1KO 1T8EA 2UVWA 9ICUA 2JEGA 2Q97A 4RQ6A 1BPDA 4H0OA 4FWPA 5J0QA 3EE9A 5J2BA 1NGHA 3C2MA 2HF4A 2CGLA 1O13A 1NOMA 9ICVA 5J0SA 4QZGA 4DL4A 3JPOA 5M1KA 3A8YA 2BCRA 4BGBA 1VQKN 3IDHA 4FWKA 4KN4A 1TFRA 5FPNA 4ED1A 4JKGA 2ZJ5A 3H3OB 4MF2A 1JCEA 4DOCA 4FWOA 4ILGB 4P4MA 1BPZA 3PR5B 8ICMA 3BF3A 3KTQA 4UAWA 4CZKA 3G6VA 1ILYA 7ICLA 4ED2A 1U47A 1NJWA 5M1PA 4ED8A 4WF9L 2V4QA 4QZ8A 2C28A 1TV9A 5AQGA 4JV0A 3LDOA 2W9BB 2XO7A 2E8AA 4A5AA 1E4FT 5EOYA 4J9SA 3L0QA 1MA9B 5L9XA 2ALZA 3GFKB 2Q1NA 2E2OA 5AQYA 3ULEA 8ICAA 3KHGA 1IG8A 4BR7A 1TK0A 1A77A 3RBEA 5KFHA 2W9MA 3CQXA 5KPRA 1NJZA 3R6MA 3RB3A 4B9LA 4Z94A 3CETA 1RZTA 3GILA 1SZ2A 3JPNA 3RR8A 4CBWA 3SAGA 1S72N 4M9GA 2Q31A 2H3GX 4PGQA 3RH4A 3PMLA 4QZHA 2M9NA 4FO6A 4CZIA 3OHBA 2OANA 2ASJA 2QM1A 3VGLA 9ICHA 1BPBA 4BRQA 4GC6A 3JPQA 2BKEA 5CJ7A 1NGIA 3CI5A 3ZYYX 4ECRA 3MGIA 3WXIA 4A59A 3MWTA 3KHHA 5KFEA 5J0XA 4YDUC 1XWLA 5DG8A 5KPTA 3GIIA 2P9IB 3VTHA 1U45A 1D8LA 3C1YA 2AQ0A 2JEJA 2I7PA 3OSPA 5F0XA 1ZJNA 1JN3A 2A3ZA 1QZ6A 1BPEA 5AQPA 4E1JA 1P8ZA 1JX4A 5DBCA 2RE2A 2JZBA 4MFAA 3SBGA 5AFUH 4TURA 1ATNA 3ENBA 5DDYA 4O5EA 7ICNA 1NGBA 4K43A 5J2FA 3VERA 2W8LA 5C12A 4U7BA 1ZQXA 1ATSA 2XY5A 5D49A 4AF1A 4R65A 3GV7B 4X5VA 4LZGA 4ELUA 1NK5A 2E2QA 4EIAA 5LJVA 5TKWA 4MLEA 4M7YA 5KFGA 4ELVA 3G71N 3C21A 2HHQA 2KHOA 2WC9A 2HW3A 1IJJA 2C2RA 3PR4A 3UB5A 2A41A 3V6KA 4CZEA 1NK7A 4I2IA 4JK9A 3VF4A 4PHEA 4M2YA 5J2EA 7ICKA 2QWMA 4CZHA 4CI6A 3B0YA 2IHMA 3ZETB 4KLEA 4YR3A 1RYSA 7ICUA 2OTLN 1NK4A 4RQ8A 1SKRA 2HHUA 3MR6A 4DQSA 4MFCA 1NLVA 1GLLO 5J2DA 4BRNA 3BP8A 4IR1A 3UE5A 4JKBA 3FFKB 2J6TA 1ZQIA 1K9MO 5BRDA 5J2IA 5J2JA 4DFMA 3CF5L 3OA9A 3E9LA 4MO4A 4F92B 2MUTB 4UAZA 4Q43A 1T6DA 4BR4A 2J4RA 1ZQNA 3CC4N 3GDXA 1U9LA 4K41A 5F1XA 4DSIA 1QVFM 3SLCA 5GAGP 5EXWA 4CZJA 3ZEUB 1UA0A 4WCEL 3U9ZA 4OO1J 4F4KA 4QWEA 4YFKA 1GLAG 1LB2B 2HHXA 1DGKN 4XQ8A 2KKZA 3RJKA 3EKSA 1NK8A 7ICHA 4KH6A 4B1VA 5GADP 3Q8LA 4CBUA 4EFHA 1YF5L 3IKMA 5TZVA 4MFFA 1B22A 5FPDA 1D9DA 2QWPA 4ECWA 3A0IX 4FWNA 2R8IA 1K8KA 3FLCO 1GLJO 2FF3B 2WFBA 5KPZA 3M5RA 5IIJA 5FPEA 5IILA 3P39A 4YDUA 1TK5A 1YHQN 3T3FA 1XC3A 2F1IA 3PO5A 2FSJA 3RR7A 3ID6A 1JXEA 2JZBB 3VPZA 4O5FA 5AQTA 2XCPA 1BWFO 3P38A 4YG2A 1QZ5A 3QBXA 1ZQKA 2ATLA 5DB8A 2NNWA 2NRWA 2KTQA 5AQWA 2C22A 4CBXA 4BWJA 2ASPA 4MDAA 2QWRA 4YP3A 2QWQA 3LDNA 2A1JA 3RVCA 2FLPA 2QW9A 2ZUBA 3DXMA 3VGKA 4ILJA 3FYHA 3ID8A 3PX6A 3H1VX 3GV8B 4BR5A 2GEMA 3F5TA 1XU4A 2A5XA 1HJPA 3ISBA 3RJIA 5E26A 4IZ9A 3TSUA 3G25A 5HNKA 1ZQAA 3CHWA 5LY3A 1NK6A 5I9EB 3QFUA 4O3PA 4ECUA 4KLFA 3A5MC 5KFCA 5KFVA 4JKAA 2VANA 5GINA 4J9NA 1Z3EB 5KFQA 3OGUA 4F5NA 1YI2N 5F9LA 5AZIA 4FOEA 4M9LA 4BG9A 4DFPA 1NGEA 3NMUA 3IMXA 3DLLL 5CE3A 4KN7A 3CD6N 4GVEA 3C6AA 4EZ9A 1W97L 4JWMA 3SI8A 2ZWHA 1VQ5N 4JNEA 3H45C 4UB2A 9ICGA 3SAHA 4PGXA 4KLIA 3C7NA 7ICFA 3TTCA 1KD1O 5KFYA 5KFZA 4K4GA 4YD1A 5KG0A 2J6UA 3BJYA 1MDUB 3PLAA 1L3UA 1YITN 3MN5A 5J2AA 5BPCA 4ECSA 3I55N 2ASLA 4I2HA 5EOZA 1NWKA 5AQQA 3C65A 4ECXA 1S22A 1P90A 2I1QA 1MQ3A 4F8RA 5DBBA 4KLUA 4IQUA 1MWKA 4PPXA 4YXMA 3GIKA 2YX6A 5EVZA 2BTFA 4NB4A 2NLXA 1QVGM 2QTDA 3MN7A 3J7ZO 2UVRA 4DKWA 4ZH4A 3BEXA 5AQRA 3V72A 4GXIA 3PW7A 1ZQOA 3G4SN 3KHRA 1NGCA 4GXKA 2JEIA 5BRHA 3HWTA 5ELZA 3BF1A 1VQ8N 3KHYA 4NLBA 3VMFB 2R8JA 1SL0A 1BDGA 5HOOA 3KZBA 4B1UB 3PW0A 4EEYA 3AGRA 3MN9A 4XRHA 9ICRA 7ICIA 1N48A 4DLGA 1YVNA 3EZWA 3ZDBA 1TKDA 1ZQEA 3BUZB 3VTIA 4JKHA 5DB9A 3ZD9A 3CCRN 5BOMA 2BPGA 4NLKA 3TTDA 3ZDAA 4EBDA 3EE8A 5ADXH 3UPQA 2QWNA 4BROA 1EO1A 1TAQA 4PL8A 3VOVA 3ISCA 3Q7BA 1G99A 3ULEB 2KFNA 3LDQA 4EAHD 4F5PA 1K8AO 2ZJAA 1ZQDA 2E88A 3TSQA 4JKDA 4KLOA 4M63C 4I28A 4H0PA 3F9MA 4F91B 5MLCQ 4NLNA 1ZYQA 9ICTA 1WUAA 4WQ5A 1BG3A 2J6SA 2E1ZA 4EHUA 4BRKA 5CR4A 2W9AA 3LDLA 2GTDA 3CJ1A 2YJEA 3FGUA 1S0NA 4K42A 4DS4A 1U2VB 5JLFA 1KXPA 2EWSA 9ICCA 4DSKA 3ENHA 5KG4A 4ED3A 4R64A 4DQRA 2CH5A 2BDPA 9ICSA 2W9BA 2E1YA 2MAXA 1EQYA 2P66A 4ECQA 4C8LA 5AZJB 3SZ2A 4FL9A 1Z00A 5KQ8A 3M8SA 1YIJN 4DQQA 3ETLA 4BDPA 1C0FA 5BR9A 3ZX0A 4JAXA 4RPYA 5HMMA 3LDPA 1N56A 3TANA 9ICNA 3Q8MA 4LC9B 5L1LA 4BC4A 1RXWA 3CCSN 4HWIA 2PFPA 4ECVA 2IVOA 2GWJA 3QBWA 3T69A 5KG3A 1D4XA 2GWKA 5DQHA 4F5QA 4AM7A 3V7LA 5DB7A 4YR0A 1COOA 4RUCA 2D1KA 2ISPA 1HKBA 5AQMA 4IFEA 1VQPN 4QWDA 3EZ5A 1C7YA 5M1NA 2RDIA 3O9SA 2ZTEA 5KFTA 1L5UA 4C1NI 3SYZA 5KG5A 2W9CB 4KH4A 3PMNA 1MSWD 3ISDA 1T44A 2ZJPL 2ASMA 3R8EA 3BQTA 3VETA 4HYKA 3ZDCA 1Q82O 8ICVA 3RB0A 5DGAA 5D4BA 5DLGA 3RH5A 5JMVA 1T3NA 4F2SA 4PH5A 1ZQZA 4F3OA 4HTLA 4KLMA 4YOTA 4QZ9A 3U8XA 3L4QA 8ICOA 4B9SA 3RSEB 9ICBA 2HVIA 4O3NA 1NK9A 4DOBA 1XSLA 1KSPA 1BVSA 3CCUN 3CC7N 4IDHA 2ASOA 4DOAA 5KG2A 1XSPA 1TYQA 3SBTA 4MF8A 2QXLA 5C2FA 3EL2A 4WQ5C 1NBWA 4FS1A 4IXCA 5KFRA 4EBCA 4RTFD 4DHYA 3L4IA 4IRDA 5CA7A 5KFPA 3SMPA 4K4HA 2ZUCA 4FWRA 4F50A 1RDWX 3HPOA 2QEXN 4XH1A 3HRGA 3D2EA 3N4MB 1V9PA 4BRFA 2HF3A 1AROP 2OTJN 3RB6A 2ZJRL 2H5XA 2ASDA 3M9OB 3TSPA 3T5HA 4GXJA 4M9HA 3GIMA 4FS2A 4GV6A 3IFRA 1KAYA 3QEBZ 1E4GT 5IIIA 1DT9A 3GOIA 3VEOA 3KWIA 5J0OA 1RXVA 1HKGA 2W40A 3N97B 3WQTA 2HBKA 4RT2A 3O08A 9ICAA 3D2EB 4NLCA 1KRPA 2CGJA 1S76D 1HX1A 4QZFA 3R9PA 3TTFA 3G6YA 4CZFA 5C15A 1XC9A 2ZGZA 3PV8A 1U48A 4ECTA 4C8OA 1QTMA 2E20A 1VQNN 1KEJA 2P9UA 3I56N 2UVUA 3CPWM 4I29A 4WFBL 7ICPA 4C23A 2YHXA 3U4LA 3VEVA 2XC9A 4IJAA 4IEIA 4B9TA 3TARA 1T7PA 3IUCA 4NM1A 3CJCA 3H8WA 2HMPA 3RJFA 2HHVA 8ICGA 3C0BA 3ZX3A 2JWLA 3FZMA 3G6EN 1ESVA 3DWLA 1QQOA 3JPTA 3RB4A 3HW8A 5KFJA 2KZ3A 4TQRA 5KFUA 5KG6A 1BOTO 3EN9A 4YOYA 2QI2A 5JVGL 3QZ8A 2Q36A 3KVGA 3PIPL 1V4TA 1KFDA 4RT3A 4P4OA 5KFXA 2C2EA 4YCXA 5KT6A 4FOIA 4CD1A 3TAPA 4UAYA 5JVHL 4R66A 4KITB 1CUKA 8ICLA 1YJWN 1WCLA 4YMOA 4BGDA 5D46A 2HHSA 1GLDG 4KMUA 4B1ZA 1ZQQA 3HX0A 5KFOA 2KZZA 3BQ0A 3TU5A 1NGJA 3E9PA 4BR9A 1NM1A 4KLDA 4BY9C 2PFOA 1NGFA 4DFJA 5LJWA 5C0YA 1Z05A 4ISEA 3H40A 3MABA 1SAZA 4J9PA 5KFSA 4KH5A 4GC7A 4CCHA 5BN8A 1ZBSA 7ICRA 1SKSA 4EHTA 2CH6A 5JUMA 4H0XB 4I2GA 3T5JA 4J9RA 5HL7L 5EWEA 3G6XA 4UB5A 1ZJMA 4UB3A 1S0VA 2PI4A 5AQJA 1ZQJA 2DFLA 4H5WA 1QSYA 3UKUB 4LVSA 2VYPA 4Z6EA 4KLTA 3RJHA 5F9NA 2E2NA 5DM7L 1BGXT 2Y1JA 2AGPA 5L1JA 5BN9A 4EBEA 4XA5A 3BQ1A 4MEYA 4DO9A 3SV4A 2BQUA 2QWOA 3HTVA 4M6WA 4BVOA 5EX5A 2KFZA 4B9QA 2GELA 1RFQA 5AQNA 5KFBA 4ECYA 4L3QA 3HP6A 4JD2A 1JIHA 5C10A 3CCJN 4ED0A 9ICMA 1S10A 3WQUA 3MR3A 5M1FA 2R8GA 2BQRA 4E0DA 3CCMN 4JKFA 3I8BA 5BRFA 3C2LA 1D8YA 3CJBA 3WEEB 4YMNA 3HT3A 5HMLA 4ECZA 2FLOA 4C8MA 4CJ7A 1XQSC 4RQ1A 3A5OC 2FMQA 3Q8QB 3PW4A 5J2KA 8ICYA 1ZQRA 3C23A 8ICNA 2Q2RA 3CXCM 3NVMA 3ENOA 3UQ0A 3BDPA 5AR0A 3GDQA 4RQ5A 4UBBA 4I2JA 3PNCA 5JICA 4F4YA 3O9RA 3WT0A 4JHDA 3K9JA 3UXPA 4J9MA 4R63A 3VEZA 3HSCA 2W9CA 2GWSA 3ZDDA 3QDKA 4J9LA 2Q0RA 3LWMA 4DSLA 5AFUA 2YI1A 3MDCA 1U4BA 8ICSA 4IQTA 7ICEA 2KLAA 4A2AA 5KFIA 5GAHP 5J0WA 1ZXOA 1D9FA 1QHAA 4BRGA 4RUAA 5GAEP 5L1IA 4K25A 4MEXA 5C2DA 2BR0A 1WCNA 4YR2A 4TQSA 4BRDA 3O1BA 3FZLA 5J0PA 3CCEN 2D4WA 1KAXA 2HSTA 1NGAA 3PX0A 4DF8A 3MDAA 4RNNA 4FWQA 4DSJA 1TYQB 1NJYA 2P9PA 2ZGYA 3M9MB 2XY6A 4A57A 3OJUA 4IQVA 1L3SA 4BC2A 2BGWA 3P31A 3FDSA 3UXNA 2HBJA 4H0YB 3LM9A 4KTQA 2PAVA 3EO3A 3O8MA 2BPCA 2VGMA 4RCHA 5BPLA 1NMDA 4UB1A 1VAZA 4GNIA 1X9WA 2P9LB 4JK8A 3ZEUA 3MWPA 3Q8SB 3QICA 5JLHA 2UVVA 2C2DA 5KQDA 3Q8KA 5J2GA 8ICKA 1QLNA 4RNMA 3MX2A 3JS6A 4JK1A 2NRXA 4QZIA 4BC5A 5AZJA 1TAUA 3TQ1A 5KT7A 4EZ6A 5ADXA 1MC8A 4J9KA 1KDHA 2NZTA 3WXLA 3A5LC 2Q0UA 1ZQWA 3H8SA 3FR0A 3UKRA 1Z6RA 5AQVA 4CZMA 4KLHA 5KT5A 4DQIA 4ISFA 2IHNA 3K75D 4DL2A 1H38A 2WTFA 4IO8A 1YXQA 3NGDA 2DPIA 3M9NB 4DLEA 1N8RO 2FMSA 8ICXA 3M8RA 2PFUA 5KG1A 1ZQVA 4DEZA 4O3SA 5AQLA 4FBUA 2BHNA 4Q8EA 1NK0A 1PZNA 4F5RA 3M1FA 2ZUDA 3B0XA 3MCAB 3H3NO 4O8KA 2R8HA 3RTVA 3CCVN 1MWMA 1VQ7N 2DPJA 3A5NC 4O5CA 3OBWA 1H1VA 4QZAA 2D0PA 2OWOA 4CD3A 5HHIA 4AM6A 1S97A 3MN6A 4NO7A 4A62A 2IVNA 1L3TA 1QQMA 8ICUA 3AAQA 1T6CA 4DQPA 1VQLN 5FPMA 3H7IA 3O4WA 2VA8A 4RQ0A 4RU9A 3GE1A 1SKWA 3ATVA 3VEWA 1BUPA 9ICEA 4C1NK 3MGHA 2BQ3A 2MUTA 5KG7A 3PW5A 2YCHA 4ELTA 2BCSA 1XO1A 2W8KA 4F93B 4TUQA 3EWAA 2AJQA 3WUHA 9ICKA 2P9PB 9ICIA 4IWVA 1ZQHA 1IXRA 5DKWA 4J9OA 2P6RA 2IA6A 1YUWA 3N4PA 3J8AA 1ZQMA 3JXUA 5IIKA 4XEIA 2FPLA 4Q44A 4PKGA 3RSEA 1VQON 1SL2A 4FWLA 3DJCA 4JEPA