2NRZA

Crystal structure of the c-terminal half of uvrc bound to its catalytic divalent cation
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
b'RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrzA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrzA01
1HJPA 1XWLA 1D9DA 2R8JA 3M9NB 3KHLA 4M9JA 5EWEA 3JPQA 4M47A 8ICVA 2BKEA 2ZTCA 4X5VA 2J6TA 5KFCA 4FBUA 4JV0A 4RQ2A 3MDCA 4DSEA 4RQ7A 1SKWA 4ELUA 5KFDA 8ICYA 2NRWA 5KT2A 3BQTA 2IA6A 4B9UA 3T3FA 2KZZA 9ICXA 3IHQB 1ZQVA 4C8MA 8ICAA 1KFSA 3RRHA 4DQQA 5J2GA 2KFZA 1ZQSA 4PHEA 4QZ8A 4TQRA 4GC6A 1NK7A 4KLFA 1ZQPA 2UVVA 2PI4A 2Y1JA 5KG1A 5CHGA 5DB7A 2PFOA 5IIJA 4DS4A 4O3RA 4F5OA 4MEYA 2HVIA 1U48A 4ZH4A 3UXOA 2PFNA 1ZQXA 3T5JA 1NKEA 1BPZA 4I2FA 4B9NA 4I2EA 4KN4A 3FDSA 4YFKA 5KFLA 5J2DA 3GIKA 9ICQA 1KSPA 8ICEA 4F5NA 3NGDA 1NK8A 4YG2A 4R8UA 2R8IA 2AGQA 2R8HA 4DLGA 4DFJA 3TI0A 4DL3A 3RJFA 4M9GA 4J9PA 4GLXA 4BWJA 4DQRA 1NJYA 1IM4A 3V7KA 2JEJA 2HHWA 3AUOA 1ZQTA 4RZRA 1TAQA 5KG6A 4UB2A 5J2BA 3ZDDA 9ICOA 4O3SA 4O0IA 4DSLA 1H38A 3OHBA 2ZJ5A 1NK9A 2J6SA 9ICHA 4ECYA 1NK6A 4YMNA 5KFHA 3PX4A 1JX4A 3GIMA 4Q45A 2NRTA 1COOA 1K1SA 5KG3A 5CB1A 4F4XA 4PPXA 2JEFA 4PHDA 2H5XA 5DG7A 2BGWA 4XUSA 4B9TA 1LV5A 1NKCA 3EWAA 1QTMA 3B0XA 2XCPA 2ASDA 4RQ1A 1ZQHA 3HP6A 2UVWA 4UAYA 3RH5A 1CEZA 2FLNA 4IQWA 3ETLA 4ELVA 1S77D 7ICUA 1B22A 4JV2A 1SZPA 4P4MA 4HYKA 1D9FA 5HHHA 1T8EA 3K75D 5KFTA 3PMNA 4PHPA 3GQCA 1Z00A 2I9GA 2W9BA 4O3PA 4F92B 5DBCA 1JXEA 4DLEA 3MR3A 1XC9A 2A1JB 1U4BA 4KLJA 4ECTA 4KITB 5J2FA 3H4DA 1ZQZA 2XCAA 3UQ2A 4ECUA 1L3SA 2W9CA 2ISPA 4R64A 3PW4A 2DPIA 1ZQWA 2BCQA 2ZUBA 5KFMA 3THVA 9ICWA 4LZGA 1UT5A 4RNOA 4YMOA 4IQTA 5J0XA 3SV4A 1BPXA 9ICBA 3TAPA 5L1LA 5J0QA 4DSJA 4XQ8A 1S0MA 7ICGA 9ICEA 4YXJA 3RAQA 5KFZA 4KLDA 2BQUA 4CCHA 3M9MB 4KLUA 5IIMA 1NJXA 4F4ZA 4O5EA 4GXIA 1S76D 4E0DA 8ICTA 3QZ8A 5DGAA 3LWLA 3ZDAA 1TFRA 3MBYA 5HNKA 3Q8QB 2Y1IA 3QE9Y 3UPQA 1ZQIA 7ICLA 7ICKA 3MDAA 5KFBA 4F93B 3FYHA 3GDXA 1ZQFA 3RJGA 2HHQA 8ICMA 1U9LA 3H8WA 5EWGA 4UBCA 3KHGA 4K4IA 3MGIA 4RT2A 2ZJ8A 3N4MB 4BGDA 4F2SA 5KFOA 4M9NA 4YVZA 3H7IA 2P66A 5KFIA 4RQ6A 5KG0A 4GXJA 4ECVA 3BDPA 5J0TA 4R66A 1JMSA 1ZQYA 4QZIA 2VA8A 5KFRA 1KTQA 4RPXA 4M6WA 4ECXA 4RUCA 4QZGA 5BPCA 4TQSA 4XRHA 1UT8A 7ICSA 3PV8A 5KFAA 1RXWA 2HHXA 2JEGA 2J6UA 5KG7A 4DL5A 4DQPA 4I2GA 1CUKA 3OSNA 4JV1A 1V9PA 5KT3A 4R8UB 4GC7A 8ICPA 9ICFA 1ZQCA 8ICRA 3MABA 1EXNA 3V6JA 1XSNA 4YP3A 4NM1A 5KT5A 1S10A 4DL6A 4DL4A 4DF8A 3C21A 5J0UA 2ASJA 1ZQEA 4QZEA 4O3QA 4YD1A 4O3OA 4PHAA 5KFUA 3PNCA 4G3IA 5CP2A 1L3VA 1BPYA 2I1QA 4QZAA 3EYZA 1ZJNA 1JXLA 4BDPA 4IR1A 8ICSA 4M0AA 4JWNA 3PW5A 2FLPA 5KFVA 4IQVA 5KFKA 1SL0A 1X9WA 4YCXA 1L5UA 2V4QA 1A76A 3JPNA 1KDHA 5KFXA 3RJEA 2FMPA 4MF8A 1WCLA 4F5QA 9ICKA 1A77A 5DBBA 2F1HA 1SL2A 4YXMA 4R63A 3T5LA 4ED2A 4J9MA 3OJUA 2JEIA 3M8RA 3HPOA 5J2EA 4F50A 1ZQOA 3V7JA 2AQ0A 4UB1A 2R8KA 4K4HA 1ZQBA 3ZDEA 5J0PA 1BPDA 2C22A 2AU0A 2BQ3A 3C1ZA 5J29A 8ICFA 2IBKA 5J2JA 2ASLA 3H8JA 1NOMA 3RH6A 5J2AA 1WCNA 2JZBA 2ZUDA 5KT4A 4TUQA 2W9BB 2BCUA 1C7YA 4DSIA 3V6HA 2BDPA 3RR8A 3K4GA 5J2KA 4DOAA 4KLLA 1IXRA 7ICIA 1X2IA 3QEAZ 4M2YA 4O3NA 2W9CB 5DB9A 3C2LA 5DG9A 4C8NA 2XY6A 1QLNA 1SKRA 2HVHA 2BHNA 2F1JA 5HMMA 5TZVA 2KN7A 3HW8A 4J9SA 4ECSA 8ICOA 5DLFA 2XGPA 4I2BA 4RPYA 3GIIA 2BR0A 4UAZA 4MFFA 3GV8B 4J9NA 3GIJA 2GWSA 4C8LA 4ECRA 4QZDA 1SL1A 4I2IA 4ED1A 5C5JA 4F8RA 3C65A 4FS1A 4P4OA 2Q0ZX 3HX0A 4Q8EA 4PGXA 3NTUA 4DS5A 5L1JA 2DFLA 1JN3A 3RJKA 4NXZA 4KLQA 4RQ3A 3GILA 3PW0A 2HHTA 2BCSA 3ZDCA 4F2RA 9ICRA 3MFHA 5D46A 4EBDA 4F3OA 5KFQA 1XSLA 3AU6A 3QZ7A 1KFDA 4EYHB 5CJ7A 4ED0A 4I2CA 4J9OA 3PW2A 1ZYQA 3RRGA 4B9MA 5DQHA 5DDMA 4B9LA 4F4KA 4I27A 2HW3A 4Z6EA 2NRRA 5JUMA 2C2DA 3JPOA 4BXOB 2XO7A 3MR2A 4K4GA 2BPCA 4QZFA 3UXPA 4EBEA 4QWDA 3M9OB 2RDJA 1BGXT 2WTFA 2XY7A 1NJZA 2C28A 3RJHA 4RQ8A 4DOCA 3TARA 4YD2A 5DG8A 2AQ4A 3EZ5A 9ICGA 5L1KA 1BVSA 4BWMA 5J0RA 4J9QA 9ICIA 3MGHA 7ICJA 4EZ6A 2ALZA 3TFRA 3T5KA 2AGPA 4ED7A 4IRKA 1L3TA 5IINA 4ELTA 3T5HA 2XGQA 4JUZA 2R8GA 9ICTA 2W8KA 4GXKA 8ICLA 4YMMA 4UB5A 1QSYA 3RB6A 2FPMA 4RUAA 1ZETA 1NKBA 3V7LA 4QWBA 5KT7A 4DQIA 4KTQA 8ICUA 3C2KA 4KLEA 1UA1A 5DDYA 4DO9A 2NRZA 5KFEA 4Q43A 4LZDA 1RYSA 4QWEA 3MFIA 2ISOA 3ISCA 4QWCA 4R65A 4I2HA 5KG4A 2HHVA 9ICUA 4I2AA 1NK4A 3PR4A 1XSPA 1BPEA 1ZQDA 5DKWA 1Y88A 1S97A 2AGOA 5J0SA 5KFJA 5KFPA 9ICMA 2V4RA 1B43A 2JZBB 4RQ0A 1QSLA 5CA7A 5EWFA 5EOZA 7ICNA 4UQGA 3LDAA 3G6XA 9ICLA 4DFMA 1N48A 7ICHA 3MR5A 7ICRA 3GV7B 1U45A 4QZ9A 4UAWA 3PMLA 1T7PA 5HHIA 5D4BA 1ZQKA 5KT6A 1D8LA 2UVRA 4F5PA 4KLGA 5KTQA 4RNNA 4YN4A 3Q8PB 2BQRA 2A1JA 8ICWA 8ICHA 1ZQUA 4I29A 4IR9A 3TANA 4KLMA 4QW9A 4TURA 4KMUA 3SV3A 5DGBA 3Q8LA 3KTQA 1S0VA 8ICJA 1U47A 2FPLA 3Q8KA 2HHSA 5D49A 5KFYA 5DBAA 3KHRA 4DL7A 1MSWD 3RR7A 4FO6A 2DPJA 1L3UA 1SKSA 1DOQA 8ICGA 2FPKA 4QZCA 5KFNA 4KLTA 4UBBA 1KFTA 1ZQLA 4DL2A 1TK8A 4DSKA 3C1YA 2PI5A 4I28A 5KFGA 4B9SA 4MF2A 1ZQAA 1ZQRA 2KTQA 4MFCA 1T4GA 1Z3EB 4Z6DA 4DSFA 4Z6FA 3V6KA 5J0WA 3UQ0A 4Z6CA 2FLLA 8ICZA 3RB0A 1Z00B 4NY8A 1TAUA 1RXVA 8ICNA 2M9NA 3PX6A 7ICTA 4F4YA 2RDIA 4YR3A 4EEYA 2NRVA 1NK0A 4DQSA 4IQUA 2XY5A 2KZMA 2KZ3A 4C8OA 1ZQQA 3PY8A 3Q8RB 1KLNA 4EZ9A 5J2CA 5L9XA 1MC8A 2UVUA 2FMSA 4KLOA 2ZTDA 2IMWP 3SI8A 2MUTA 3M8SA 1QSSA 3GV5B 1ZQJA 8ICBA 3UXNA 7ICQA 3IM1A 4NLGA 4RNMA 3MR6A 4NM2A 3RB4A 4ECQA 4P4PA 5J2HA 4DEZA 1N56A 5KG2A 2BCRA 2BCVA 4DF4A 2VA2A 3H8SA 2HHUA 3Q8MA 3G6VA 2W9AA 3H40A 3C23A 2MAXA 3HT3A 4NLZA 1K1QA 4KN7A 4J9KA 1S9FA 1S0OA 3Q8SB 4QZBA 7ICEA 8ICCA 3BQ2A 4PGQA 5HP4A 3LWMA 2W9MA 3QEBZ 4O5KA 9ICVA 5KFWA 2FMQA 4DFKA 2B21A 4UB3A 3BJYA 4KLHA 4QZHA 4YQWA 4B9VA 3JPPA 3BQ0A 7ICPA 1XS9D 2C2RA 2P6UA 1X9MA 1UA0A 4O5CA 9ICJA 3JPSA 2IHNA 3OJSA 3RBDA 5KFFA 1XU4A 2BPFA 4F91B 4F5RA 1MQ2A 4KLIA 7ICMA 4M6WB 1X9SA 4MFAA 5DQIA 2AJQA 7ICVA 1NJWA 1HUOA 7ICFA 2ZJAA 1DGSA 1ZJMA 2BPGA 4YR2A 8ICIA 3SZ2A 1RPLA 2VANA 4JK1A 3ISBA 1U49A 5DQGA 4FBTA 3EW9A 4PGYA 4C8KA 4DFPA 4ECZA 3ZD9A 1TV9A 2VA3A 9ICCA 1TKDA 5KFSA 1HUZA 4QW8A 4QWAA 4RT3A 3RJJA 3TAQA 1XO1A 5IIOA 3TFSA 4YR0A 3C2MA 1T3NA 1ZQNA 2V9WA 4DOBA 1JIHA 3HWTA 2PXIA 3E2EA 5KG5A 5IILA 3TQ1A 5J0YA 3ZD8A 5IIIA 1PZNA 4NLNA 3B0YA 1MQ3A 5DB6A 4ECWA 3LK9A 3RTVA 4M9LA 3EPIA 5F9LA 2W8LA 4ED8A 3RJIA 3JPTA 1TK0A 1D8YA 2PFQA 4UB4A 7ICOA 4EBCA 3RBEA 2ZUCA 1RZTA 5DLGA 4KLSA 3RAXA 2F1IA 8ICQA 4TUSA 3PO5A 3KHHA 4MEXA 4RQ4A 5CWRA 5J0OA 3C5FA 3PW7A 2NRXA 4Q44A 3EPGA 3SYZA 3N97B 2P6RA 4DWIA 4Q8FA 9ICPA 2LYHA 8ICXA 2ZTEA 3PR5B 3OGUA 1LB2B 3C5GA 3BQ1A 4FS2A 3PVXA 4ED3A 5HMLA 9ICAA 3RB3A 1KEJA 5CR0A 1TVAA 2C2EA 4IRCA 5L1IA 1KRPA 4I2JA 2XC9A 3H4BA 8ICKA 2ATLA 4XA5A 5DB8A 3ZDBA 9ICNA 4IRDA 4I2DA 1NK5A 4PH5A 4M04A 1S0NA 2IHMA 1ZQGA 2MUTB 5BOMA 3JPRA 5F9NA 3V72A 4M9HA 4JWMA 3ORYA 3OHAA 4RU9A 1RYRA 4BXOA 4LVSA 5J2IA 4EYIB 4NLKA 1AROP 5IIKA 4TUPA 3ISDA 5BOLA 4J9LA 1TK5A 2PFPA 1ZQMA 1BPBA 3RH4A 2OWOA 2KFNA 4ED6A 3PX0A 3GFKB 4RQ5A 4O9MA 4RPZA 4P2HA 3OSPA 9ICSA 3AU2A 4F4WA 3G6YA 4J9RA 3PO4A
chains in the Genus database with same CATH superfamily
4Y2RA 4BX9C 2R8JA 4FZZA 2YY6A 3AA3A 3KHLA 1KAZA 1HQUA 5ALNA 3T1AA 4ILJA 2VG5A 2J6TA 3LVWA 4ILHA 4JV0A 1QH9A 3DEEA 4ELUA 3HPHA 4NYFA 4CFCA 2G8UA 8ICYA 2IA6A 4CIGA 2QWMA 5ALRA 4DTMA 2K4IA 1TYQB 3IHQB 1ZQVA 1C0FA 1QVGM 3GE1A 8ICAA 3A2FA 1N61A 1KFSA 1EX4A 2CH6A 3TSQA 4ISEA 3CPEA 2PFUA 3NE6A 3F2DA 2ASOA 4GC6A 1NK7A 1Q86O 4FZLA 1WLJA 4BRLA 5GAGP 4O3RA 4XIUA 4O5BA 4FJMA 2RLTA 1UQVA 4I2FA 2OPRA 1ZQXA 3T5JA 2QI2A 1BPZA 2A42A 2P9NB 4B9NA 5C25A 1VSFA 4DTRA 4MLEA 5AQKA 4YFKA 3OYMA 9ICQA 3VEXA 3PZPA 3V9ZA 1BISA 4F5NA 1QQ6A 1NK8A 3AGRA 3WK9A 1Q3UA 4GLXA 2HHWA 4BWJA 1E4FT 4Y2JA 2JEJA 2K60A 2P9PA 2P9UB 3L3UA 5TKYA 4RZRA 5F2RA 1BCMA 4HAIA 3KLFA 4ZOHC 1S9EA 5M1OA 1JLAA 4JD2A 3FZMA 3PX4A 5HRRA 2LMRA 4M3XA 1E3MA 3TTCA 1K1SA 5CB1A 4JRQA 4F4XA 1S72N 3H0MB 5DG7A 4IDKA 3ZX0A 4XUSA 5CZ2A 3CCJN 4YOWA 1NGDA 1OH5A 3UKUB 4Q0BA 1Z4OA 4RQ1A 2ASDA 1RT5A 4NB4A 2UVWA 3J7YP 2QB0B 5KL1B 2Y9TA 3DDHA 2FLNA 3MWTA 3EE9A 5JLHA 1K8KB 3N4QA 4A61A 1ZBSA 2W9BA 3LDQA 4F72A 4X62K 1JXEA 3SBTA 3BEXA 4KHSA 5GTIU 4YOVA 1VQ4N 3T69A 2KK0A 1KVAA 4CJ4A 3CC2N 2DY4A 1ZQZA 2P9IA 1N5XA 5AKHA 3CCQN 3KHYA 2DPIA 1FKPA 1ZQWA 4AF1A 5AI9A 3TPQA 5AKZA 9ICWA 4WCEL 3CIPA 2UUAK 1ASWA 4CJLA 4B3RK 3IS9A 2KJ9A 1WN7A 2DFFA 1BPXA 9ICBA 5L1LA 9ICEA 1S0MA 1S3XA 4YXJA 2F77X 4FZMA 1HKCA 4JK7A 3M9MB 4DR5K 1NMDA 5AQYA 1HYZA 4CBXA 5AK6A 3IMXA 3QZ8A 5DGAA 5LL6Z 5AM2A 1JLCA 3EN9A 4BE2A 1TFRA 3QNOA 1RT6A 1T3VA 7ICLA 1N2XA 3QICA 4I6MA 3MDAA 5KFBA 3FYHA 3GDXA 1BA0A 2Y0SF 1N5YA 3VQQA 1KCFA 3KHGA 2D8CA 2E2OA 1HX1A 5E79U 2F9WA 3THXB 3H7IA 1V38A 3TAGA 1S1VA 4JI0K 3JYTA 4GXJA 2V52B 4O55A 3VQAA 5A0LA 4M7XA 3MK6A 4CJSA 1UHUA 5CR4A 3OS2A 1PK1A 4RPXA 2JLEA 3F2BA 5GAEP 4ECXA 4XRHA 3PV8A 3WKDA 1MU2A 3A8YA 4OKKA 4CEDA 1BOTO 3K5MA 2J6UA 3L4QA 4KI4A 2E1FA 3U3GA 4I2GA 1CUKA 5HP1A 3OSNA 1DEJA 4JV1A 4R8UB 8ICPA 2GWJA 8ICRA 1XSNA 2IOFK 4YP3A 2HB5A 4FW1A 1K9MO 3IUCA 2D1KA 4DL4A 2P5OA 4CDGA 2DQNB 4QZEA 2P5GA 1FFVA 4YD1A 4PHAA 2XI9A 2QTDA 5CP2A 5JMVA 1L3VA 2I1QA 4QZAA 3P38A 3QEIA 4GKKK 1JXLA 1C0UA 4UATA 4IR1A 8ICSA 3DAWA 3LP3A 2MRLA 3PW5A 1XNSA 2GV9A 5KFVA 3A5LC 5AQRA 4IQVA 2JH7A 5KFKA 2V4QA 1A76A 1KDHA 2A1AA 3BS7A 1BUPA 3T5LA 3ZSXA 3PIOL 4CEEA 2JEIA 4FJ5A 5KQDA 4CJPA 5J2EA 4F50A 3J7AP 1KVBA 4OJRA 1LCUA 2BQ3A 5J2JA 2ASLA 2X78A 4FLTA 1YT3A 1PVQA 1NGFA 5KT4A 4F9OA 1C7YA 5LJVA 3V6HA 1T3QA 4DTNA 1XMOK 3HYFA 4DOAA 1BWFO 1BHLA 3I0RA 3LP1A 4IXCA 2KD1A 1X2IA 4H8KA 4CZHA 4FJKA 5H2FU 2W9CB 3IKMA 3DXMA 2ZIXB 4OGCA 2ZJRL 2XY6A 2H3VA 4U6PA 1VQ7N 2F1JA 5HMMA 5TZVA 3NF6A 2JXJA 1RM6C 1XC3A 4B9QA 4GFJA 1B9DA 4UASA 4I2BA 4H0VB 2BR0A 1R0AA 1T03A 3GIJA 4ECRA 4CK1A 3OYIA 4CHPA 4I2IA 3C65A 5KPRA 1G99A 2F8TA 4CGGA 4JKFA 2WBNA 4PGXA 2YX8A 4IBNA 3NTUA 3O80A 1KC8O 2YHXA 5GIOA 3QFUA 4NXZA 4KLQA 3GILA 2HHTA 3AVMA 4BRMA 4JS4A 3CRXA 9ICRA 5AQZA 2FBVA 5BRHA 5FPNA 1LKYA 3WK6A 2HBMA 4EX7A 4EBDA 3THYB 4DTUA 2HBKA 2WB1C 3TKAA 1HNXK 4Y2TA 1ASUA 4I2CA 4FVUA 4DCCA 4B9MA 3PW2A 3RRGA 5DQHA 5DDMA 2HW3A 1L7NA 1U04A 2AA4A 3OS0A 5JS1A 1RNHA 2IC3A 4IFYA 2QKKA 2OEHA 3N7SC 5AM3A 1HNVA 2BPCA 4EBEA 1RDUA 3AGKA 3CJCA 4DCHA 3MGVA 1BGXT 2D4WA 4KHPK 1V4SA 4RQ8A 4DOCA 3O4WA 4YD2A 2VQFK 1IO2A 1NOYA 1BVSA 2WTUA 1OXJA 4J9QA 1OW5A 4EZ6A 3TFRA 2AGPA 1NGEA 2D5RA 3EZWA 5IINA 5AK3A 5AQSA 2NZTA 1RQLA 3WNHA 4GXKA 3SK3A 1CLQA 2FPMA 1R59O 1X42A 3GDQA 3QIPA 4IFEA 1K5OA 2OCEA 3MN6A 8ICUA 3FZFA 3C2KA 4KLEA 2KJ5A 1BI4A 3MEEA 2G06A 3T79A 2KKZA 4C4TA 2X6SA 1WOQA 3SQ0A 2ISOA 4R65A 5KG4A 9ICUA 4KI6A 4I2AA 1BNPA 4DV7K 2F8LA 5AQMA 2RRDA 1WNSA 3RMDA 3ZEUA 1N60A 4FWPA 1PUZA 1X1PA 4CEQA 3ALYA 5J1EA 1YI2N 1QSLA 5CA7A 7ICNA 2GO7A 1L6NA 4UAUA 4UQGA 3G6XA 3LP0A 3OY9A 1YITN 3M7DA 4CGIA 3CQYA 4A2AA 4LF4K 3V9XA 3AVBA 1SZHA 5ADXA 2P9PB 5D4BA 3I8DA 3DMJA 3H3NO 5KTQA 4RNNA 2BQRA 3CP8A 4BDZA 3TANA 4KLMA 4TURA 2LYBA 4KMUA 3M6GA 2QA4N 2HHSA 4JD2B 3H3OB 5C2FA 4FYDA 4DL7A 3DOKA 3RR7A 2DPJA 1L3UA 1SKSA 8ICGA 1HPZA 3LDPA 2FPKA 4KLTA 4CF2A 2GOLA 2QEXN 3TACB 4DL2A 4DSKA 2GH1A 3AMZA 4MDAA 3V9SA 3SR6A 3O1WA 2Q3SA 1RGIA 2I5HA 1LW0A 2G07A 2B6AA 3BY5A 4R5PA 1ZQRA 1C0TA 3M5RA 3RMAA 4DTPA 2GUPA 3MN7A 4Z6CA 4CW7B 1SZ2A 4KV8A 8ICZA 5C24A 3TTFA 4Z4CA 3SI6A 3KD1E 4B3OA 1RXVA 2WF7A 3LP2A 3PX6A 1XQSC 1B4FA 2O4GA 3AO1A 3O9QA 4F4YA 3VGMA 4A2BA 4YHHK 4JYAK 3WEEA 1RDAA 4EEYA 2VWBA 5K14A 2KZMA 2PYJA 1ZQQA 3PY8A 1VQNN 3M3ZA 4EZ9A 2P9IB 2WC9A 4CJTA 3VEVA 5GINA 5KPTA 4KLOA 1CZ9A 3MECA 2MUTA 3M8SA 4GV6A 2KEYA 2LM1A 3CD6N 4RNMA 5KL8B 4NM2A 3N4PA 4ECQA 3CFPA 4FJ7A 5AI6A 5J2HA 2O6KA 1N56A 5KG2A 1SIJA 2NNWA 1RG6A 3E1YA 1WAJA 4DV5K 3IFRA 3UE5A 2IOHA 4FL9A 3HJFA 3OBYA 5AZIA 2CGLA 2PZSA 3FFIA 3QINA 5BPNA 3G6VA 2ESEA 2OPPA 1RT3A 3BS5A 4PJ0U 2E2QA 1S0OA 4GV9A 1HNWK 3BQ2A 2RPIA 3LWMA 2W9MA 1ZC6A 3G71N 1TE2A 3NF7A 5AQJA 5KFWA 4AQYK 3CG7A 4K42A 3D0PA 4H5VA 4QNLA 2KNJA 2KHOA 4YQWA 3W0LA 4M3WA 3JPPA 3BQ0A 3CFRA 4DQ8A 2YMQA 3DJCA 3U4LA 4I2PA 1EWQA 1X9MA 1T44A 3H0LB 3OHRA 2VYPA 3JPSA 2IHNA 2K4PA 3HP9A 5LJWA 3OTOK 3DLBA 1XU4A 4F91B 4M45A 3TAMA 7ICMA 1QQ7A 1X9SA 4MFAA 4BJQA 5DQIA 4H5WA 2HMPA 3VA3A 5EE1A 3ENHA 5EU7A 1HUOA 4B08A 1Q9YA 1CI4A 5BPLA 3JSMA 3F5EA 1RPLA 3ISBA 2ZIWA 4FBTA 1SS6A 4EX6A 4PGYA 2M0NA 2Q0UA 4QIWC 1TV9A 4OO1J 1KQSM 1EETA 1NZBA 1ZRMA 3TSPA 2WFBA 3SJJA 4B3TK 3VEWA 4QW8A 3LZJA 1XO1A 1YAGA 3O9RA 2P9UA 1XNQK 3UB5A 5IT9O 4YR0A 3C2MA 2HDOA 1T3NA 1ZQNA 2V9WA 1QQ5A 3VF4A 3E2EA 3E01A 3O9TA 2OH2A 4H0XB 1S1XA 4BRQA 1TAMA 3L0QA 1PZNA 3ZLJA 1HLUA 5DB6A 2IVNA 4FK4A 4BR2A 4ECWA 4M9LA 1Q18A 4CHYA 1VSJA 3LALA 3VEYA 1RBVA 1Y64A 5SZTA 3JPTA 4PA1A 4FJGA 4H0TB 1NOZA 2WF6A 3DI6A 5DLGA 4KLSA 3KLHA 4FLZA 8ICQA 1ATRA 1JL1A 1TUUA 3UKUA 1IIPA 4RQ4A 5CWRA 1DT9A 3VQ9A 2QKBA 2MSNA 4FLYA 2VIXA 4Q8FA 4ISGA 4BQLA 2XRIA 5ALLA 4CE9A 2LYHA 5HR6A 5ALTA 4USAA 3PR5B 1SV5A 3D2EB 3C5GA 1KW4A 3O5BA 5AI5A 4ED3A 5HMLA 9ICAA 5CHIA 1JJ2M 2HBJA 1VSMA 5G5HA 1K8KA 3AVAA 2C2EA 5L1IA 4I2JA 1HNIA 8ICKA 4Y2XA 4UARA 2HNZA 4I2DA 3ULDA 1NK5A 1HPMA 4EP4A 2OXOA 3DXMB 4WF9L 2E5SA 4ISFA 1ZQGA 4BG8A 4P0QB 1RTIA 3V72A 3DOLA 3ZSOA 4DUYK 5HBMA 1Z19A 3LL3A 1WWUA 2PMZC 4NCBA 4NLKA 1NNLA 1AROP 4TUPA 5GTHU 5BOLA 4J9LA 3FZHA 2KFNA 2VJ4A 2FE9A 4ED6A 4CIEA 1BCOA 1WSIA 4BRDA 1GLFO 2GEMA 3CM6A 4A59A 3F53A 4F4WA 5ALYA 3SV3A 4J9RA 3PO4A 1HJPA 1BNOA 1XWLA 1D9DA 1YHQN 3M9NB 4E7KA 3WXLA 4XH1A 5T14A 4L3QA 3C94A 4X5VA 4RQ2A 4RQ7A 3LDLA 4O44A 1J9AA 2MA1A 3F2KA 2BUPA 4B9UA 3ZX2A 9ICXA 1IKVA 4KH4A 1J5OA 4QS7A 1JLFA 3THXA 1ESVA 4DQQA 4B3SK 4PHEA 4TQRA 4KLFA 5AM0A 3WUHA 5KG1A 5IIJA 4CI6A 4MEYA 2HVIA 4H03B 3HOSA 4YORA 4DR7K 3UXOA 2PFNA 2YHYA 2F76X 3R8EA 4A5AA 1L7PA 3SPYA 2JMGA 3HOTA 5J2DA 5KFLA 3GIKA 5AKLA 4E3SA 2OYYA 4FLUA 4R8UA 2R8IA 2AGQA 2G08A 2R8HA 4DFJA 4DU3A 1SUQA 4DL3A 4M3TA 4BR5A 1XMQK 3VGLA 3H08A 4KTZA 1ZQTA 1WAFA 3LPTA 5KG6A 3LDNA 3NBPA 4PKHA 5J2BA 1LVHA 9ICOA 4YDUC 1KKXA 4O0IA 5BRFA 1H38A 3BZKA 4BVOA 1NK9A 3P83D 3DLHA 4FJJA 1SV4A 4YMNA 3O9SA 2BGGA 3GZFA 2D0OA 2NRTA 3TAFA 4A57A 2VCPA 5ALIA 2JEFA 4IKFA 2K4HA 4PHDA 3C6AA 3VEOA 2H5XA 4CJ5A 4B9TA 4JKAA 4LY7A 3SQ1A 3NDKA 1NKCA 3ZEUB 3B0XA 2XCPA 4IJAA 3VESA 1E4GT 2EX3A 2Z1JA 3K9JA 1QS4A 3QU5A 2HSTA 4CECA 1B22A 4FLVA 4DTOA 1BG3A 1VQLN 1D9FA 1IKXA 1T8EA 1NI3A 1ATSA 4MHVA 2WF9A 3PMNA 3K2PA 2FJ6A 4DV2K 3GQCA 4H4MA 5ALZA 4YOTA 1CZBA 5T7BA 4F92B 4ZTJA 4JNEA 3MR3A 1XC9A 4EFHA 5ALHA 1U4BA 4FM1A 2A6AA 4KITB 3H4DA 4PL1A 3UQ2A 1EQYA 3K58A 2DBYA 2W9CA 3NRZA 2ISPA 4FVMA 3GOIA 3KIOA 4DR2K 4NL9A 2BCQA 2ZIUA 1TVRA 3Q7BA 3THVA 2KVCA 1UT5A 3M6KA 1U2VB 4YMOA 2YKNA 4IQTA 1BU6O 3SV4A 5CY4A 4HVJA 1B9FA 5EXWA 7ICGA 2E8AA 3RAQA 1HRHA 4CCHA 4NO7A 3WXMB 1NJXA 4JI2K 4E0DA 4E1MA 3LWLA 4N56A 2DPNA 4BR4A 5BR8K 2HI0A 4LD0A 5HNKA 3VOVA 3A0HU 1CXUA 1ZQFA 3RJGA 5JVHL 3H8WA 4UBCA 3D2SA 1IG9A 3WEEB 1RT7A 3BF1A 3N4MB 4F2SA 2ZD1A 3UM9A 1I94K 4KH6A 3L3VA 4C7ZA 3E9PA 4ECVA 3NH2A 4E7LA 5J0TA 3IRUA 3WT0A 5KFRA 1OUQA 1ZXOA 1TKTA 2B5JA 3CMEN 4M6WA 4RUCA 5BPCA 3ZX3A 4TQSA 7ICSA 2Q1NA 5AICA 5KFAA 2HHXA 2H3FA 2JEGA 2ZGYA 4W5NA 3V1OA 3QUBA 4DL5A 2E2PA 1CRXA 2QKQA 4BR9A 2E4LA 4CBUA 1Q3VA 3G6EN 2OPQA 3SUQA 4GC7A 4OGEA 3ZCMA 5JU5A 5AIBA 4NM1A 4BY9C 2O8BA 1S10A 5I3UA 3G25A 3C21A 1T94A 4H5RA 4DG1A 3V6DA 2CGKA 3PNCA 4G3IA 3MXIA 1HNZK 2DF4B 3AN1A 4HCCA 1BPYA 3EYZA 3AO4A 4K8ZA 2QXLA 4LH4A 2R7YA 5AQUA 3I1YA 3OYKA 1SL0A 4Y2YA 1X9WA 1S5JA 4QS8A 3RJEA 1WCLA 4F5QA 1ZBFA 1SL2A 4FXDA 4YXMA 4R63A 1Z1VA 4ED2A 4J9MA 4XEIA 3OJUA 2ATQA 1NGGA 2HMXA 3HPOA 4BGBA 5B5EU 2F8SA 3V7JA 2AQ0A 3L2QA 3WK5A 3ZDEA 5J0PA 1YXQA 2ZIWB 5J29A 8ICFA 2IBKA 5ALUA 3H8JA 3VQCA 1NOMA 3RH6A 1WCNA 3LVVA 3F2CA 1YF5L 3ZSQA 4C23A 2O8CB 4DV0K 3HI0A 5ALFA 4RW9A 4RQNA 4K0KK 1HIWA 1QQCA 3G0ZA 1IXRA 4HUGA 4KRFA 4QCLA 1WWVA 3OBWA 1O08A 1YTAA 3NH1A 4EEKA 4GNIA 4KH5A 4C8NA 2IDOA 4JI4K 1SKRA 2ZE2A 5KRTA 2A3VA 2KN7A 3IG8A 1NM1A 5DLFA 4AHTA 2XGPA 3KK1A 4RPYA 4H0YB 5LY3A 3A0BU 3GIIA 1N33K 4MFFA 2LSNA 5HOOA 4J9NA 3AVHA 3HL8A 4B8CA 5HRSA 2YQEA 3AVKA 5AQVA 4AYBC 4F8RA 1VQ9N 5C5JA 3VQ8A 4FS1A 2VJ5A 3L4IA 1NG9A 4CK2A 5L1JA 5JVGL 2DFLA 2P9SA 4K25A 4P0PA 4U7CA 3RJKA 3KD5E 3TAEA 4JI7K 4RQ3A 3ZDCA 4JK8A 3WKAA 3MFHA 4DMNA 5DM6L 2LKYA 1M6YA 2O8FA 3SUNA 1XSLA 4A5BA 1OH8A 4CD3A 2EAMA 3QZ7A 3BQ7A 1NGJA 2KVSA 4DV3K 3UKRA 4JKCA 1M90O 4F4KA 2ES6A 4AHRA 4CEBA 4I27A 1XNRK 1N62A 4AHUA 4Z6EA 3L3FX 4JLHA 5BPMA 2C2DA 1F21A 4LH5A 3MR2A 4K4GA 4YFUA 4QZFA 3L2VA 4QWDA 3M9OB 4FFDA 5AKEA 2WF5A 1OVYA 3F9MA 3NFAA 2WTFA 4NWIA 1FKOA 4CF3A 1NJZA 4FWOA 3RJHA 1VSEA 3FGUA 4GKJK 2D0CA 1SV0C 2LPEA 3K9KA 4IWVA 2FSNA 5KGWA 4OX9K 3KKRA 2KMDA 1Q81O 4ED7A 2EAPA 4ELTA 3QB0A 2QB1A 4PKGA 3SMSA 2XGQA 3QO9A 3WQTA 4BC4A 5AQIA 4LF7K 3A0IX 4PQUA 2D0AA 4B1WB 3RB6A 1ZETA 3V7LA 4QWBA 3K5NA 4UB6U 4DR1K 2RHKA 3DLLL 4BE1A 1LWEA 4Y1DA 3FLCO 2B4JA 1UOCA 2E1YA 3FR0A 1FO4A 5KFEA 4JI3K 1RYSA 3TWHA 4QWEA 2RE2A 3ISCA 5E84A 2UXBK 4I2HA 3VENA 2HHVA 1WG8A 1VQ8N 4CVNE 2PKEA 1DTTA 4US9A 3JXUA 3NVVA 1GOAA 5FRMA 5J0SA 3C6UA 5KFJA 9ICMA 2O8DA 2V4RA 3SMPA 1RDCA 2OTJN 4KB0A 3LDAA 1L7OA 3NVYA 4DFMA 9ICLA 4CHQA 5AFUA 3MR5A 4WJ3B 4HUEA 4QZ9A 4UAWA 3PMLA 4BQZA 4ZHRA 1HQEA 3C7NB 4CEAA 5HHIA 2UVRA 1ZQKA 5KT6A 4F5PA 3Q8PB 3AVIA 1WSGA 2A1JA 4LJXA 1ZQUA 4IR9A 3HPGA 4FWQA 4Y2PA 1S0VA 4ILGB 3KTQA 4RW7A 8ICJA 3Q8LA 5DGBA 3FC4A 3EO3A 2ITMA 2FPLA 1BQMA 3LZIA 3CCUN 1KXPA 3H46O 4I2QA 4IEIA 4C0ZA 2JWKA 3KHRA 5HRNA 3QIOA 1MSWD 4BRPA 3L6QA 1OKJA 4KFBA 5ALKA 5SWMA 1KFTA 1XI1A 4IO9L 4BRNA 4CF0A 2YB4A 2VG7A 1V4TA 4OJ5A 4B3MK 2PI5A 4I28A 1TL3A 4CJRA 4YNQA 2W11A 1RQNA 5J8YA 2KTQA 1T4GA 4G9ZA 1MA9B 2JRZA 2WONA 4FWNA 5AQLA 3V6KA 5J0WA 2EWSA 2KJ8A 3SCXA 1RYUA 3RB0A 4CZFA 3OS1A 1KL9A 3D2EA 1JL2A 1IKYA 5JICA 2I7PA 4YR3A 5TKWA 2NRVA 3HKZC 2Y0SC 2XY5A 3BZCA 3MWPA 4YOUA 5AQTA 3PSPA 1KLNA 1CXQA 1DKGD 3SPZA 1O03A 2CH5A 5DMRA 1P7DA 2FMSA 2ZIUB 4P0QA 1RFQA 8ICBA 4O0JA 4NCGA 4NLGA 5ALOA 5AJ3K 3MR6A 3RB4A 4OPHA 1GLEG 4Z0UA 4JI6K 4DEZA 3THWB 1A5VA 1SB3C 3KK7A 1PK3A 2VWJA 1M1KO 2BCVA 4H0OA 4DF4A 2I6XA 2VA2A 3TU5A 3HXMA 3QEWA 2Q0RA 4QOZB 4KAZA 3NVWA 3Q8MA 5FLXO 3M1YA 3C23A 2MAXA 3O1BA 4NLZA 4KN7A 3HM9A 1VRTA 4FJXA 3QYPA 4FJLA 3Q8SB 4QZBA 7ICEA 3SUOA 2KP7A 5HP4A 4O5KA 3AL0B 2G8KA 2FMQA 4DFKA 2B21A 4QZHA 4NL9C 5HL7L 3CCVN 2G09A 3WXKA 7ICPA 3FFKB 3AVNA 1UAXA 4CHZA 1OH6A 1AQ6A 1GLCG 4BG9A 5F0XA 3NS1A 1UA0A 1IV0A 3N7PD 4FOEA 1B0XA 1S1WA 2IS3A 3RBDA 4YDUA 1YZ6A 4PL2A 1X40A 3QUQA 5KFFA 4B1UB 3ZT0A 4F5RA 1MQ2A 4KLIA 4M6WB 2G5HB 3KFUF 4GVEA 4BROA 7ICVA 4RTFD 1D4XA 2E3TA 1DGSA 4Y2VA 1MN8A 2BPGA 4Z4IA 5C10A 3KZBA 4OJLA 2VA3A 3AARA 2O8BB 3WNGA 3SAFA 3RFAA 1TKDA 4EP5A 4FWKA 1JXBA 4H5TA 4JKGA 4FSVA 4CF8A 3RJJA 3MCAB 1N8RO 3TAQA 2GLEA 2B6GA 1VSKA 3C95A 2YV0X 3B9JA 4CHOA 4PY5A 4N76A 5AKIA 2PY5A 1TV6A 3GBTA 3I55N 1COKA 3PLAA 5K4LA 2XIDA 1HJRA 4IEEA 1RILA 3B0YA 3O08A 3VA0A 2KOBA 1EP4A 1Z1BA 3WK8A 4RWTA 3J8AA 4EBCA 3RBEA 3ZSWA 3I28A 4FW2A 4BRCA 4O8UA 3ZETA 3EUB2 4TUSA 4RCHA 3ZT3A 4K8XA 3KHHA 3IG5A 4KMOB 2ZF5O 3KLGA 1GLJO 4DWIA 1JCGA 4Q44A 1YZ7A 3SYZA 2P6RA 1ZBUA 1MA7A 4FOIA 3T1HK 8ICXA 1LB2B 1K73O 3BQ1A 3PVXA 1W7AA 2F4VK 1VHXA 3L2WA 5CR0A 2DFEA 4CEOA 3I33A 4OVLA 4RW6A 2XC9A 3K5OA 2CN1A 4CZIA 4Y2UA 4RW8A 3L2RA 3L4PA 2A1SA 3VF2A 1N34K 4PH5A 4M04A 1PVPA 4OPAA 1QQOA 3RMBA 2OPSA 2IHMA 4BUGA 5BOMA 3JPRA 3HSTB 3QDKA 5F9NA 3KKAC 3VTHA 3CHWA 2E6LA 3V9WA 5CEHA 3ORYA 2YKMA 4LVSA 4RU9A 1Q46A 4EELA 4BXOA 1LW2A 3FZLA 4GMJB 4MO4A 5ALGA 5DK5A 3ULEB 4E1JA 1TK5A 1ZQMA 1U2VA 3PX0A 3UIQA 4RPZA 2HMIA 3GU3A 4P2HA 3OSPA 4PWDA 2KKPA 4L8RB 4KO0A 2P9SB 4M9JA 4P0PB 3JPQA 4CF1A 2AHOB 8ICVA 3SMVA 4FBUA 3Q7CA 4MDBA 1SKWA 1ZXIA 4OD0A 2DUYA 2ZWHA 5KFDA 5EOYA 3P39A 1HYSA 2O8FB 2NRWA 3BP8A 1NWKA 4CEZA 2KIVA 5EE9A 4C8MA 1FK9A 2A5XA 3UKRB 3ZSYA 4HCBA 3IDWA 3TR8A 4C80A 1IG6A 2KE7A 3J81O 4JKBA 3ISNC 1ZQPA 1Q7YO 2ZG6A 2YNHA 2UVVA 5CHGA 5DB7A 1Q82O 1VLBA 3KZXA 3VQ7A 5CZ1A 1NKEA 2ZIVB 2GWKA 1RBSA 2HF4A 4I2EA 4X65K 4OJOA 3VQPA 5EE0A 3MN9A 8ICEA 2P1JA 4I9QA 2PAVA 3KWIA 3I8BA 4M3UA 4HTLA 4CIFA 2HOEA 4PL7A 2K8BB 4M9GA 4DQRA 1HYVA 1NJYA 1I39A 5HLFA 3V7KA 2BTFA 3CYMA 2E20A 4H4OA 3CCMN 4ICAA 3SENA 4DSLA 4XH4A 2EZYA 1REVA 3OHBA 9ICHA 1KN5A 1KVCA 2OZMA 1JX4A 3CM5A 4NLBA 3O9UA 4PPXA 1A6SA 1XHXA 3H45C 4QJFB 3D45A 3VN5A 4M3YA 3CC4N 2G8WA 4Y2SA 2BGWA 3PUFA 3HJEA 1LV5A 1IG8A 3AA2A 3EWAA 1KBUA 1QTMA 4O3MA 4V19S 1ZQHA 2JH1A 1X9XA 1QHTA 3R1XA 2O8DB 3DRPA 2AXTU 5AIAA 3OPXA 4IQWA 3ETLA 4ELVA 7ICUA 1DGJA 4JV2A 4E89A 4P4MA 4HYKA 2VQEK 4DTJA 3ID8A 5AM1A 3A5NC 1Z00A 4O3PA 3CCSN 3D6JA 1H1VA 1TGOA 2IIRA 4DLEA 2DL0A 2O8CA 3I0SA 3NCIA 2A1JB 4KLJA 3LAKA 3RSEB 5ALJA 5J2FA 3OA9A 3HZ6A 2XCAA 4ECUA 2HOIA 4CFAA 2HBLA 1FW6A 3KOOA 5ALEA 4R64A 3PW4A 5CYQA 3MCPA 5KPZA 5JRTA 5KFMA 4JHDA 2H3IA 4LZGA 3K1ZA 3B6OA 4KBOA 3OYAA 3MEGA 1PVRA 3M8QA 3ZYYX 5J0QA 2QXFA 2X6NA 4W5QA 5AI0A 5KFZA 1MWKA 3ENBA 2UU9K 2QWOA 1BDGA 3SUPA 1WBBA 2DKXA 5IIMA 4KLUA 4F4ZA 4O5EA 4DV4K 1S76D 3LM2A 8ICTA 2LYAA 3ZDAA 3QE9Y 4JEPA 2W42A 1ZQIA 1SWWA 4BR0A 4F93B 2VGNA 8ICMA 4JAXA 4FCYA 1K8AO 2JGAA 4H5NA 4AH9A 2WAQF 5EWGA 5D3GA 1HKBA 1SV0A 3MGIA 2DFHA 4OKEA 4NLCA 3ALRA 2A41A 3R9PA 3ZT1A 4ZTFA 4OKJA 5KFOA 2W03A 2P66A 1Z6RA 5KG0A 3DRRA 3BDPA 1CZAN 3QUTA 1JMSA 3MX2A 4M41A 4DTSA 4IOAL 3AVGA 2KHQA 2YHAA 3W3DA 2IGIA 3HSCA 2E8MA 5J8YC 1UT8A 1F0MA 1RXWA 5GADP 3HVRA 4DQPA 2YNIA 2G8VA 5ALDA 1V9PA 1JCEA 5KT3A 3VGKA 4B1VA 1UPHA 1ZQCA 4U67L 1EXNA 3V6JA 4E7HA 2QK9A 5F1XA 4CJKA 4I7FA 5KT5A 4CZJA 1Z05A 1ZQEA 4FM2A 1BO5O 4O3QA 4AHVA 3MEDA 4NV0A 2NYVA 5AQWA 5ADXH 3P5JA 5HROA 1VK0A 4JWNA 3OYDA 5EY4A 2FLPA 3DM2A 2H3ZA 5M1PA 1VSHA 3OYHA 1QZ6A 1JROA 2KSOB 1L5UA 3JPNA 2HF3A 3MDQA 3MC1A 5KAFU 4BREA 3FAHA 5DBBA 2F1HA 3VMFB 2EDUA 1A5XA 4FJNA 3AO2A 2VGMA 4CF4A 2F96A 5AQPA 5AZJB 3M8RA 3QU7A 4JI1K 1ZQOA 2A19A 1N5WA 5BRDA 3AY9A 2FC0A 4CF9A 1ZQBA 4N41A 1ZRNA 4EENA 1BA1A 3C1ZA 5AQFA 3NVKA 4IG0A 2BCUA 2LM4A 5J2AA 5C12A 2UXDK 4TUQA 1B92A 5KQ8A 1VQMN 4OPJA 3OYBA 3K4GA 5J2KA 1T6DA 4KPYA 2LI6A 3MMVA 2WOMA 4JKGB 5AHXA 1YTUA 4LFAK 3QEAZ 3OYEA 3C7NA 4DR6K 1OH7A 4IO8A 4M3RA 3OYNA 1O13A 2HOFA 4KKOA 3LANA 5M1FA 1A0PA 3WK4A 2HVHA 1ZBIA 1XO0A 8ICOA 3AO3A 2XHBA 2ETJA 4UAZA 3GV8B 1D8BA 4E19A 2W04A 2GWSA 1HR0K 1S1UA 5TISU 4QZDA 1IBMK 1FEZA 3FE1A 4MFBA 5IWAK 4LF5K 4E7IA 2DGZA 4IL6U 3QNMA 3ZETB 4P4OA 3KLIA 2Q0ZX 2RQ5A 2W55A 3HX0A 4CJ3A 1N63A 2W3RA 4Q8EA 3HK2A 2Z7JA 4LF6K 2E5LK 3EKSA 4OJPA 4DS5A 2FBXA 1QE1A 1DXSA 3S6JA 3JS6A 3NVMA 3WNEA 4IOCL 2VWKA 3PW0A 4W5TA 4F2RA 5EVZA 2HNDA 3VCBA 2Q31A 4J8FA 5AQXA 3U9ZA 2A1RA 4K43A 5KFQA 5GAHP 3IG1A 1Z25A 3HBTA 4EYHB 2W3SA 5CJ7A 4AHSA 3QUCA 3E9LA 2YHBA 4B9LA 2IAJA 4LF9K 1C0GA 2EZXA 1VRUA 1HUXA 2MU2A 5AQOA 2DWQA 4BXOB 3JPOA 1BIUA 2XO7A 5KAIU 1VSDA 4BRIA 4KX5A 1J53A 3HRGA 3LPUA 1N36K 2E6MA 3S41A 3CJAA 2D3DA 2XY7A 2HOQA 2YMLA 4WQ5A 1A5WA 3THWA 3EE8A 2K4EA 3VQDA 4KHQA 4B6JA 3NF8A 5DG8A 2AQ4A 1J2MA 9ICGA 3VQ6A 5J0RA 4BWMA 1ASVA 2FBYA 3MGHA 3R9KA 2I5JA 3QXGA 4IRKA 1VQ6N 3ZI4A 1LWFA 3J80O 3O3FA 1ED1A 4ID5A 5E41A 1JLBA 9ICTA 8ICLA 1QSYA 4UB5A 1N32K 3NASA 3VC8A 1NKBA 1FJGK 3O3HA 5KT7A 4RQMA 4KTQA 4RG8A 1SXEA 1UA1A 4G9BA 4DO9A 4J03A 5ALWA 4FWLA 2ASMA 1NK4A 2ZXIA 3PR4A 1XSPA 4RW4A 1BPEA 3SNNA 1ZQDA 2QM1A 3CQ8A 5DKWA 4FPBA 2AGOA 4DHYA 2QARB 3J81j 3EEQA 3CXCM 1KD1O 3SBGA 3EY1A 2JZBB 4PZNA 2Q97A 3AM9A 2UYTA 5EWFA 2NRHA 2P9KA 5ALMA 1DTQA 5CE3A 2LBOA 1JLQA 1N48A 7ICHA 7ICRA 3GV7B 4EHTA 1HEKA 4UB8U 2AH5A 1KQQA 1ZD4A 1D8LA 1DK3A 4KB1A 4KHYA 1WSHA 4YN4A 3CCRN 3CMAN 3A5OC 3DYAA 4WFNL 4QW9A 1XUPO 3DLGA 3B6PA 5J2MA 3CQXA 3Q8KA 3CETA 1Q9XA 3LDOA 5KFYA 4Z4GA 3QU4A 1RDDA 2F8KA 3HILA 4KTWA 1T05A 3CC7N 3LM9A 1O1WA 4FO6A 3NMUA 3PSIA 5KFNA 4UBBA 3V1RA 1ZQLA 3S3MA 1TK8A 4YY3K 3KKAA 5KFGA 3AVJA 4B9SA 4BVPA 1ZQAA 1W9HA 3D2FA 4C4RA 2G5IB 2KQ2A 3OTQA 5AQHA 1Z3EB 4Z6DA 5FPDA 5AQNA 2BE2A 3DLRA 4WFAL 4GIBA 3UQ0A 3BF3A 3VTIA 3I56N 1LAVA 4AM7A 4K41A 4I9LA 1Z00B 3CNHA 4NY8A 1FIQA 8ICNA 1MWMA 2M9NA 3QEXA 3CERA 3S9HA 1DRGA 2RDIA 4NJ8A 2AP1A 2GUIA 1Q8IA 4CK3A 4IQUA 5FRNA 4BRGA 3ENOA 2KZ3A 3CW2C 1ECWA 4DUZK 3CF5L 1YIJN 1IBKK 2ASPA 2PYLA 2YJEA 3F5AA 2E8PA 5L9XA 2IMWP 4JHDB 3ATUA 1QSSA 3D7EO 1C0MA 3IM1A 1ZBHA 1GLAG 3WXJA 2G8IA 3ULEA 2W41A 1YVUA 2IOCA 4DU1A 4ID1A 4GVMA 3BGRA 3H8SA 3FM9A 2HHUA 1HMVA 1RT4A 3AEVA 4FWMA 3VETA 3H40A 1LAWA 3F73A 3O6WA 2QWLA 1S9FA 1JI7A 3QU2A 3VQ4A 3AQFA 3IDHA 2WFAA 3RWUA 2B0CA 3IAYA 3BJYA 4UB3A 4KLHA 1XS9D 1W97L 4ICLA 3WNFA 3B8AX 5HR7A 2CRXA 4TSXA 3F9KA 2W43A 9ICJA 2N1RA 2BPFA 3IP4B 3M6ZA 1VJ5A 2W7OA 4GW6A 3NH0A 2W6LA 3IRXA 3QU9A 4KX3A 1NJWA 1Q8KA 7ICFA 2ZJAA 1EWRA 1L7MA 1ATNA 4YR2A 3SZ2A 2ZIVA 2VANA 3H0RB 2EAOA 1U49A 2BANA 2Z1HA 3GG4A 1VDVA 4B1ZA 1C1AA 4DFPA 2GBZA 9ICCA 3SEIA 1RBUA 3ZT2A 4Q5VA 1TUYA 1IJJA 5C2DA 2KIWA 2EQYA 4J2BA 3CJ7A 2IOFA 1FFUA 1WBDA 4DKWA 1NNEA 5IIOA 3ITHA 2YNGA 1BL3A 3WKEA 2ITGA 5AI4A 1EXQA 1C6VA 3K0SA 2CGJA 1JIHA 3HWTA 5KG5A 1X3MA 3TQ1A 5J0YA 3ZD8A 4Y0WA 5IIIA 3F5TA 1WSJA 1RT2A 4EHUA 3RTVA 4CJQA 2YI1A 1UWBA 5F9LA 3SQ2A 4DR4K 2W8LA 4ED8A 3RJIA 2PFQA 7ICOA 1VQON 4UB4A 3AO5A 2ZUCA 2A3ZA 3MXMA 1JALA 4M7YA 3O0FA 3QX7A 5H1SQ 5KI6A 4MEXA 3BUZB 3ZSRA 3C5FA 3UMBA 3EPGA 3N97B 1RTJA 1XHZA 4CESA 3NVZA 5DM7L 2EH9A 2ZTEA 4FJHA 3HKZF 4FS2A 3VQ5A 4JKDA 4Z4FA 2WHEA 1KEJA 1TVAA 2OM6A 3DLKA 3QERA 5DB8A 3KJVA 3ZDBA 9ICNA 5LMNK 1KAYA 2W7PA 2QWQA 3O4QA 1UCVA 5FP0A 4CZGA 4FLXA 1S0NA 3KBBA 1QCKA 4EAHD 4BDYA 1WUAA 4FZYA 1GLDG 1GLBG 4FZNA 3OW2M 4JWMA 5JLFA 3OHAA 1RYRA 2V7YA 5J2IA 2VKQA 2KG5A 2PFPA 1QVFM 1IBLK 1BPBA 3CJ1A 2OWOA 1K6YA 4O9MA 2E1EA 5J2PA 1LWCA 3T1YK 9ICSA 3AU2A 4IRDA 4BC5A 3G6YA 2AJQA 1W0HA 2DKZA 4M9HA 3VERA 2JGUA 3KVGA 4BRHA 4M3ZA 1BIZA 5EWEA 4M47A 4DV1K 4UY8O 2BKEA 2ZTCA 5G5GA 2YJFA 3MAQA 5KFCA 3MDCA 2WB1F 2F44A 4DSEA 4H0PA 4FK0A 2CPRA 4CJWA 5KT2A 3MX5A 4FWRA 3BQTA 3WKCA 3T3FA 1VQKN 2KZZA 4CERA 3LYSA 1P8ZA 3TADA 2D0BA 3RRHA 4BRAA 1IH7A 1ZQ1C 5J2GA 2KFZA 1ZQSA 4KREA 4QZ8A 1RBTA 3OVNA 3ATVA 4Y1CA 1JUDA 3OYFA 3WXIA 2UXCK 4X64K 2PI4A 2Y1JA 3TABA 2BDUA 4DS4A 2PFOA 4F5OA 3MXJA 3P31A 1U48A 4ZH4A 2ZJPL 4JS5A 4JKEA 4DV6K 4KN4A 5KNIA 3FDSA 1ITGA 1KSPA 2Q36A 2F2AB 4FJIA 3NGDA 3IV6A 4YG2A 1S8OA 2BH1A 3EKUA 4DLGA 3TI0A 2NV3A 3RJFA 4J9PA 1GOCA 2KKVA 1IM4A 3AUOA 2H3QA 5CRXA 1TAQA 3DV9A 4CF5A 5ALPA 1X66A 4ACOA 4UB2A 3ZDDA 5HRPA 4O3SA 3K59A 5KRSA 2ZJ5A 2J6SA 1WB9A 4ECYA 4IC9A 1NK6A 3NHGA 5KFHA 3MN5A 1SQKA 3GIMA 4Q45A 1TL1A 3AQEA 1COOA 2KSOA 5KG3A 1JLEA 4WQ5C 3E9OA 4JMUA 3ID6A 3U8XA 3QNNA 1V97A 5AZJA 3VQBA 2QW9A 3KD3A 3HP6A 4UAYA 3RH5A 5B66U 4X66K 4J2AA 5ALQA 1CEZA 4FM0A 5AM5A 1S77D 2P9KB 1SZPA 3CPWM 5HHHA 2YCHA 4B1XB 3K75D 5KFTA 4PHPA 2GX9A 2UUCK 4BC3A 2I9GA 1G15A 5DBCA 1IKWA 2E1ZA 3C6HA 4DFDA 2R18A 3OYJA 5AKXA 1QQNA 4PL8A 4YOXA 5C0YA 4ECTA 5AQQA 2OHFA 3V4IA 4W5OA 1L3SA 1Z4NA 5I9EB 1RTDA 3SQIA 2IVPA 1YJNN 2ZUBA 4OCZA 3KK2A 5AKGA 3A5MC 4RNOA 3AVFA 4A62A 3OYGA 3V9UA 5J0XA 5AK5A 3TAPA 4DSJA 4XQ8A 2KHVA 3T7ZA 4CGDA 4KLDA 4R79A 2BQUA 2VG6A 4CJEA 2CXYA 4DB3A 2XY8A 4BRKA 3D2FB 2L5YA 4GXIA 1D5AA 5AK4A 3QMLA 3MBYA 4UW9A 3CI5A 2OZSA 3Q8QB 2Y1IA 3DWLA 3DRSA 3UPQA 4IOXA 3PIPL 7ICKA 1X6IA 1J2NA 2YX6A 2HHQA 3QLHA 2V7ZA 3QEVA 3DXKA 1U9LA 2NLXA 4K4IA 5ELZA 2QWPA 3K5LA 4RT2A 2ZJ8A 4WQ4A 4BGDA 2F9TA 4JN4A 4M9NA 4OLAA 1EO1A 4YVZA 5KFIA 3CJ9A 4RQ6A 4E7JA 4CBWA 4R66A 1ZQYA 4AILC 3HRDD 4QZIA 2VA8A 2ZXHA 1KTQA 5M1NA 1ZOLA 4PKIA 3CCLN 5BN8A 3QEPA 3OYCA 1ZBLA 4QZGA 2P9LA 4IDHA 5AM4A 4WE1A 4HHTA 2G8FA 3N28A 2JR5A 4QS9A 1MDUB 4MQ3A 3K1RB 1JLGA 5KG7A 4C4SA 1TKXA 2PBDA 3PSFA 1J5EK 1T6CA 1RDWX 9ICFA 3L5KA 3MABA 5AR0A 2YHWA 1TKZA 4IJNA 5C42A 4DU4A 3C6TA 2EZZA 4DL6A 4DF8A 2ASJA 5J0UA 5MLCQ 4HUFA 5AKKA 4U7BA 2V51B 4O3OA 5KFUA 5AFUH 2O8EA 4CGJA 3AV9A 3ETRA 1SGGA 1ZJNA 2J4RA 4BDPA 4CNQA 4JI8K 4M0AA 2OANA 1RBRA 1J97A 1SAZA 2W40A 7ICTA 4KHUA 4YCXA 4N47A 3HO1A 4C7YA 5KFXA 2FMPA 4MF8A 9ICKA 2OA8A 1A77A 4JK9A 2LHTA 4Y2QA 2Z1IA 1RT1A 4Z4EA 2OYQA 3E0FA 3P4IA 4UB1A 2R8KA 2XVTA 4QIWF 4K4HA 2C22A 1BPDA 2AU0A 2QARA 4CRXA 2JZBA 2ZUDA 4FE3A 2W9BB 4DSIA 1S9GA 2YNFA 3HTVA 1YJWN 2K89A 5M1KA 3D2NA 2BDPA 3RR8A 2IVOA 4A8EA 3WU2U 1QQMA 3M8PA 1C1CA 2JV3A 3SD7A 4KLLA 7ICIA 4GV3A 2RP5A 4M2YA 3AAPA 4O3NA 2DTUA 4CGZA 4B8AB 4M42A 5DB9A 3C2LA 4NCAA 5DG9A 4IG3A 1QLNA 4FO0A 1V85A 2FBTA 2BHNA 2G0AA 4ECSA 3HW8A 2HCFA 2NO4A 4J9SA 3AVCA 5I42A 1NGHA 3SQ4A 5A2QO 1NGCA 2ZJQL 4IZ9A 4YOYA 1F44A 3IN5A 4C8LA 4US8A 4IS7A 2FSJA 2ZGZA 4JV5K 1SL1A 2FF6A 4ED1A 2X74A 3D2QA 2ZQBA 4CEFA 3ZSVA 2ZM6K 2WF8A 4HWIA 4LC9B 3P1GA 4I6MB 1VSLA 4AHCA 3JAMO 1JN3A 3S3NA 2BCSA 1L8OA 3U9DA 5D46A 1S22A 4F3OA 3WQUA 2K8CB 3ZSZA 3PSTA 1ZD3A 4CJVA 3AU6A 1F5SA 4ED0A 1KFDA 1TYQA 4LSLA 1ZD5A 1NJIO 4CZEA 1VAZA 3AA4A 4J9OA 1ZYQA 2UUBK 4LFBK 2PMZF 4WFBL 1NMNA 1OVQA 2KV2A 2FF3B 1PK1B 2XICA 2NRRA 4OLBA 5JUMA 3N7RC 1GLLO 3UXPA 1LOTB 1SWVA 3NGYA 4B1YB 2RDJA 4HTUA 5BR9A 2HNYA 4CGFA 1URJA 2P9NA 2C28A 3NAEA 2QLTA 3TARA 4FK2A 3WKBA 3J7ZO 3EZ5A 5L1KA 2FDRA 1S1TA 2RKIA 9ICIA 7ICJA 2ALZA 3HM8A 3T5KA 3CCEN 1L3TA 3T5HA 2D0PA 4J2EA 2YMPA 1J54A 3H6EA 5AKJA 1YVNA 4JUZA 4N5SA 1NGBA 2R8GA 4QAGA 4XH5A 2W8KA 4YMMA 1NGIA 3VF6A 4FJ9A 4RUAA 5EX5A 1ILYA 3FZKA 3H8MA 4DQIA 3S3OA 3SLCA 1DK2A 5DDYA 4F71A 5AI8A 1KLMA 4O5FA 4F3TA 2NRZA 4KHWA 4Q43A 4LZDA 4BR7A 3MFIA 1YUWA 3G4SN 4QWCA 1GOBA 5FPEA 5BN9A 3U3YA 4LF8K 1JCFA 4FWSA 3KK3A 1ZD2P 1Y88A 5AQGA 3SAGA 1S97A 2F7TA 4OPKA 3TTDA 2H3GX 4CE6A 3DLEA 1C20A 5KFPA 2QB0A 4PHTX 1B43A 4RQ0A 4J2DA 5EOZA 4MLHA 1FXXA 3D6RA 1U45A 3KZIU 1KAXA 1T7PA 4DTXA 3C29A 1DLOA 2YN4A 1RCHA 3TADC 5C15A 4KLGA 4BE0A 3RMCA 4FLWA 1Y97A 3CJBA 8ICHA 4I29A 3RSEA 3LDSA 2GTDA 3QESA 1U47A 3UMGA 1I3AA 5ALSA 5D49A 3O3GA 4CFDA 4WYBA 3NF9A 5DBAA 4NYNA 2Z1GA 4CJFA 1W2BM 1DOQA 4QZCA 4PZOA 3O4NA 4M63C 5J2QA 4PUOA 2HHHK 3C1YA 3E58A 3H1VX 2EHGA 4W5RA 1J6ZA 2D6FC 4MF2A 4GY2B 1YJ9N 1QZ5A 1RDFA 4MFCA 3NGZA 4DSFA 4UAVA 4CFBA 4Z6FA 1RDBA 2E8OA 4C1NK 4CZMA 2E2NA 2FLLA 5E26A 1N6QA 3K57A 1LKYB 1TAUA 1WSEA 1L8LA 2K8AA 2O4IA 3R3LA 3RVCA 1NK0A 4DQSA 3C0BA 3E66A 3NUQA 2WAQC 4C8OA 3L8BA 4OJ6A 3Q8RB 5J2CA 2NUBA 1WYGA 2UVUA 1MC8A 3H1QA 3TSUA 4IFVA 2W54A 2ZTDA 3WK7A 2P35A 3SI8A 5CYMA 3GV5B 1ZQJA 1DGKN 2FSKA 3UXNA 7ICQA 2Y9UA 4CD1A 5J2NA 3V1QA 1NU0A 1JKHA 4P4PA 2ODGA 3QETA 5AKYA 2G8HA 2I7NA 2BCRA 2FLOA 3HVTA 2KLAA 4AM6A 3KLEA 3KKSA 3RF9A 1NLVA 5ALVA 2FI1A 4DR3K 2W9AA 2JHDA 3HT3A 3ASMA 3SJHA 1K1QA 4J9KA 5M1QA 1VQ5N 2GELA 2RF2A 2KW4A 4BRFA 5KGXA 8ICWA 8ICCA 4O8KA 9ICVA 4PGQA 3QEBZ 2QWNA 3DXKB 4JKHA 3OYLA 4JB3A 2P51A 4E1NA 3U6FA 3QBWA 4FPAA 3O8MA 4CJUA 2YTUA 2QWRA 2JWLA 4Z4HA 4B9VA 1SXDA 1NZPA 1BI4B 2C2RA 1GO3F 4FJ8A 2P6UA 4C1NI 5EE3A 1VQPN 4O5CA 4LFCK 5LMUK 3VQEA 3OJSA 1S6PA 4NXNK 5FPMA 2EANA 2P9LB 4Z94A 2RHFA 1HKGA 3UMCA 4CZLA 3U26A 4EIAA 1VSIA 1ZJMA 3SAHA 8ICIA 4JK1A 3AAQA 1HJOA 5DQGA 3EW9A 3I76A 3R6MA 4C8KA 4ECZA 3ZD9A 5F3XB 2FXUA 4WQ4C 5KFSA 1QHAA 1HUZA 2O8EB 1S5LU 3ICXA 4KHNA 2Q2RA 4QWAA 4RT3A 3VPZA 4BC2A 1U6ZA 3TFSA 2KICA 2ZIXA 1C1BA 4DOBA 5ALXA 2PXIA 3ED5A 5FROA 4O4GA 5IILA 2F3NA 5FDLA 3QFPA 4NLNA 1MQ3A 1RTHA 3KWGA 2E8NA 4BGAA 3LK9A 3EPIA 3VEZA 3EL2A 1TK0A 1D8YA 3ZT4A 1EKEA 1RZTA 2OTLN 3RAXA 2YB1A 2F1IA 1JRPA 3PO5A 4CGHA 5GIPA 4CJ7A 3LAMA 3T19A 5J0OA 3NRWA 3PW7A 2NRXA 1S6QA 4BACA 1X6JA 9ICPA 3ONNA 1BQNA 3AA5X 3C28A 2BZFA 4G1QA 3OGUA 5JS2A 1IV8A 4FZXC 3RB3A 2Q4TA 4IRCA 1KRPA 2W6KA 3H4BA 4NXMK 2ATLA 4XA5A 4MO5A 3THYA 3L2UA 5B8HA 4LSNA 1NGAA 2YMMA 3NGIA 2HSZA 2MUTB 3V81A 5BREA 5JTIA 3GL1A 4CZKA 3CFOA 3G10A 1X9JA 1Z26A 2NO5A 2E88A 4EYIB 4AYBF 1WSFA 5IIKA 3ISDA 2A40A 1WUDA 2WUSA 3RH4A 1NBWA 3QBXA 5AZIB 4JI5K 3GFKB 4RQ5A 1X3NA 4AP9A 4CHNA 4JRPA 5L1MA 1P90A 3AVLA 3M1FA 3BS5B 2RN2A
chains in the Genus database with same CATH topology
2R8JA 3KHLA 1KAZA 4ILJA 2J6TA 4ILHA 4JV0A 4ELUA 8ICYA 2IA6A 2QWMA 1TYQB 3IHQB 1ZQVA 1C0FA 1QVGM 3GE1A 8ICAA 1KFSA 2CH6A 3TSQA 4ISEA 3CPEA 2PFUA 2ASOA 4GC6A 1NK7A 1Q86O 4BRLA 5GAGP 4O3RA 4I2FA 1ZQXA 3T5JA 2QI2A 1BPZA 2A42A 2P9NB 4B9NA 4MLEA 5AQKA 4YFKA 9ICQA 3VEXA 4F5NA 1NK8A 3AGRA 4GLXA 2HHWA 4BWJA 1E4FT 2JEJA 2P9PA 2P9UB 5TKYA 4RZRA 5F2RA 5M1OA 4JD2A 3FZMA 3PX4A 3TTCA 1K1SA 5CB1A 1S72N 4F4XA 5DG7A 3ZX0A 4XUSA 3CCJN 1NGDA 3UKUB 2ASDA 4RQ1A 4NB4A 2UVWA 2FLNA 3MWTA 3EE9A 5JLHA 1K8KB 3N4QA 4A61A 1ZBSA 2W9BA 3LDQA 1JXEA 3SBTA 3BEXA 4YOVA 1VQ4N 3T69A 3CC2N 1ZQZA 2P9IA 3CCQN 3KHYA 2DPIA 1ZQWA 4AF1A 3TPQA 9ICWA 4WCEL 3CIPA 1BPXA 9ICBA 5L1LA 9ICEA 1S0MA 1S3XA 4YXJA 1HKCA 4JK7A 3M9MB 1NMDA 5AQYA 4CBXA 3IMXA 3QZ8A 5DGAA 3EN9A 1TFRA 1T3VA 7ICLA 4I6MA 3QICA 3MDAA 5KFBA 3FYHA 3GDXA 1BA0A 3KHGA 2E2OA 1HX1A 2F9WA 3H7IA 4GXJA 2V52B 4M7XA 3MK6A 5CR4A 4RPXA 5GAEP 4ECXA 4XRHA 3PV8A 3A8YA 1BOTO 2J6UA 3L4QA 4I2GA 1CUKA 3OSNA 1DEJA 4JV1A 4R8UB 8ICPA 2GWJA 8ICRA 1XSNA 1K9MO 4YP3A 3IUCA 2D1KA 4DL4A 4QZEA 4YD1A 4PHAA 2QTDA 5CP2A 5JMVA 1L3VA 2I1QA 4QZAA 3P38A 1JXLA 4IR1A 8ICSA 3DAWA 3PW5A 5KFVA 3A5LC 5AQRA 4IQVA 5KFKA 2V4QA 1A76A 1KDHA 1BUPA 3T5LA 3PIOL 2JEIA 5KQDA 5J2EA 4F50A 1LCUA 2BQ3A 5J2JA 2ASLA 4F9OA 1NGFA 5KT4A 1C7YA 5LJVA 3V6HA 4DOAA 1BWFO 4IXCA 1X2IA 4CZHA 2W9CB 3IKMA 3DXMA 2ZJRL 2XY6A 1VQ7N 2F1JA 5HMMA 5TZVA 1XC3A 4B9QA 4I2BA 4H0VB 2BR0A 3GIJA 4ECRA 4I2IA 3C65A 5KPRA 1G99A 4JKFA 2WBNA 4PGXA 3NTUA 3O80A 1KC8O 2YHXA 5GIOA 3QFUA 4NXZA 4KLQA 3GILA 2HHTA 4BRMA 9ICRA 5AQZA 5BRHA 5FPNA 4EBDA 2HBMA 2HBKA 4I2CA 4FVUA 4B9MA 3PW2A 3RRGA 5DQHA 5DDMA 2HW3A 2AA4A 2BPCA 4EBEA 1RDUA 3AGKA 3CJCA 4DCHA 1BGXT 2D4WA 1V4SA 4RQ8A 4DOCA 3O4WA 4YD2A 1BVSA 4J9QA 4EZ6A 3TFRA 2AGPA 1NGEA 3EZWA 5IINA 5AQSA 2NZTA 4GXKA 3SK3A 2FPMA 1R59O 3GDQA 4IFEA 3MN6A 8ICUA 3FZFA 3C2KA 4KLEA 2KKZA 1WOQA 2ISOA 4R65A 5KG4A 9ICUA 4I2AA 5AQMA 3ZEUA 4FWPA 1YI2N 1QSLA 5CA7A 7ICNA 4UQGA 3G6XA 1YITN 3CQYA 4A2AA 5ADXA 2P9PB 5D4BA 3H3NO 5KTQA 4RNNA 2BQRA 3TANA 4KLMA 4TURA 4KMUA 3M6GA 2QA4N 2HHSA 4JD2B 3H3OB 5C2FA 4DL7A 3RR7A 2DPJA 1L3UA 1SKSA 8ICGA 3LDPA 2FPKA 4KLTA 2QEXN 4DL2A 4DSKA 4MDAA 3O1WA 1RGIA 1ZQRA 3M5RA 2GUPA 3MN7A 4Z6CA 1SZ2A 8ICZA 3TTFA 1RXVA 3PX6A 1XQSC 3O9QA 3VGMA 4A2BA 4F4YA 3WEEA 4EEYA 2VWBA 2KZMA 1ZQQA 3PY8A 1VQNN 3M3ZA 4EZ9A 2P9IB 2WC9A 3VEVA 5GINA 5KPTA 4KLOA 2MUTA 3M8SA 4GV6A 3CD6N 4RNMA 4NM2A 3N4PA 4ECQA 5J2HA 1N56A 5KG2A 2NNWA 3E1YA 3IFRA 3UE5A 4FL9A 3OBYA 5AZIA 2CGLA 5BPNA 3G6VA 2E2QA 1S0OA 4GV9A 3BQ2A 3LWMA 2W9MA 1ZC6A 3G71N 5AQJA 5KFWA 4K42A 4H5VA 2KHOA 4YQWA 3W0LA 3JPPA 3BQ0A 4DQ8A 3DJCA 3U4LA 1X9MA 1T44A 3OHRA 2VYPA 3JPSA 2IHNA 5LJWA 1XU4A 4F91B 7ICMA 1X9SA 4MFAA 5DQIA 4H5WA 2HMPA 3ENHA 1HUOA 5BPLA 1RPLA 3ISBA 1SS6A 4FBTA 4PGYA 2Q0UA 1TV9A 4OO1J 1KQSM 3TSPA 2WFBA 3VEWA 4QW8A 1XO1A 1YAGA 3O9RA 2P9UA 3UB5A 4YR0A 3C2MA 1T3NA 1ZQNA 2V9WA 3VF4A 3E2EA 3O9TA 4BRQA 4H0XB 3L0QA 1PZNA 1HLUA 5DB6A 2IVNA 4BR2A 4ECWA 4M9LA 1Q18A 3VEYA 1Y64A 3JPTA 4H0TB 5DLGA 4KLSA 8ICQA 1ATRA 1TUUA 3UKUA 1DT9A 4RQ4A 5CWRA 4Q8FA 4ISGA 4BQLA 2LYHA 3D2EB 3PR5B 3C5GA 3O5BA 1JJ2M 4ED3A 5HMLA 9ICAA 5CHIA 2HBJA 1K8KA 2C2EA 5L1IA 4I2JA 8ICKA 4I2DA 1NK5A 1HPMA 3DXMB 4WF9L 4ISFA 1ZQGA 4BG8A 3V72A 3LL3A 4NLKA 1AROP 4TUPA 4J9LA 5BOLA 3FZHA 2KFNA 4ED6A 4BRDA 1GLFO 2GEMA 4A59A 4F4WA 3SV3A 4J9RA 3PO4A 1HJPA 1XWLA 1D9DA 1YHQN 3M9NB 3WXLA 4XH1A 4L3QA 4X5VA 4RQ2A 4RQ7A 3LDLA 3F2KA 2BUPA 4B9UA 3ZX2A 9ICXA 4KH4A 4QS7A 1ESVA 4DQQA 4PHEA 4TQRA 4KLFA 3WUHA 5KG1A 5IIJA 4CI6A 4MEYA 2HVIA 4H03B 3HOSA 4YORA 3UXOA 2PFNA 2YHYA 3R8EA 4A5AA 3HOTA 5J2DA 5KFLA 3GIKA 4R8UA 2R8IA 2AGQA 2R8HA 4DFJA 4DL3A 4BR5A 3VGLA 1ZQTA 5KG6A 3LDNA 4YDUC 4PKHA 5J2BA 9ICOA 5BRFA 4O0IA 1H38A 4BVOA 1NK9A 4YMNA 3O9SA 2D0OA 2NRTA 4A57A 2VCPA 2JEFA 3C6AA 4PHDA 3VEOA 2H5XA 4B9TA 4JKAA 1NKCA 3ZEUB 3B0XA 2XCPA 4IJAA 3VESA 1E4GT 3K9JA 2HSTA 1B22A 1BG3A 1VQLN 1D9FA 1T8EA 1ATSA 3PMNA 3GQCA 4YOTA 4F92B 4JNEA 3MR3A 1XC9A 4EFHA 1U4BA 2A6AA 4KITB 3H4DA 3UQ2A 1EQYA 2W9CA 2ISPA 3GOIA 2BCQA 3Q7BA 3THVA 1UT5A 1U2VB 4YMOA 4IQTA 1BU6O 3SV4A 5EXWA 7ICGA 2E8AA 3RAQA 4CCHA 4NO7A 3WXMB 1NJXA 4E0DA 3LWLA 2DPNA 4BR4A 5HNKA 3VOVA 1ZQFA 3RJGA 5JVHL 3H8WA 4UBCA 3WEEB 3BF1A 3N4MB 4F2SA 4KH6A 3E9PA 4ECVA 5J0TA 3WT0A 5KFRA 1ZXOA 3CMEN 4M6WA 4RUCA 5BPCA 3ZX3A 4TQSA 7ICSA 2Q1NA 5KFAA 2HHXA 2JEGA 2ZGYA 4DL5A 2E2PA 4BR9A 4CBUA 3G6EN 4GC7A 4NM1A 4BY9C 1S10A 3G25A 3C21A 4H5RA 2CGKA 3PNCA 4G3IA 1BPYA 3EYZA 2QXLA 5AQUA 1SL0A 1X9WA 4QS8A 3RJEA 1WCLA 4F5QA 1SL2A 4YXMA 4R63A 4ED2A 4J9MA 4XEIA 3OJUA 1NGGA 3HPOA 4BGBA 3V7JA 2AQ0A 3ZDEA 5J0PA 1YXQA 5J29A 8ICFA 2IBKA 3H8JA 1NOMA 3RH6A 1WCNA 1YF5L 4C23A 3HI0A 1IXRA 3OBWA 4GNIA 4KH5A 4C8NA 1SKRA 2KN7A 1NM1A 5DLFA 2XGPA 4RPYA 4H0YB 5LY3A 3GIIA 4MFFA 5HOOA 4J9NA 5AQVA 4F8RA 1VQ9N 5C5JA 4FS1A 3L4IA 5L1JA 5JVGL 2DFLA 2P9SA 4K25A 3RJKA 4RQ3A 3ZDCA 4JK8A 3MFHA 5DM6L 1XSLA 4A5BA 4CD3A 3QZ7A 1NGJA 3UKRA 4JKCA 1M90O 4F4KA 4I27A 4Z6EA 5BPMA 2C2DA 3MR2A 4K4GA 4QZFA 4QWDA 3M9OB 1OVYA 3F9MA 2WTFA 1NJZA 4FWOA 3RJHA 3FGUA 3K9KA 4IWVA 2FSNA 1Q81O 4ED7A 4ELTA 3QB0A 4PKGA 3SMSA 2XGQA 3WQTA 4BC4A 5AQIA 3A0IX 4B1WB 3RB6A 1ZETA 3V7LA 4QWBA 2RHKA 3DLLL 3FLCO 3FR0A 2E1YA 5KFEA 1RYSA 4QWEA 2RE2A 3ISCA 5E84A 4I2HA 3VENA 2HHVA 1VQ8N 3JXUA 5J0SA 5KFJA 9ICMA 2V4RA 3SMPA 2OTJN 3LDAA 9ICLA 4DFMA 5AFUA 3MR5A 4QZ9A 4UAWA 3PMLA 4BQZA 3C7NB 5HHIA 2UVRA 1ZQKA 5KT6A 4F5PA 3Q8PB 2A1JA 4ILGB 1ZQUA 4IR9A 3RSEA 4FWQA 4YOWA 1S0VA 3KTQA 8ICJA 3Q8LA 5DGBA 3EO3A 2ITMA 2FPLA 3CCUN 1KXPA 3H46O 4IEIA 2JWKA 3KHRA 1MSWD 4BRPA 3L6QA 1OKJA 1KFTA 4IO9L 4BRNA 1V4TA 2PI5A 4I28A 2KTQA 4G9ZA 1T4GA 1MA9B 4FWNA 5AQLA 3V6KA 5J0WA 2EWSA 3RB0A 4CZFA 3D2EA 5JICA 2I7PA 4YR3A 5TKWA 2NRVA 2XY5A 3MWPA 4YOUA 5AQTA 1KLNA 1DKGD 2CH5A 2FMSA 1RFQA 8ICBA 4NLGA 3MR6A 3RB4A 4OPHA 1GLEG 4DEZA 3KK7A 1M1KO 2BCVA 4H0OA 4DF4A 2VA2A 3TU5A 2Q0RA 3Q8MA 3C23A 2MAXA 3O1BA 4NLZA 4KN7A 3Q8SB 4QZBA 7ICEA 5HP4A 4O5KA 2FMQA 4DFKA 2B21A 4QZHA 5HL7L 3CCVN 3WXKA 7ICPA 3FFKB 1GLCG 4BG9A 5F0XA 1UA0A 4FOEA 4YDUA 3RBDA 5KFFA 4B1UB 4F5RA 1MQ2A 4KLIA 4M6WB 4GVEA 4BROA 7ICVA 4RTFD 1D4XA 1DGSA 2BPGA 5C10A 3KZBA 2VA3A 3AARA 3SAFA 1TKDA 4FWKA 4H5TA 4JKGA 4FSVA 1N8RO 3RJJA 3MCAB 3TAQA 3I55N 3GBTA 3PLAA 4IEEA 3B0YA 3O08A 4RWTA 3J8AA 4EBCA 3RBEA 4BRCA 4O8UA 3ZETA 4RCHA 4TUSA 3KHHA 2ZF5O 1GLJO 1JCGA 4DWIA 4Q44A 3SYZA 2P6RA 4FOIA 8ICXA 1LB2B 1K73O 3BQ1A 3PVXA 5CR0A 3I33A 2XC9A 4CZIA 3VF2A 4PH5A 4M04A 4OPAA 1QQOA 2IHMA 5BOMA 3JPRA 3QDKA 5F9NA 3VTHA 3CHWA 3ORYA 4LVSA 4RU9A 4BXOA 3FZLA 4MO4A 3ULEB 4E1JA 1TK5A 1ZQMA 1U2VA 3PX0A 4RPZA 4P2HA 3OSPA 2P9SB 4M9JA 3JPQA 8ICVA 4FBUA 3Q7CA 4MDBA 1SKWA 2ZWHA 5KFDA 5EOYA 3P39A 2NRWA 3BP8A 1NWKA 4C8MA 2A5XA 3UKRB 4JKBA 1ZQPA 1Q7YO 2UVVA 5CHGA 5DB7A 1Q82O 1NKEA 2GWKA 2HF4A 4I2EA 3MN9A 8ICEA 2PAVA 3KWIA 3I8BA 4HTLA 2HOEA 4PL7A 4M9GA 4DQRA 1NJYA 3V7KA 2BTFA 2E20A 3CCMN 4DSLA 4XH4A 3OHBA 9ICHA 1JX4A 4NLBA 3O9UA 4PPXA 3H45C 3CC4N 2BGWA 1LV5A 1IG8A 3EWAA 1QTMA 1ZQHA 3R1XA 4IQWA 3ETLA 4ELVA 7ICUA 4JV2A 4P4MA 4HYKA 3ID8A 3A5NC 1Z00A 4O3PA 3CCSN 1H1VA 2IIRA 4DLEA 2A1JB 4KLJA 3RSEB 5J2FA 3OA9A 3HZ6A 2XCAA 4ECUA 2HBLA 4R64A 3PW4A 3MCPA 5KPZA 5KFMA 4JHDA 4LZGA 4KBOA 3ZYYX 5J0QA 1MWKA 5KFZA 3ENBA 2QWOA 1BDGA 4KLUA 5IIMA 4F4ZA 4O5EA 1S76D 3LM2A 8ICTA 3ZDAA 3QE9Y 4JEPA 1ZQIA 4BR0A 4F93B 2VGNA 8ICMA 4JAXA 1K8AO 4H5NA 5EWGA 1HKBA 3MGIA 4NLCA 2A41A 3R9PA 5KFOA 2P66A 1Z6RA 5KG0A 3BDPA 1CZAN 3MX2A 1JMSA 4IOAL 3W3DA 3HSCA 1UT8A 1RXWA 5GADP 4DQPA 1V9PA 1JCEA 5KT3A 3VGKA 4B1VA 1ZQCA 4U67L 1EXNA 3V6JA 5F1XA 5KT5A 4CZJA 1Z05A 1ZQEA 1BO5O 4O3QA 5AQWA 5ADXH 4JWNA 5EY4A 2FLPA 5M1PA 1QZ6A 1L5UA 3JPNA 2HF3A 3MDQA 4BREA 5DBBA 2F1HA 3VMFB 2VGMA 5AQPA 5AZJB 3M8RA 1ZQOA 5BRDA 3AY9A 1ZQBA 1BA1A 3C1ZA 5AQFA 3NVKA 2BCUA 5C12A 5J2AA 4TUQA 5KQ8A 1VQMN 3K4GA 5J2KA 1T6DA 3MMVA 4JKGB 3QEAZ 3C7NA 4IO8A 1O13A 5M1FA 2HVHA 8ICOA 4UAZA 3GV8B 2GWSA 4QZDA 3FE1A 3ZETB 4P4OA 2Q0ZX 3HX0A 4Q8EA 3EKSA 4DS5A 3JS6A 3NVMA 4IOCL 3PW0A 4F2RA 5EVZA 2Q31A 4J8FA 5AQXA 3U9ZA 4K43A 5KFQA 5GAHP 3HBTA 4EYHB 5CJ7A 3E9LA 4B9LA 1C0GA 1HUXA 5AQOA 4BXOB 3JPOA 2XO7A 4BRIA 3HRGA 3S41A 3CJAA 2XY7A 4WQ5A 3EE8A 5DG8A 2AQ4A 9ICGA 5J0RA 4BWMA 3MGHA 4IRKA 1VQ6N 9ICTA 8ICLA 1QSYA 4UB5A 1NKBA 5KT7A 4KTQA 1UA1A 4DO9A 4FWLA 2ASMA 1NK4A 3PR4A 1XSPA 1BPEA 1ZQDA 2QM1A 5DKWA 4FPBA 2AGOA 4DHYA 1KD1O 3CXCM 3SBGA 2JZBB 2Q97A 2UYTA 5EWFA 2NRHA 2P9KA 5CE3A 1N48A 7ICHA 7ICRA 3GV7B 4EHTA 1D8LA 4YN4A 3CCRN 3CMAN 3A5OC 4WFNL 4QW9A 1XUPO 3CQXA 3Q8KA 3CETA 3LDOA 5KFYA 3CC7N 3LM9A 3NMUA 4FO6A 5KFNA 4UBBA 1ZQLA 1TK8A 5KFGA 4B9SA 4BVPA 1ZQAA 3D2FA 5AQHA 1Z3EB 4Z6DA 5FPDA 5AQNA 4WFAL 3UQ0A 3BF3A 3VTIA 3I56N 4AM7A 4K41A 1Z00B 4NY8A 1MWMA 8ICNA 2M9NA 3CERA 2RDIA 2AP1A 4IQUA 4BRGA 3ENOA 2KZ3A 3CF5L 1YIJN 2ASPA 2YJEA 5L9XA 2IMWP 4JHDB 3ATUA 1QSSA 3D7EO 3IM1A 1GLAG 3WXJA 3ULEA 2W41A 3H8SA 2HHUA 4FWMA 3VETA 3H40A 3O6WA 2QWLA 1S9FA 3IDHA 3BJYA 4UB3A 4KLHA 1XS9D 1W97L 3B8AX 9ICJA 2BPFA 1NJWA 7ICFA 2ZJAA 1ATNA 4YR2A 3SZ2A 2VANA 1U49A 3GG4A 4B1ZA 4DFPA 9ICCA 1TUYA 1IJJA 5C2DA 3CJ7A 4DKWA 5IIOA 2CGJA 1JIHA 3HWTA 5KG5A 1X3MA 3TQ1A 5J0YA 3ZD8A 4Y0WA 5IIIA 3F5TA 4EHUA 3RTVA 2YI1A 5F9LA 2W8LA 4ED8A 3RJIA 2PFQA 7ICOA 1VQON 4UB4A 2ZUCA 2A3ZA 4M7YA 5H1SQ 4MEXA 3BUZB 3C5FA 3EPGA 3N97B 5DM7L 2ZTEA 4FS2A 4JKDA 1KEJA 1TVAA 5DB8A 3ZDBA 9ICNA 1KAYA