2NRZA

Crystal structure of the c-terminal half of uvrc bound to its catalytic divalent cation
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrzA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrzA01
3GQCA 4M2YA 3MR6A 4NLZA 8ICPA 3JPQA 5DG8A 1ZQAA 4ED2A 5J2GA 5KFFA 5KG1A 5J2AA 1NKBA 1S76D 9ICIA 4QZHA 5KT6A 5KFJA 2BKEA 1SL2A 4UB2A 1S0MA 3RJHA 1NK4A 7ICHA 1MC8A 1QSLA 8ICAA 2HVHA 3GILA 4RNOA 3OGUA 2HVIA 4IRCA 4UB3A 5HHIA 4PHDA 2FMSA 4RQ2A 9ICMA 1NOMA 1X2IA 5CB1A 4I2CA 8ICRA 2MAXA 5J2DA 4ECWA 4DL3A 2HHUA 3Q8MA 2FLLA 2KFZA 4RZRA 9ICNA 1LB2B 1D9FA 1B43A 5L1JA 2ASLA 2W8LA 1NJWA 2P6RA 3PX6A 4RPYA 3RRHA 3PW7A 3OJUA 2HHTA 4YD2A 5J0YA 4UB1A 9ICXA 2HHWA 5J0RA 1LV5A 4JV0A 4R66A 3BQ0A 4FBTA 5L1KA 4F92B 4JUZA 9ICEA 3ISBA 1S0OA 1SKSA 2IA6A 5DBCA 3TANA 2HHVA 5BPCA 9ICLA 4DEZA 5HNKA 4C8MA 3PMLA 3JPOA 4J9NA 4ED0A 2J6UA 2PFPA 4Z6DA 2AGOA 5IIJA 5DB8A 4IQWA 2NRXA 3EYZA 4ECUA 1TKDA 4ELVA 4GC7A 1Z00A 4YVZA 4DQSA 4J9SA 1DGSA 5DKWA 1BPDA 1B22A 1SL1A 4O0IA 8ICQA 5KG4A 2MUTA 4E0DA 3KHLA 2OWOA 4F50A 2C28A 5F9NA 4C8LA 4O9MA 4KLGA 3EW9A 3G6XA 4I2AA 5KG7A 1N56A 4K4HA 2B21A 4O5CA 8ICIA 5KFZA 4ECYA 7ICNA 4NLNA 4O3NA 4BWMA 5J2BA 5DQHA 1XSPA 4CCHA 2A1JA 2XY7A 2BHNA 5KFSA 2HHXA 4KLMA 9ICVA 7ICPA 4DQIA 5DLGA 4UAYA 4LZGA 2KZMA 5DBAA 4EYIB 1ZQSA 3PX4A 1ZQMA 2C2EA 1RXWA 3OHBA 3RTVA 4GC6A 9ICTA 3C65A 4PGYA 7ICJA 5DGBA 5J0UA 2V4RA 4C8OA 3G6YA 3M9OB 3GIMA 2ZJ8A 1RYSA 4I2HA 1AROP 4O5EA 2FPLA 5DG9A 1NK0A 3MR5A 5CA7A 2J6TA 4BWJA 2NRTA 4G3IA 3KHGA 1XO1A 2BPCA 5IIOA 4ECRA 4DFPA 3RH4A 2KFNA 3TFRA 1A76A 1KTQA 3OJSA 3GIKA 2W9BA 4NLGA 1ZQYA 1CEZA 8ICLA 4J9QA 2IHMA 4O3OA 3C2MA 4P4MA 4YP3A 2JZBB 5KFBA 5D46A 5J2CA 4YXMA 4QW8A 3PVXA 2P66A 3MBYA 5KFOA 4DQPA 4M9HA 1ZQXA 1RPLA 3SV3A 2ISOA 4KLJA 3C5FA 1RXVA 4TUPA 2VA2A 4YCXA 4M0AA 7ICIA 3KHHA 4ECZA 4F2RA 4DO9A 4F93B 2Q0ZX 1NJZA 2PI4A 4GLXA 5CR0A 3PW5A 3JPPA 3RR8A 1ZQLA 4QWDA 4X5VA 4PGQA 4RQ7A 4K4IA 2H5XA 3SI8A 2Y1JA 1U9LA 8ICEA 2BR0A 3GIIA 5KFDA 4MF2A 5CWRA 4MFAA 5J2FA 3QZ8A 2BPFA 5KFMA 1ZQQA 2FLPA 4F8RA 4YR3A 8ICBA 5DB9A 5KT2A 3KTQA 3RJJA 2XY5A 7ICUA 4M9JA 1COOA 1JMSA 4EBDA 5HMLA 3ISCA 4DS5A 3MGIA 4J9PA 3IM1A 3QEBZ 1N48A 4RT3A 2R8JA 1TFRA 5KFAA 2RDJA 8ICVA 1ZQRA 8ICYA 2ZTDA 1TK5A 1TV9A 4P2HA 2KTQA 1ZJNA 3H7IA 3H8WA 4HYKA 5KT5A 2AGPA 1ZQIA 1RYRA 4ELTA 2JEGA 5KG5A 4ED6A 2FLNA 4F4ZA 4IQVA 4RPXA 4DLEA 3RJIA 1XU4A 4ZH4A 5KTQA 5L1IA 3RB6A 9ICSA 5L1LA 1HUZA 4YXJA 3G6VA 2HHQA 5J0TA 3JPNA 3JPRA 5DB6A 4DL5A 2PFOA 4BXOA 9ICGA 1K1QA 4EBCA 4QWBA 3N4MB 5J2HA 8ICZA 4QZCA 3MGHA 5KG0A 3PO4A 1BVSA 4TURA 4BGDA 4RT2A 4F4WA 4O3QA 4DWIA 2V9WA 2J6SA 4DF4A 5KFPA 3RRGA 3RBEA 4YN4A 3RJGA 8ICCA 4DL4A 4B9SA 3MR2A 4R65A 4I2BA 5IIKA 4IR1A 4I28A 1ZQCA 3ZD8A 1A77A 3H4DA 4KLEA 4YD1A 2Y1IA 4QZFA 4F5PA 3QE9Y 3RAXA 5KFHA 1T4GA 7ICOA 4UBBA 1U4BA 2NRZA 4JWNA 3UPQA 2AQ4A 4NY8A 3SZ2A 3M8SA 1NJXA 5KFLA 3BJYA 3V72A 1Z00B 2FMPA 2BCQA 5BOMA 1JXEA 1HUOA 3T5LA 1HJPA 1UA0A 4ED8A 7ICRA 3JPSA 8ICTA 2NRWA 3QEAZ 1C7YA 4O3PA 7ICEA 3TAQA 4RQ0A 2C22A 4RQ5A 2BQUA 3B0YA 1SL0A 4TUQA 9ICAA 2ZTCA 3V6JA 1KFTA 4IQTA 4DQRA 1ZQTA 4KLSA 1Y88A 1S97A 4NXZA 4KN4A 3PW2A 2BQRA 3PR4A 4UB5A 3ISDA 8ICNA 3OSNA 5KG6A 5J0WA 4RNNA 3HWTA 3T5JA 1BPZA 1XC9A 3ORYA 3ETLA 7ICVA 5J0QA 2W9BB 5EWEA 1ZQPA 1V9PA 1IM4A 3AUOA 2ZTEA 2AQ0A 3C1ZA 4QZEA 4ECXA 4NLKA 4KLOA 9ICOA 4PHPA 1KLNA 4EZ9A 4EZ6A 4ECTA 3N97B 4I2FA 1NKEA 3MDCA 5KFXA 2BGWA 5KFGA 3HP6A 1T8EA 5KFTA 5KG2A 4KLTA 4F91B 3GV8B 4Q8EA 4ELUA 5D49A 3SYZA 1MQ3A 5EWGA 2HW3A 4UAWA 3MFIA 1S77D 2UVUA 4M9LA 7ICSA 3C1YA 8ICXA 1QTMA 3T3FA 3C2LA 1ZQJA 3BQTA 9ICWA 4QW9A 4RQ1A 3M8RA 4DL6A 1NK7A 4B9UA 1NJYA 4C8KA 3BDPA 3E2EA 9ICUA 7ICFA 2DPJA 4PHEA 5DBBA 4YR2A 3MFHA 4B9MA 4Q44A 1JX4A 4J9KA 4ED7A 3TI0A 3UXNA 2R8GA 3T5KA 5KFWA 5DDMA 2ATLA 1EXNA 4QZGA 1ZETA 1XSNA 8ICMA 5IIMA 3PW0A 2XGPA 2ZUDA 4M6WB 2WTFA 2XO7A 1XS9D 3ZDDA 4KLLA 4I2JA 5C5JA 4DSKA 2F1HA 4FBUA 4IRDA 8ICUA 3AU2A 1IXRA 1KFDA 5DQGA 4KMUA 1U49A 5J29A 4KTQA 4KLQA 4DSFA 5J2EA 3RJFA 4RU9A 4TQSA 2JEIA 2P6UA 3ZD9A 2I9GA 1ZQUA 5J0SA 3PX0A 2W9MA 3Q8LA 4KLUA 4ED1A 5KFVA 5TZVA 1DOQA 1H38A 2UVVA 1XWLA 4RNMA 3PMNA 2BQ3A 4F2SA 4C8NA 3EPGA 5HP4A 4BXOB 2KZZA 8ICFA 9ICQA 3IHQB 3MR3A 4P4PA 4DS4A 3PV8A 3NTUA 2XGQA 1L3SA 2BCUA 4F4KA 3PY8A 2F1IA 3GV7B 1X9MA 1ZQBA 9ICPA 4PGXA 3PR5B 2PI5A 5KFYA 3AU6A 3Q8QB 1ZQEA 4KLFA 4KN7A 1ZYQA 4ECQA 1X9SA 5DDYA 1X9WA 1KDHA 4DL2A 2M9NA 4EBEA 1L5UA 8ICGA 4Z6CA 5DG7A 2JZBA 2BPGA 2IBKA 2PFNA 4XRHA 1NK6A 1U48A 2R8KA 4F5QA 1S0NA 2UVRA 4KLIA 4O3RA 4YQWA 3PO5A 5CHGA 2BCVA 1XSLA 3Q8KA 4R8UB 4J9RA 2UVWA 4XUSA 1D8LA 3B0XA 3LWLA 3V7LA 2R8IA 3C23A 1TAQA 9ICHA 4Q43A 3V7JA 2ALZA 2BCRA 3JPTA 8ICKA 2ZUCA 1NK9A 4M04A 4B9LA 4I29A 4XQ8A 2AU0A 1SKRA 5DLFA 4B9NA 4JV2A 4ECVA 1UA1A 4Q45A 3GDXA 4M6WA 3C5GA 2NRVA 4Z6EA 4YMMA 4ED3A 2ZJAA 4DQQA 1S9FA 4RQ4A 1BPYA 1S0VA 1ZQZA 2VA8A 3SV4A 2ASDA 2VA3A 5HMMA 4B9TA 4RQ8A 4MF8A 3Q8SB 3UQ0A 1Z3EB 2W8KA 3MABA 4GXKA 2MUTB 4I2GA 9ICJA 4DFKA 3RB3A 3K75D 4DOBA 4PH5A 1KFSA 4B9VA 4RUAA 5J2IA 4J9MA 2FPKA 4F5RA 1JXLA 4MFFA 4Q8FA 8ICOA 4QZ8A 4DOCA 2JEJA 7ICTA 3LDAA 3RJKA 1ZJMA 3C2KA 2V4QA 1JN3A 4QZIA 3HPOA 4DSLA 7ICGA 2PXIA 5HHHA 4UQGA 3TAPA 1S10A 3PW4A 3UQ2A 1D8YA 4YFKA 5KG3A 1PZNA 1D9DA 3V6KA 1KRPA 4MEXA 9ICCA 3HX0A 3GV5B 4EEYA 3RH5A 4QZBA 3TARA 4R8UA 5KFQA 4J9LA 1ZQDA 5CJ7A 3OSPA 4RUCA 4UB4A 5EWFA 5KFKA 3OHAA 3QZ7A 2BCSA 4RPZA 2DFLA 5BOLA 2R8HA 1KEJA 1ZQNA 4KLHA 5EOZA 3ZDBA 2ZJ5A 9ICKA 1JIHA 4FO6A 2BDPA 2VANA 4DOAA 3RB0A 3ZDAA 3GFKB 3K4GA 1ZQVA 3LWMA 3FYHA 4J9OA 3RR7A 4KLDA 4K4GA 1WCNA 5IINA 5DQIA 4F4XA 4JK1A 4LZDA 4DF8A 4DSEA 3V6HA 5KFCA 2LYHA 5KFNA 2FPMA 4QWCA 4JWMA 3RJEA 3T5HA 1CUKA 2I1QA 4UAZA 3NGDA 2IMWP 3FDSA 5KFUA 3UXOA 4IQUA 4DSIA 2XCAA 4DLGA 1L3VA 2PFQA 4R64A 1BGXT 3TQ1A 1ZQFA 4M9GA 2XC9A 5KT4A 7ICMA 1ZQHA 1U45A 5IIIA 2KZ3A 9ICBA 1ZQWA 5KFIA 5J0OA 7ICKA 3H8JA 4PHAA 5J0PA 2F1JA 3TFSA 1NK8A 3M9NB 1TK0A 1ZQGA 4GXIA 4I2EA 1NK5A 3V7KA 2RDIA 4QWAA 3RH6A 2AGQA 3RBDA 5J2JA 3KHRA 3C21A 2A1JB 4QZ9A 3BQ1A 5KT3A 4KITB 4ECSA 1U47A 1K1SA 7ICLA 2GWSA 3UXPA 4RQ3A 1RZTA 4DFMA 1UT5A 1ZQOA 1BPBA 1T7PA 4YMOA 5JUMA 4R63A 2W9AA 4TQRA 3THVA 4IR9A 3H4BA 1L3UA 2ASJA 1NKCA 1ZQKA 1SZPA 3M9MB 4FS1A 2ZUBA 1SKWA 1QSSA 2JEFA 5L9XA 4I2DA 5J2KA 3EZ5A 8ICHA 4F5NA 2AJQA 4RQ6A 4XA5A 5IILA 4F4YA 1L3TA 4DSJA 9ICRA 3EWAA 3RAQA 1TK8A 1KSPA 4I2IA 3ZDEA 4UBCA 7ICQA 1T3NA 5D4BA 3HT3A 1TVAA 1MQ2A 4Z6FA 2XY6A 4DL7A 5KFRA 8ICWA 3MDAA 3PNCA 3Q8RB 4MEYA 2C2RA 4O3SA 4PPXA 9ICFA 4YG2A 4F3OA 2NRRA 2KN7A 3LK9A 1WCLA 3Q8PB 5CP2A 4NM1A 8ICSA 4P4OA 2XCPA 4BDPA 3H40A 5DB7A 4M9NA 8ICJA 4JV1A 4GXJA 4I27A 3BQ2A 3ZDCA 2ISPA 1BPEA 4QWEA 2HHSA 4IRKA 1TAUA 4LVSA 5KT7A 2DPIA 4NM2A 5DGAA 4YR0A 1UT8A 5J0XA 3RB4A 4FS2A 3GIJA 1MSWD 4QZDA 2W9CB 3H8SA 2FMQA 4F5OA 4EYHB 4M47A 3HW8A 4MFCA 3EPIA 2W9CA 2C2DA 4QZAA 1BPXA 4TUSA 2IHNA 1QSYA 4O5KA 4YMNA 5F9LA 4DFJA 5KFEA 1QLNA
chains in the Genus database with same CATH superfamily
4KX3A 2HBMA 4ED2A 5KFFA 1HKCA 1S76D 2K8CB 2LBOA 3W0LA 2G8FA 3D7EO 5KFJA 3WUHA 4Z94A 3ZX3A 4QNLA 3VN5A 2YMPA 1LAWA 1QSLA 2IAJA 2V7ZA 2HVHA 3GILA 4RNOA 1KVAA 4UB3A 3L6QA 4E1NA 3E9LA 1EXQA 4BY9C 1X2IA 5J2DA 4ECWA 2KE7A 4RZRA 1L7NA 1N63A 3ZSWA 3BS5A 1NOZA 1WBDA 2K8BB 3CJ1A 1B43A 2ASLA 3NF9A 2W8LA 1NJWA 2RF2A 5M1PA 4ZTJA 4CK1A 3RMCA 2O8BB 4NXNK 3M8QA 4H5TA 4JI8K 3HSTB 4CF3A 3IDWA 4XH5A 3CRXA 3ZT0A 3PSIA 1LV5A 1ASVA 3FZFA 4GV3A 4FBTA 1NOYA 3CETA 2W04A 2Q3SA 1NZBA 1S6QA 1WWVA 1HIWA 2RP5A 3BZKA 3GU3A 4DEZA 4Y2TA 4C7ZA 3PMLA 2PFPA 3HXMA 5E84A 4JV5K 1S5LU 2GUIA 4IC9A 5DB8A 4H0XB 2KKPA 3WXLA 4ECUA 1TKDA 1JALA 3AVIA 1HUXA 1DGSA 2DL0A 5DKWA 1BPDA 4HAIA 3ATUA 2WB1F 4O44A 1T44A 1YUWA 5KG4A 2YV0X 2WHEA 4F50A 1MDUB 4O9MA 1AQ6A 1C20A 3TSPA 2VJ4A 2G09A 3G6XA 4IEEA 3AM9A 3D6RA 2I5HA 1N56A 2Z1IA 4U7BA 3CM6A 4C80A 2E1EA 7ICNA 5AM0A 3PLAA 3K59A 1ITGA 4QS7A 2I5JA 2XY7A 2HHXA 9ICVA 4E7LA 2W11A 4CERA 5DBAA 3MGVA 4NJ8A 2W54A 4PKHA 2YB1A 3DMJA 2C2EA 3A5LC 3J80O 3ULEA 3F73A 3VQBA 7ICJA 3SBTA 4Y2SA 3FR0A 4NO7A 3M9OB 3GIMA 5LY3A 3OYKA 4OCZA 1TKZA 1KKXA 4QAGA 1AROP 4UASA 5ADXA 3AN1A 3CD6N 4WCEL 5DG9A 3PIPL 3V6DA 4NXMK 4OPHA 3SK3A 4B3TK 4BWJA 4G3IA 1N32K 3KHGA 4DR6K 4DFPA 1IV8A 5KAFU 3AEVA 1J53A 4ISGA 3QEWA 3UKUA 2YKNA 2ITGA 5ALTA 3OJSA 4L8RB 3F2DA 3SMPA 4J9QA 3OY9A 1N36K 4FWOA 3CC2N 2FC0A 2E5SA 2FBYA 4E89A 2X6SA 3U8XA 5KFBA 5D46A 1MU2A 1T94A 4QW8A 3M6KA 3MN5A 3MBYA 4BRHA 5JICA 4CZFA 5I42A 4M0AA 1NBWA 4HUGA 1RCHA 5ALRA 2HNDA 3ZX0A 4DO9A 3VGMA 4FYDA 4CZJA 4GLXA 4KHYA 3HM9A 1Z6RA 2PFUA 5DMRA 4K4IA 3SI8A 1F21A 2Y1JA 2KIVA 4DTRA 3M7DA 1PVRA 4H0TB 3EKSA 5J2QA 2RQ5A 5J2FA 2BPFA 2QTDA 3GBTA 5KFMA 1ZQQA 4F8RA 1IJJA 1GLFO 3AVAA 1VK0A 3OBWA 3V4IA 1W7AA 5KT2A 1K73O 2XY5A 4I6MA 5HMLA 2D0AA 4QJFB 3OYJA 5F3XB 3CYMA 3G0ZA 5BR8K 4RT3A 1VQ8N 5KFAA 4JS5A 2RDJA 1WNSA 1R0AA 1WWUA 2KTQA 2RPIA 4M3RA 1KN5A 1N2XA 3H8WA 4JKGB 5GAGP 3CJ9A 3KK1A 3HTVA 2JEGA 1YVNA 4B3OA 3OPXA 4F4ZA 2YHWA 5AFUA 1XU4A 9ICSA 5L1IA 2QI2A 5AICA 1A0PA 1HUZA 2GWJA 2Y9UA 3ED5A 1DKGD 2P9UA 3CJAA 3H6EA 3Q7CA 4JD2A 3QMLA 2LKYA 3QU5A 4HVJA 3NVVA 3L3FX 5HL7L 3N4MB 4N5SA 2ZIXA 8ICZA 4QZCA 3PO4A 2FF6A 4RTFD 3HK2A 4CZIA 1IKXA 4O3QA 4DWIA 4E7KA 2V9WA 2AXTU 4YN4A 1SGGA 3HI0A 4DL4A 4CD3A 3DV9A 1OW5A 4I28A 4PKGA 3SMSA 2P9SB 2E88A 4CJ7A 2Y1IA 4OGEA 3O08A 4F5PA 4HHTA 4KHWA 1KVCA 3DLKA 5KFHA 1T4GA 7ICOA 2E1FA 4C1NK 1BOTO 3THXB 1BWFO 3SZ2A 3BJYA 4M7XA 2FMPA 1XQSC 2BCQA 5BOMA 4A2AA 3T5LA 1JROA 2QEXN 1IKYA 4B3SK 1XNSA 4CD1A 2NRWA 4KX5A 5M1NA 4CNQA 4RQ0A 3AVHA 3WKEA 4RQ5A 3QUBA 3NHGA 3OTQA 4JD2B 9ICAA 1K8KB 4QCLA 3V6JA 3ENBA 3P38A 4IQTA 1ZQTA 4DTPA 1Q8IA 3PR4A 3P4IA 1B0XA 5KG6A 4B1YB 5EE9A 4IOCL 3M3ZA 2WOMA 3ETLA 4H0VB 2E8PA 1S9GA 1JI7A 1IM4A 4CVNE 2AQ0A 3C1ZA 4QZEA 4CZGA 1J5OA 1UAXA 4FJIA 3N97B 5DK5A 2PYJA 1NKEA 4B8AB 1UHUA 5KFXA 1M90O 1T05A 3E58A 5C42A 1D8BA 2UXBK 4CJUA 5AI6A 4IKFA 5D49A 4WJ3B 4GKJK 3LM2A 5EWGA 3V9ZA 2KLAA 1A5XA 2P1JA 4Y2VA 2K8AA 2ITMA 4EP5A 3C1YA 3KLGA 1RT1A 3NVWA 1X6IA 3T3FA 4JB3A 3C2LA 4QW9A 4K41A 1RILA 1XC3A 4RW7A 3OYFA 1NK7A 1PK1B 2F44A 4C8KA 9ICUA 5CEHA 1T3VA 3H46O 3TADA 2QLTA 2X6NA 3OYIA 4F71A 3IAYA 4GV9A 3UB5A 4Y2PA 3MFHA 5BN8A 4B9MA 1A5VA 4OJOA 1DLOA 4AHCA 1JX4A 3AVGA 2R8GA 5AR0A 5DDMA 4P0PB 4DV5K 1ZETA 1XSNA 3F5AA 3PW0A 3N28A 2XGPA 3V9UA 2WFBA 1XS9D 8ICUA 4OPAA 3RMBA 1UCVA 2F1HA 3H8MA 3AU2A 4Z4CA 1TUYA 3SQ1A 4R5PA 2FJ6A 3ZSZA 1REVA 2JGAA 1KFDA 5DQGA 4QIWF 4J8FA 4FFDA 5J29A 1G99A 4DSFA 2OYYA 2JEIA 5AKZA 4Y2RA 5FP0A 4CFBA 5KFVA 3WQUA 1LVHA 1RT5A 1RT6A 3EPGA 2KZZA 5JRTA 4WE1A 3DOKA 3MR3A 1GLDG 3NTUA 2XGQA 2DFHA 4F4KA 5E41A 3LM9A 4KAZA 3PY8A 1X9MA 2V52B 4PGXA 3PSFA 4NCBA 5KFYA 3C7NA 3ALYA 3CCLN 4BRFA 4KFBA 4DTXA 2XIDA 1VQPN 5AKJA 5CZ2A 3ZEUB 2CGLA 1LAVA 3S3NA 8ICGA 4J03A 4EBEA 1NGCA 1NMDA 1S1VA 4XIUA 3NVZA 3DXKA 3D0PA 1U04A 4YOYA 3THYB 4DV2K 2D1KA 3GDQA 3WK7A 5DG7A 5C12A 2AH5A 2PFNA 4JI5K 4XRHA 5EE0A 5AQPA 3U4LA 1SXEA 1S0NA 2UVRA 3LDPA 1BI4B 4DR1K 3AVBA 3PZPA 2NZTA 2YNHA 4B9QA 1KAXA 3M1FA 4R8UB 1VSHA 2ATQA 2JGUA 1JL2A 2F8LA 3M8PA 3CI5A 3B0XA 2JLEA 1P7DA 3LWLA 2ZGYA 3VPZA 1F44A 1JCFA 2R8IA 5C10A 3C23A 5FPDA 4M3ZA 1HNWK 3VF2A 2WF9A 5C2DA 1ESVA 1ZBLA 2BCRA 4KH6A 5CY4A 5TKWA 3S6JA 3JPTA 1TKXA 4BRGA 3FFIA 1YITN 5ALZA 2X74A 3QO9A 4I29A 2AU0A 2LPEA 3IG5A 3CW2C 2K4IA 4ECVA 4Q45A 5AIBA 3C5GA 4YMMA 1YJ9N 4M7YA 1FKPA 2E2PA 4RQ4A 3OBYA 3C6TA 1ZQZA 3NASA 2UUCK 3TR8A 4JRPA 2OTLN 3FZKA 2W8KA 4YDUA 3DXMA 1BL3A 3LP0A 4I2GA 5AQXA 4LFCK 2NUBA 2YMLA 2ZXIA 4CEEA 3OTOK 4PH5A 4B9VA 4F5RA 1JXLA 3KJVA 8ICOA 1VSKA 1SV0C 4QZ8A 4DOCA 7ICTA 1LWFA 3R3LA 3UE5A 3LP2A 3LDAA 4XEIA 3C2KA 3DLLL 1WB9A 3ZT1A 3ZT4A 3K1RB 7ICGA 3CMAN 4UQGA 4FJ9A 1DK2A 1D8YA 5AZIB 2W7OA 1D9DA 3V9XA 1ZBFA 1OH6A 3RSEB 4B3RK 4YOVA 3RH5A 3JSMA 4FJHA 2KHOA 3QU4A 1J97A 4R8UA 5KFQA 3MEDA 4J9LA 5AQJA 4RUCA 3OHAA 5KFKA 2QB0A 1RDAA 2DWQA 2DFLA 5BOLA 1GOCA 4PZNA 5C0YA 3CQXA 2KIWA 3D2FB 1B92A 2VWKA 1B4FA 3H1VX 1HYZA 1JIHA 4N41A 4BQLA 3SD7A 3O4QA 3P1GA 1ZQVA 4GNIA 5K14A 3TADC 1KQQA 4K4GA 2W03A 1RTIA 2KEYA 2VKQA 4JK8A 4YY3K 4CHQA 4FJGA 4CJEA 4LZDA 3QICA 2MSNA 4DF8A 1OUQA 4O5BA 2K4EA 2LYHA 4QWCA 1NMNA 4NB4A 3T7ZA 1RG6A 1WBBA 4AYBF 2VG5A 5AQKA 2LI6A 1C0MA 1M6YA 2Q31A 5TKYA 5ALKA 3THWA 3J7YP 4BR2A 4R64A 1ZQFA 3IMXA 5MLCQ 3OYBA 4FPBA 3A5NC 4ILHA 5KT4A 1O13A 1ZQHA 1SUQA 1U45A 1S6PA 4DV6K 5AK3A 2KZ3A 3M1YA 1RBUA 2KICA 1Q9XA 3H8JA 4N56A 2NYVA 3TFSA 3M9NB 2A42A 2E6LA 2KNJA 4FWLA 4CEFA 3CCJN 1MA9B 2AGQA 2BDUA 4NL9C 2QWLA 3EL2A 1KCFA 3KHRA 4QS8A 2KKVA 4ECSA 4KITB 4O5FA 5AFUH 4M41A 4OJ5A 4RQ3A 3KZBA 4KHSA 1ZQOA 5ALFA 4BE0A 5KL1B 1S1TA 1IG6A 5GAEP 4MQ3A 1L3UA 3VESA 3AA3A 4FJXA 2WAQF 5AQSA 4H8KA 2E1YA 2JEFA 2YNFA 2K89A 4I2DA 5J2KA 1TL3A 4CEAA 4GFJA 3K5MA 3KD1E 4F5NA 4IDKA 2JXJA 4F4YA 1SWVA 1YZ6A 3EWAA 2G5IB 2D5RA 2YHXA 3BGRA 4B3MK 2ASPA 1C6VA 4MO4A 7ICQA 1D4XA 1T3NA 1NNEA 5H1SQ 4J2AA 3QUQA 5KFRA 3FAHA 1TYQA 2PBDA 5HR7A 3PNCA 3Q8RB 3VMFB 1IKVA 1VQ7N 3WK6A 3UMGA 1VQKN 4CJPA 2XCPA 3SENA 5DB7A 2VJ5A 3QUCA 3H40A 4GXJA 4OJLA 1GLJO 3ZDCA 5DGAA 1UT8A 4JMUA 4FS2A 4CZHA 4CZMA 4CJQA 4LFBK 2FSJA 2D8CA 4DKWA 3H8SA 2FMQA 2Q36A 3AVLA 4EYHB 5ALPA 4F72A 5GADP 1ZRNA 1RNHA 3U3GA 4TUSA 4O5KA 1EWRA 2BTFA 3SCXA 1SAZA 2W6LA 4CW7B 4B1WB 2VQFK 3IRUA 2I6XA 3H3NO 3UKUB 1EO1A 3KKAC 5DG8A 5B8HA 1NKBA 5KG1A 9ICIA 2A41A 2F9TA 4DR4K 1DK3A 5AK6A 5KT6A 4QZHA 1Q82O 4OLAA 4CZEA 4UB2A 1RDCA 5C25A 1OVQA 2H3VA 2HVIA 3MK6A 4IRCA 3FZHA 1QH9A 5HHIA 4PHDA 2FMSA 1BI4A 3IV6A 4FL9A 5AI8A 9ICMA 1NOMA 1XHXA 5EE3A 1C0GA 4CHNA 3F53A 2HHUA 3Q8MA 2W43A 2FLLA 2KFZA 1RT7A 5ALLA 2A6AA 5L1JA 4Z4FA 4K8XA 5JVHL 5F1XA 1V4TA 3S3OA 2F9WA 4Z4HA 4GY2B 4JV0A 3J7ZO 4Y2JA 2Y9TA 3E0FA 5EY4A 5J2PA 4JUZA 5J1EA 4CF2A 3ISBA 1GLLO 1HNVA 3WQTA 2YB4A 1Q8KA 5DBCA 3TANA 4CF8A 2HHVA 2P9NB 3K5OA 4ACOA 5HNKA 3JPOA 1YF5L 1NU0A 4Z6DA 2ZJQL 5IIJA 1J2NA 5K4LA 4IQWA 4HTLA 4FK4A 1MWMA 4IDHA 1Q46A 1P8ZA 3LP3A 1VRTA 3ZX2A 2DBYA 2H3ZA 4LY7A 3B9JA 1JUDA 3CFPA 2F4VK 4FWMA 2F8KA 2D0PA 5CYQA 3GE1A 4E0DA 2FDRA 3KHLA 4C8LA 1M1KO 4FVMA 2Q97A 5IT9O 2WUSA 1XNQK 3EE9A 2D6FC 3G25A 2G06A 5KG7A 2VCPA 4JKDA 2B21A 1RGIA 4C0ZA 8ICIA 2E4LA 1L8LA 5JS2A 3M6ZA 1GLEG 4DR7K 4O3NA 4BWMA 3O4WA 4DR2K 2OA8A 3ZCMA 4HCBA 5KFSA 4CEZA 2PMZF 7ICPA 4DQIA 3IDHA 1FFVA 4EYIB 1S22A 3PX4A 3C6UA 3KLIA 1QQCA 2IOHA 4RW6A 4CF4A 3OHBA 1Y97A 2LMRA 4BG9A 2P5OA 3C65A 3VA0A 5JTIA 4PGYA 3V9SA 1CZBA 5BPLA 1RYSA 3IKMA 3AO3A 4M3TA 3HO1A 4BDYA 2FPLA 5BPNA 4DG1A 1BNOA 5CHIA 5AI9A 3K9KA 4EX7A 3ZSRA 4ECRA 4RWTA 3QNMA 4LF9K 3U9DA 3TFRA 2DFEA 3H08A 2FLOA 3WXIA 1FJGK 2KHQA 4QS9A 8ICLA 4AILC 3L2VA 1TL1A 1NGIA 2ESEA 4CJKA 3HOTA 1QZ5A 2EZYA 5FPMA 5LMUK 2P66A 2KOBA 3MN6A 2KMDA 1RPLA 2ISOA 1JCGA 1RXVA 4W5NA 2VA2A 4BROA 4YCXA 1NGAA 5HRSA 4ECZA 4FOEA 4ID1A 4F93B 2Q0ZX 1NJZA 3PW5A 5CR0A 2VIXA 4PKIA 5AQYA 5BRDA 3CCEN 2WONA 3HL8A 4DTMA 4QWDA 4HWIA 4X5VA 4LD0A 4RQ7A 2BUPA 8ICEA 1N60A 2P5GA 1VAZA 5KFDA 3OYNA 5CWRA 1L7MA 4FK2A 1BDGA 2OANA 5TISU 5M1FA 1V85A 2YHBA 4C4TA 8ICBA 1T6DA 2QWPA 2KP7A 3RJJA 1HPMA 3CJ7A 3WXJA 4FLYA 2FI1A 5ALWA 4EHUA 1SXDA 3R9PA 4BE1A 1KW4A 3IM1A 4J9PA 3QEBZ 2R8JA 3GG4A 3BP8A 1ZQRA 1K6YA 3F9MA 4CF5A 2K4PA 4YOUA 2ZTDA 5AM1A 1TK5A 4P2HA 4CHYA 1L7OA 3VOVA 4FSVA 1NNLA 3C6AA 3QERA 3TWHA 2W55A 4NLKA 3SQ0A 4OJ6A 4IQVA 4FM2A 3CP8A 1CXQA 5L1LA 1N61A 2P35A 2KSOA 3G6VA 2HHQA 3HRGA 2Q0RA 2PFOA 9ICGA 1SZHA 4EBCA 4CHOA 1ZBUA 4QWBA 2YHAA 3D6JA 1DTQA 5AQHA 1QVGM 2DY4A 3L2QA 2HDOA 4TURA 4BGDA 4FJ8A 2QW9A 3C28A 2YX6A 3TU5A 5G5GA 2JRZA 2GV9A 3T69A 3MR2A 4R65A 2EZZA 2HOEA 4A57A 1LCUA 2PAVA 4ZTFA 2DPNA 4FVUA 3VQ7A 4H5WA 4O55A 4YD1A 3RAXA 2NRZA 2BGGA 1CZ9A 3KOOA 1T3QA 1WLJA 1NJXA 5KFLA 3EO3A 3VGLA 4B1ZA 3ZSVA 1HUOA 3QESA 4ED8A 3KD5E 3JPSA 3CJCA 4FWPA 2ZJRL 4CK3A 2BQUA 3A5OC 4DQ8A 2ZTCA 1S8OA 3C94A 4CGDA 3FZLA 5AM5A 2WF5A 4KLSA 4AHUA 4OX9K 1ZD2P 2VG7A 3T1AA 4KN4A 3KVGA 1U6ZA 4JKEA 4ILJA 3CG7A 5J0WA 4RNNA 3HWTA 3IG8A 3LALA 3ORYA 4IS7A 7ICVA 2CRXA 3NGIA 1XNRK 2B5JA 5CZ1A 3UKRB 5EWEA 1ZQPA 3WKDA 4ECXA 1N34K 3I0SA 4PHPA 1RDBA 2IC3A 3SAHA 2PYLA 3NDKA 4PHTX 3OS0A 3F2CA 1JLAA 3BUZB 4Q8EA 2O8EA 5KFTA 4KLTA 4GVMA 4F91B 3GV8B 4YOXA 4ELUA 3IP4B 2RRDA 4KO0A 2G8WA 1TKTA 4FJJA 4UAWA 4BVOA 2EWSA 4G9BA 3QX7A 3BS7A 8ICXA 1KXPA 2YJEA 4CJTA 2E8OA 1ZQJA 4ICAA 2P51A 9ICWA 3MXJA 3O9QA 2DGZA 4B9UA 3C7NB 1NWKA 2OPSA 4K8ZA 4A5AA 1E4FT 1ZD4A 3SLCA 4AHSA 4YR2A 4H4OA 3IUCA 5KQDA 5EX5A 3UXNA 3SNNA 4FW1A 3C6HA 3SUOA 1UPHA 4QZGA 8ICMA 5IIMA 2IOFA 2ZUDA 2WTFA 7ICSA 2ZJPL 4I2JA 1WUAA 4DSKA 4IWVA 3FGUA 3AMZA 2IOCA 5C2FA 2VQEK 5GIOA 4KMUA 4KLQA 2NO4A 1ATNA 4EP4A 2KG5A 2HB5A 4RU9A 4TQSA 2WBNA 3VEYA 4ED1A 5TZVA 1DTTA 1HX1A 3TAMA 5FLXO 4FJLA 1XWLA 4RNMA 4F2SA 3FE1A 4C8NA 4BXOB 3KKRA 5BRFA 2GLEA 1EETA 2P9IA 3PV8A 1KAYA 4DCCA 5B66U 1X9JA 4NCAA 4Y1DA 9ICPA 4W5RA 4GKKK 3QUTA 3AU6A 3ICXA 2I7PA 5L1MA 4LF4K 5DDYA 1JLBA 1X9WA 3O5BA 5JLFA 1W97L 1N8RO 4Z6CA 3NGYA 1RT2A 5J8YC 3OYMA 1NGFA 2IIRA 3SUPA 2IBKA 4PJ0U 2E1ZA 3VF6A 5HRNA 3H1QA 3BS5B 4BRIA 4H5VA 4JI6K 3VCBA 4DTSA 3JAMO 4F5QA 5AQGA 2XVTA 4CEQA 4RG8A 1QQ5A 5AQWA 3PO5A 1E3MA 3A0HU 2P9PB 1O1WA 4CJRA 2H3QA 2W40A 3MXMA 3AAQA 1J54A 2UVWA 3LZJA 3QEVA 1RT4A 2UU9K 3R9KA 4B6JA 3CNHA 4DUZK 4AM7A 2ZG6A 2HBJA 4Q43A 4ISEA 4DU3A 4O3MA 3DWLA 2B0CA 8ICKA 4DTNA 3DRPA 4NL9A 4M04A 1VSEA 3V9WA 1SKRA 4DV7K 3TPQA 3TABA 4HCCA 4WFAL 2IDOA 2V51B 4B9NA 3R8EA 1Q3VA 5AKYA 4M6WA 3HM8A 2NRVA 4Z6EA 2EAPA 4ED3A 2ZJAA 4DQQA 5JMVA 1S0VA 3KD3A 1H1VA 3ULEB 4A61A 3I8DA 3MXIA 3SV4A 2ASDA 4K25A 5G5HA 5HMMA 2E2OA 4RQ8A 3EUB2 4WFBL 4MF8A 3UQ0A 4W5QA 1BNPA 1ASUA 1BCMA 3DJCA 3BF3A 4RW8A 1KFSA 5BR9A 3SAFA 3WKCA 5SWMA 4RUAA 5J2IA 2KJ5A 5KI6A 3LVVA 1NGDA 5LMNK 3KFUF 5KRTA 3KWGA 1JN3A 4DSLA 5AK5A 4M63C 2A1RA 5HHHA 3VEZA 4FJ5A 3V6KA 1IG8A 4RW4A 2QARA 3LYSA 4MEXA 1VRUA 1OXJA 2Z7JA 3TARA 4CJSA 2YQEA 3QB0A 4CF1A 1T6CA 5EWFA 3PIOL 2BCSA 4RPZA 2IS3A 1NGBA 3SJJA 3RFAA 2YNGA 3OS1A 1HNZK 4FZYA 4Z4IA 4KLHA 2HF4A 3ZDBA 3KBBA 4FWRA 3S41A 4PL7A 3D2EA 5B5EU 4BRCA 2VANA 4DOAA 3RB0A 3SAGA 3GFKB 3L0QA 2Y0SC 3LWMA 2P9LA 4CZLA 1WCNA 5IINA 1PVQA 2QWOA 4NLCA 2D4WA 4JK1A 2W6KA 3KWIA 1WOQA 2J4RA 3B6OA 3QINA 4UARA 3SMVA 5KFCA 1NGJA 2E2NA 5M1KA 3T1HK 1FFUA 4DV4K 1JKHA 1WAFA 2HI0A 5KFUA 5AI5A 4Y2UA 2XCAA 4DLGA 1FKOA 1L3VA 2PFQA 4XH1A 1BGXT 2G8VA 4JKCA 3L4QA 1JJ2M 4LSNA 2CPRA 4YFUA 5J0OA 3QNNA 2F1JA 4DMNA 1TK0A 3OHRA 3FM9A 4DHYA 3K57A 3SUNA 2RDIA 2A19A 4JN4A 3FC4A 5J2JA 2A1JB 1YZ7A 4ID5A 2GWSA 4E7JA 3UXPA 5AQMA 1HJOA 4DFMA 1UWBA 2ZD1A 1BPBA 2K60A 4H0PA 5CR4A 4R63A 2JH7A 4BREA 3QFPA 3L8BA 1TE2A 4Q0BA 1BG3A 1Z1VA 3NF7A 3AARA 1NKCA 4BR4A 4O8KA 3M6GA 2G8HA 2AJQA 3MAQA 2FSKA 1L3TA 1O03A 2KW4A 4LF8K 4IG0A 4RW9A 3RAQA 1VJ5A 4UBCA 3KZXA 1RBSA 3U6FA 4I9LA 4WFNL 5JS1A 2AA4A 3QBWA 4BX9C 3O0FA 2XY6A 4DL7A 1RT3A 8ICWA 2H3GX 3AO5A 2EAMA 2HNYA 3KZIU 2C2RA 2G0AA 3NVMA 3ENOA 1WSJA 1EKEA 2B6GA 1L6NA 2NRHA 2XHBA 4P4OA 4BDPA 4M9NA 1RDDA 4MHVA 3BQ2A 5ALOA 2CH6A 3MX5A 3O9TA 1TAUA 4IBNA 4B1UB 4LVSA 5KT7A 3VTHA 2DPIA 4CJWA 2KVSA 3HKZF 3QXGA 4H5RA 2W9CB 4F5OA 3WKBA 1HQEA 4Y1CA 3HW8A 4CE6A 2OTJN 1U2VA 4CDGA 1Y64A 4QZAA 3S9HA 1BPXA 2DFFA 4DCHA 2OPQA 4JKGA 4YMNA 4CIGA 3DLBA 4DFJA 1PK1A 2UUAK 5FRMA 1LKYA 1C1AA 2EDUA 4FOIA 2A1AA 4E3SA 1IV0A 4NLZA 3GOIA 4WQ4C 3JPQA 3F2BA 1YAGA 5J2GA 2OEHA 3VA3A 3LP1A 1SS6A 2BKEA 3WXMB 4CGJA 5ALMA 2PZSA 1S0MA 3RJHA 1OH8A 1NK4A 1MC8A 8ICAA 1S9EA 3OGUA 4WYBA 3TTDA 4I2PA 1JLQA 3SJHA 1FO4A 1SZ2A 1Q7YO 4M3YA 2W3SA 4C4RA 1LB2B 3QETA 4JRQA 1KQSM 2Z1GA 4AYBC 5AQNA 4PL1A 2OPRA 3PX6A 1OVYA 2QKQA 3RRHA 3PW7A 3OJUA 3I33A 4LF7K 2HHTA 4WQ5C 2W42A 4UB1A 9ICXA 1HJRA 3I28A 4AM6A 1VQ4N 1WSGA 3BQ0A 4FJ7A 5L1KA 1SV0A 9ICEA 1S0OA 1VQMN 2ZXHA 3J7AP 5BPCA 4FW2A 4JI3K 3AQEA 4ED0A 4J9NA 1W2BM 3WNEA 1IBMK 2HF3A 3UMBA 2NRXA 3EYZA 3LL3A 4FLVA 2QK9A 3OYLA 4ELVA 4GC7A 1Z00A 4HUFA 5ALNA 2GBZA 3HOSA 1MA7A 1QE1A 3DYAA 2Q2RA 4O0IA 4CFAA 1GOBA 4JS4A 3SUQA 3ALRA 1J9AA 2YTUA 1QZ6A 4JK9A 2OWOA 2C28A 1BA0A 5F9NA 3THWB 1SQKA 3CXCM 3D2NA 3U26A 3EW9A 1S5JA 1ZRMA 4UW9A 1ZOLA 1VHXA 3DI6A 2GOLA 4NLBA 3AQFA 4K4HA 4H03B 4IO9L 4J2DA 5KFZA 4ECYA 5I3UA 2VWBA 2RLTA 4NLNA 2GUPA 4BRPA 4DUYK 3TACB 1XSPA 4BRQA 5KPRA 3R1XA 3T79A 4CHZA 3DXKB 2BHNA 3HPGA 3SR6A 4KLMA 4FJNA 3ITHA 4OKEA 4UAYA 3CIPA 5ALQA 2G5HB 4LZGA 3CMEN 2KZMA 3VQQA 4FJKA 1COKA 1VDVA 2O6KA 3ENHA 4BE2A 3RTVA 9ICTA 2YNIA 1RDWX 1QQ6A 3ZSOA 2FSNA 2LM1A 2D3DA 4XH4A 4C8OA 2D0BA 3G6YA 2YKMA 3NMUA 4I2HA 2Y0SF 2JV3A 5GIPA 4CE9A 2HOFA 1NK0A 3MR5A 3UMCA 2A3VA 3AGRA 5JLHA 3IFRA 2F2AB 4CIEA 3N7SC 2NRTA 2ZIXB 4JKBA 3F5TA 5J2MA 4O8UA 5IIOA 2F96A 1WN7A 4KKOA 4KH5A 3MC1A 2P9PA 3ZEUA 1KTQA 3UKRA 2VGNA 2ZIVB 4M45A 4P4MA 3VENA 4YP3A 2JZBB 3PVXA 2G08A 2KV2A 4YXMA 4DQPA 4M9HA 4WQ5A 2ZM6K 3HVRA 2QB0B 1KBUA 3C5FA 4KLJA 1X66A 4TUPA 1Z19A 3MECA 3O9RA 3KHHA 4I7FA 3A8YA 4F2RA 2DQNB 1FW6A 5EU7A 5C15A 1QVFM 2RE2A 2A40A 3JPPA 3RR8A 2WFAA 2XY8A 1ZQ1C 1ZQLA 2Q1NA 1LWCA 1GLCG 4CEBA 3NH2A 1TVRA 2E6MA 4E7IA 4C23A 3GIIA 1WG8A 2XI9A 5E26A 1SWWA 2GO7A 3CCQN 3NE6A 4MFAA 3VTIA 5E79U 1EWQA 3HP9A 4TSXA 2G8KA 4JHDA 2O8CA 1P90A 3KTQA 7ICUA 4BC4A 4FWQA 4GW6A 2UUBK 4DS5A 3MGIA 1X1PA 1N48A 3EE8A 1TFRA 3AY9A 4BJQA 1J6ZA 4CIFA 8ICYA 3O8MA 5CRXA 3HSCA 4X65K 1VQNN 3MN9A 1RQNA 5KT5A 1Z4OA 1ZC6A 1RYRA 3V1QA 2HOQA 1ZBIA 5KG5A 2FLNA 4RPXA 4DLEA 5AM4A 3RJIA 4ZH4A 5KTQA 1YXQA 3CC7N 1ZBSA 4IO8A 2PY5A 3JPNA 1SB3C 5DB6A 3JPRA 2KD1A 4DL5A 4BXOA 3AA4A 3VEXA 1K1QA 4I9QA 5J2HA 3MGHA 3HZ6A 3VEVA 1BVSA 2HHHK 5LJVA 3RRGA 3RJGA 8ICCA 3RBEA 5AZJA 4LFAK 4Y2XA 5IIKA 3H4DA 4US8A 5ALGA 2QA4N 3QE9Y 1RFQA 4KBOA 4JWNA 3BZCA 1U4BA 2O4IA 3AO1A 4DU4A 5AJ3K 2AQ4A 4NY8A 4LSLA 3THYA 5AKHA 3V72A 1Z00B 1JXEA 3Q7BA 2YY6A 1HJPA 5ALSA 1EP4A 1UA0A 3QIPA 3SQ4A 7ICRA 8ICTA 1D5AA 1C7YA 4O3PA 4BR9A 4AHVA 2GEMA 3ZETB 4E1JA 4BR0A 4TUQA 1BHLA 4CRXA 1KFTA 1NI3A 1VSDA 3TAFA 5JVGL 2D0CA 1S97A 4NXZA 2BQRA 4OJRA 1C0TA 4CECA 4DTUA 4I2QA 3MMVA 3CF5L 4EFHA 2E8NA 1BPZA 5ELZA 3VQ4A 2HSZA 3ZSYA 3QIOA 2W9BB 1V9PA 2YX8A 4KHUA 1KC8O 2DKZA 4JKHA 4CGIA 1VQ5N 2KJ9A 2G07A 1KLNA 2F76X 5CE3A 2BGWA 2G8IA 5AKIA 4BACA 3QYPA 3LDQA 3E9OA 5KFGA 3HP6A 4YNQA 3QEIA 4IOAL 1PVPA 3VQPA 2HW3A 1S77D 4P0QA 4BRKA 3I56N 4FZZA 3HJFA 1IO2A 4M9LA 4CI6A 1Q81O 4IFVA 1VSLA 4BGBA 2HMIA 1QTMA 2UXCK 1RTJA 5F0XA 1ZXIA 4DL6A 3E2EA 1IIPA 3OYEA 3BDPA 2P9KB 1ED1A 2DPJA 1VSMA 1XO0A 4L3QA 3LVWA 5HRPA 4NYFA 1YJWN 4Q44A 4J9KA 1KAZA 3TSQA 3T5KA 5M1OA 2ATLA 4DV1K 1JLGA 1I94K 2OPPA 3ZT2A 3ZDDA 3VF4A 5C5JA 4FBUA 3HRDD 2IVNA 5AQOA 1BIUA 1IXRA 3QFUA 3K2PA 4G1QA 1U49A 1NLVA 5J2EA 3EEQA 1EQYA 4FPAA 2P6UA 4YOTA 3H3OB 2I9GA 1ZQUA 5J0SA 3A0IX 2W9MA 3K58A 4KHQA 2NV3A 1H38A 1CZAN 3E01A 4QIWC 4DV0K 3PMNA 4CJ3A 1BU6O 1XMQK 9ICQA 3P83D 4IG3A 3DRRA 4GIBA 2EH9A 3IHQB 4UATA 1L3SA 1V4SA 2RKIA 1JRPA 3VGKA 4FE3A 1WSIA 2IOFK 3GV7B 4CESA 4WF9L 4CEOA 4CGZA 1OH5A 4FZXC 4KLFA 2AP1A 1ZQEA 1BCOA 4OD0A 4KN7A 1ZYQA 5FPEA 4FLWA 1X9SA 4U7CA 2JH1A 1L5UA 2X78A 3QDKA 3QLHA 2WTUA 4KPYA 3D2SA 3JXUA 4DTOA 2P9UB 4F9OA 5SZTA 5D3GA 3E66A 3THXA 2VYPA 3H45C 4BRAA 1DGKN 3N4QA 3LDSA 1XI1A 1NK6A 1U48A 2JHDA 2R8KA 3CQYA 1BQNA 3WEEA 2O8EB 4KLIA 4YQWA 2H3FA 5CHGA 1JXBA 2OM6A 4OKKA 4Y2YA 4J9RA 1TV6A 4XUSA 2XRIA 3SEIA 1D8LA 1I3AA 1KVBA 4ZHRA 1B9FA 3V7LA 5T7BA 3PUFA 1T03A 5HROA 2GELA 3W3DA 3V7JA 3KKSA 2ALZA 1ZD3A 1NM1A 2IGIA 3AVJA 2R7YA 5AM2A 3TKAA 3DLHA 2MU2A 1ZXOA 4B9LA 2GX9A 3LAMA 5IWAK 5DLFA 2DTUA 4JV2A 1UA1A 3QEXA 1PUZA 3NFAA 1VSIA 5AKEA 4BRMA 4FZMA 3SBGA 2AHOB 3K1ZA 3ID6A 3HJEA 4IFEA 3ZLJA 3Q8SB 1QQOA 4KRFA 3MABA 4PWDA 9ICJA 3TAEA 3RB3A 5AQRA 2A3ZA 1OH7A 3K75D 4DOBA 2LM4A 4I6MB 3L5KA 2FPKA 3QNOA 4MFFA 2ZIVA 4Q8FA 1BQMA 2JEJA 4AP9A 3S3MA 4J2EA 3RJKA 2R18A 2PXIA 1X40A 5DM7L 3LPTA 3UQ2A 4NCGA 2HBLA 4DR3K 1PZNA 3NS1A 3UM9A 1DT9A 2Q0UA 4MO5A 3HX0A 3GV5B 4V19S 4AHRA 4QZBA 1N5WA 1LW2A 4JK7A 3QU7A 1Z05A 5AK4A 5CJ7A 3OSPA 3F9KA 3AO2A 2OCEA 4UB4A 3KK7A 3MEEA 3NF6A 4OVLA 1DRGA 4E1MA 1LKYB 4PUOA 2O8BA 1VSJA 4R79A 4OLBA 1IH7A 1YTUA 1KEJA 1ZQNA 4FLXA 1NGHA 2ZJ5A 3L3UA 1Q9YA 3VEWA 2BDPA 3ZDAA 3V1OA 3K4GA 1Q86O 3MEGA 3FYHA 5KNIA 4J9OA 3RR7A 3A2FA 3RMDA 1GOAA 2HSTA 3ID8A 1JLCA 4F4XA 3O6WA 3NRWA 3B8AX 4NWIA 3V6HA 1Z26A 4PZOA 2FPMA 3QBXA 4BRDA 1SV5A 5AIAA 5JU5A 4X64K 4G9ZA 4JKFA 1CUKA 3EY1A 2A5XA 1IBKK 4FK0A 1FIQA 2IMWP 2ZIUB 3F5EA 1B9DA 4O0JA 2YMQA 3TTFA 4DU1A 3LDNA 2BH1A 3LZIA 3L4IA 1N5YA 9ICBA 1HNXK 2F8TA 1Q18A 2HBKA 4PHAA 4I2EA 5DM6L 4GXIA 5M1QA 1N62A 3V7KA 4YORA 4O4GA 4QWAA 3RH6A 4IFYA 3RBDA 2F3NA 3HILA 3BQ1A 1HRHA 5KT3A 1K1SA 7ICLA 3AVKA 1T7PA 1CXUA 4YMOA 3THVA 1W0HA 4TQRA 1FXXA 3D2FA 4IR9A 3O1WA 3VQ8A 3H4BA 3O3HA 1C0UA 2ASJA 1ZQKA 2GTDA 2I7NA 1NG9A 1SZPA 1RTDA 1YI2N 4X62K 1HMVA 2RN2A 4UB6U 8ICHA 3DDHA 4RQ6A 4N47A 4DSJA 1HQUA 5KQ8A 4BC5A 4I2IA 3LANA 1X3MA 4BUGA 3O3FA 3HT3A 1TVAA 4Z6FA 1RTHA 3MCPA 3GZFA 3CERA 3CFOA 4MLHA 4ISFA 1QCKA 2FBXA 4YG2A 3VQCA 3E1YA 4JHDB 2KHVA 3WU2U 2E8MA 4CZKA 2KN7A 3LK9A 5J8YA 4UB8U 5CP2A 4NM1A 8ICSA 3I8BA 3RWUA 2LYAA 2QWNA 4BR5A 8ICJA 4JV1A 2RHKA 2KJ8A 3DXMB 2CXYA 3T1YK 3CPEA 2ISPA 1BPEA 4QWEA 4CGHA 4IRKA 3OYGA 4NM2A 4FXDA 5ALXA 5KRSA 5BREA 3RB4A 1MN8A 3P31A 4KTWA 1MSWD 1WSHA 2ZGZA 1S3XA 3L2UA 3VETA 4M47A 2P9IB 3ONNA 4GVEA 1JLEA 5C24A 2O8FB 2W9CA 2C2DA 4NV0A 3RF9A 3B6PA 3NH1A 2CN1A 3RVCA 4B8CA 4HTUA 5HR6A 2IHNA 4JEPA 1QSYA 3MX2A 5KFEA 1QLNA 4FCYA 3GQCA 4M2YA 3MR6A 4M3XA 8ICPA 3WK8A 4E19A 1GLAG 2LYBA 1ZQAA 5J2AA 2LHTA 4CFCA 3WXKA 2BANA 3I1YA 1LW0A 3A5MC 1SL2A 3CCVN 4OPKA 5T14A 7ICHA 3AA2A 4IJNA 4HUEA 3VC8A 3MN7A 2P9LB 3OYCA 1CLQA 1I39A 3KLEA 4RQ2A 5CB1A 4AF1A 1X9XA 4I2CA 8ICRA 2MAXA 4DL3A 3DLEA 3D2EB 1S72N 3MDQA 9ICNA 2B6AA 1D9FA 4CJVA 1HR0K 1HPZA 2P6RA 1RBRA 4DR5K 1Z1BA 4RPYA 3WNGA 4QOZB 3NGZA 4YD2A 5J0YA 1ZBHA 3NRZA 2HHWA 5J0RA 2GH1A 4DB3A 5LJWA 1K5OA 4R66A 4F92B 4A8EA 3KKAA 3CM5A 4J2BA 3NVKA 4Z0UA 3V1RA 1SKSA 2IA6A 5HP1A 1C1CA 3IS9A 4FWSA 3KLFA 9ICLA 4H5NA 4KH4A 4C8MA 1X3NA 2J6UA 4FWKA 3ZT3A 2ZIWA 3HVTA 4K0KK 2AGOA 3G6EN 4ILGB 5AZJB 2QB1A 1QS4A 4MDAA 4X66K 1J5EK 5HOOA 4YVZA 4DQSA 4J9SA 4BR7A 5KAIU 3TSUA 1B22A 2RHFA 1SL1A 3OYAA 3ETRA 8ICQA 1NGEA 2MUTA 2WF6A 4M3WA 2O8CB 5ALYA 2K4HA 2ZQBA 4LH4A 3WK5A 1RDFA 4P0PA 4KLGA 4I2AA 4E7HA 3WKAA 3FFKB 4O5CA 4CBXA 4JI7K 3NCIA 2WF8A 5J2BA 5DQHA 5AQVA 4CCHA 2A1JA 2F8SA 1N6QA 5DLGA 1TUUA 1ZQSA 1ZQMA 4CGFA 1RXWA 4FLZA 4JI0K 5HLFA 4H4MA 3H0LB 4GC6A 3VQ9A 2QWRA 1LWEA 5DGBA 5J0UA 1KL9A 5A0LA 2V4RA 2VG6A 2ZJ8A 2FBVA 1ASWA 1TGOA 1RBTA 3PSPA 4O5EA 3HKZC 4CK2A 5AQQA 5CA7A 2J6TA 3SQ2A 4USAA 3MWPA 5AQZA 3I0RA 4LH5A 3SI6A 5FDLA 1W9HA 2KKZA 2QXLA 4UY8O 1XO1A 2BPCA 4EENA 4EIAA 3I55N 2QKKA 1PK3A 3RH4A 2YHYA 2KFNA 3WK9A 1A76A 2OXOA 3GIKA 2W9BA 4NLGA 1CEZA 1ZQYA 2EX3A 1DEJA 3ZSXA 4A5BA 2HMPA 4BRNA 2IHMA 4O3OA 3C2MA 3SQIA 2E5LK 2CGKA 3NAEA 5J2CA 1V97A 5KFOA 1YIJN 1ZQXA 3SV3A 1L8OA 2DUYA 3NUQA 1VQLN 7ICIA 4LF6K 3KIOA 3K0SA 1N33K 5ALJA 3WNHA 2PI4A 2O4GA 4BGAA 4Y2QA 4C7YA 4MFBA 3L2WA 2ZF5O 4FZLA 5ALDA 4PGQA 5AQIA 3CFRA 2H5XA 1JCEA 1BUPA 5AKXA 1U9LA 5AM3A 2BR0A 2VGMA 2QKBA 5GINA 4MF2A 3QZ8A 1WUDA 2WAQC 3CCUN 2EZXA 2FLPA 4CJ4A 3G4SN 1HYSA 2HNZA 4YR3A 5FRNA 5DB9A 3G71N 2MRLA 2KK0A 1COOA 1JMSA 4M9JA 3VQEA 4EBDA 5KPZA 1ECWA 2NO5A 3ISCA 3JS6A 3O80A 1VQ6N 1BIZA 2F7TA 3G10A 4K42A 8ICVA 1Z4NA 3PSTA 1HKGA 2YJFA 1RM6C 3IG1A 3H0MB 1TV9A 3NBPA 3CC4N 1ZJNA 3DRSA 3H7IA 4CF0A 4HYKA 3TAGA 2AGPA 1ZQIA 4ELTA 2QM1A 2O8DB 2QXFA 4ED6A 3AA5X 3CCSN 4W5OA 3RB6A 5HBMA 3HBTA 3P5JA 5GTHU 2YMMA 3L2RA 4YXJA 3WT0A 4RQNA 5J0TA 3OYHA 1S1UA 4OJPA 4FJMA 1GO3F 1S1XA 4BDZA 3TTCA 3RSEA 4BG8A 2CH5A 5KG0A 4IZ9A 5AZIA 4JYAK 4F4WA 4RT2A 4KB0A 3E9PA 2J6SA 4DF4A 3QU9A 5KFPA 4B9SA 4OPJA 1K8AO 4IR1A 4I2BA 4CJ5A 3FLCO 1ZQCA 3ZD8A 4OO1J 5AKGA 1A77A 2F77X 4KLEA 3DAWA 4QZFA 2OHFA 2NNWA 2YI1A 2HMXA 4UBBA 2FF3B 3FZMA 3UPQA 4IEIA 2O8FA 1VQON 3M8SA 2B4JA 5LL6Z 4FLUA 4AH9A 2W7PA 3JYTA 5AQFA 3BQ7A 3QEAZ 7ICEA 3TAQA 2E20A 3N4PA 2C22A 2KQ2A 1SL0A 3B0YA 1HKBA 1BISA 1K9MO 1A6SA 2JWLA 4KREA 3O9SA 4CJFA 4DQRA 4BC3A 3O3GA 2CGJA 1Y88A 2E3TA 2JWKA 3C95A 2DKXA 4BVPA 3PW2A 4UB5A 2ODGA 3ISDA 5ALVA 8ICNA 3OSNA 2ZWHA 4RCHA 3T5JA 1Z25A 1V38A 4ZOHC 2BZFA 1XC9A 1TYQB 1UOCA 3BF1A 5J0QA 4FO0A 4H0OA 4JKAA 3DOLA 4A59A 4CBWA 3AUOA 4PL2A 2ZTEA 9ICOA 4KLOA 1QQMA 5KPTA 4EELA 4EZ6A 1WYGA 4EZ9A 4ECTA 4I2FA 1F0MA 3VERA 3VQAA 1TAMA 3MDCA 2QARB 1OKJA 4BC2A 5AKLA 2FE9A 1T8EA 5KG2A 3I76A 4UAVA 5AI4A 1FEZA 5HRRA 4LF5K 1QQNA 3SYZA 1MQ3A 3O4NA 3M5RA 3MFIA 2KSOB 2IVOA 2L5YA 2UVUA 1Q3UA 2ASOA 5ALUA 2W41A 1QHTA 3EZWA 3HPHA 3BQTA 3K5NA 3KK3A 1X42A 4RQ1A 3M8RA 5BN9A 1NJYA 4MLEA 2A1SA 7ICFA 3AO4A 3ZI4A 3DM2A 5KGWA 1YHQN 3F2KA 4PHEA 3QU2A 5DBBA 4EX6A 1WSEA 4ED7A 3TI0A 4EAHD 2M0NA 2GWKA 2XICA 3L3VA 5KFWA 3N7PD 4M3UA 2Q4TA 1EXNA 4PY5A 2KVCA 2YN4A 4M6WB 2XO7A 3WNFA 4KLLA 4IRDA 3NH0A 5J2NA 1YTAA 5KGXA 2UYTA 4RQMA 4IXCA 2BE2A 1HEKA 3BEXA 1L7PA 4KTQA 3C0BA 2WF7A 3RJFA 3A0BU 3CCMN 3RMAA 5CYMA 3ZD9A 3Q8LA 4KLUA 4UAUA 3PX0A 1DOQA 1VLBA 2UVVA 3SPZA 2BQ3A 1N5XA 3ZSQA 3OS2A 4KI6A 5HP4A 8ICFA 1G15A 2HCFA 4DS4A 2EQYA 4P4PA 1IKWA 4NYNA 1XUPO 2BCUA 3IRXA 1VQ9N 3NVYA 2F1IA 1ZQBA 2NLXA 2ES6A 4C1NI 2G8UA 1JLFA 2D0OA 1RYUA 3WK4A 3PR5B 2PI5A 3Q8QB 2MA1A 3GL1A 1IBLK 3U3YA 4ECQA 3CJBA 5AHXA 1KDHA 4DL2A 2M9NA 1BA1A 3AVFA 1RBVA 4U6PA 2HOIA 2JZBA 2BPGA 2O8DA 4KV8A 2EANA 3J81O 3KLHA 5GAHP 4O3RA 2QWQA 3VQ6A 2BCVA 3ULDA 2UXDK 1XSLA 2V7YA 3OVNA 4Y0WA 3Q8KA 2OH2A 5I9EB 3LDLA 5EXWA 3UIQA 4JI4K 5KL8B 3OW2M 1TAQA 9ICHA 1UQVA 3K5LA 4FZNA 1E4GT 2QWMA 4JI2K 2ZUCA 1X6JA 1NK9A 4Q5VA 2OZSA 4CJLA 1ZD5A 4IL6U 4XQ8A 4OKJA 4FM0A 1GLBG 2EHGA 4EHTA 3GDXA 4U67L 1S9FA 1BPYA 2E2QA 3T19A 2VA8A 2WB1C 4H0YB 2VA3A 4B9TA 3AVMA 4YOWA 3CCRN 1Z3EB 4DTJA 4KMOB 3O1BA 4GXKA 2MUTB 3CPWM 4DFKA 1URJA 3C29A 3J8AA 4KB1A 2LSNA 4J9MA 3VEOA 5AQLA 4CFDA 1KD1O 3N7RC 1BO5O 4CF9A 4BRLA 1XMOK 3H0RB 2P9SA 4W5TA 1ZJMA 1KLMA 2V4QA 4QZIA 3HPOA 5AKKA 4B1XB 1RDUA 2ZIWB 5AQUA 3L4PA 4CHPA 3TAPA 1S10A 2PKEA 3EN9A 3PW4A 1JL1A 4OGCA 4YFKA 5KG3A 2W3RA 3AAPA 5FPNA 1KRPA 2FBTA 4CGGA 4FM1A 9ICCA 5EOYA 1DGJA 4EEYA 1DXSA 4CBUA 2PMZC 4EEKA 3ASMA 3DEEA 4Z4GA 5BPMA 1YVUA 1ZQDA 3QZ7A 1NGGA 2E8AA 1CRXA 2R8HA 4GV6A 5AQTA 1CI4A 2N1RA 2YCHA 1FK9A 5EOZA 5FROA 3CQ8A 9ICKA 5ADXH 4FO6A 4F3TA 4KHNA 1QHAA 1C1BA 4A2BA 4AHTA 1S1WA 4KLDA 4ICLA 1YJNN 2OZMA 3K9JA 3ISNC 4JNEA 5DQIA 2P9KA 4DSEA 1A5WA 3LAKA 5BRHA 5KFNA 2Z1JA 1LOTB 3AVCA 3DLRA 4JI1K 1MWKA 3AV9A 3QEPA 4JWMA 4US9A 3RJEA 3D45A 3T5HA 2I1QA 4UAZA 3NGDA 3BY5A 3FDSA 3UXOA 4DSIA 4IQUA 4P0QB 4YHHK 2H3IA 3SPYA 3O9UA 3OYDA 1ILYA 3TQ1A 4M9GA 3KHYA 2XC9A 4YDUC 1HLUA 7ICMA 4PA1A 2ASMA 5ALIA 5IIIA 5A2QO 1WAJA 3HYFA 1ZQWA 5KFIA 7ICKA 1HNIA 5J0PA 1ZQGA 5ALEA 3CHWA 1NK8A 4FLTA 1NK5A 4PL8A 1RQLA 3VQ5A 3MCAB 5EVZA 3C21A 4QZ9A 4B08A 3EKUA 3ATVA 1U47A 1HYVA 4IOXA 1RZTA 4LC9B 4MDBA 1EX4A 1UT5A 5JUMA 2W9AA 3KK2A 1U2VB 3ZYYX 3LPUA 1R59O 3OA9A 4JLHA 2VWJA 3M9MB 4FS1A 2ZUBA 1SKWA 1QSSA 2DF4B 3D2QA 5L9XA 1K8KA 3EZ5A 4M42A 1VSFA 4XA5A 5IILA 1J2MA 3U9ZA 3P39A 4DFDA 9ICRA 5AI0A 1ATSA 1O08A 3VQDA 1NZPA 1TK8A 1KSPA 3AVNA 4Z4EA 3ZDEA 4AQYK 3LDOA 4IJAA 3J81j 5D4BA 1MQ2A 4LJXA 5ALHA 4KTZA 3MDAA 4JAXA 1SV4A 4MEYA 4O3SA 4PPXA 9ICFA 4F3OA 2JMGA 3WEEB 4BQZA 2P9NA 2NRRA 1YT3A 5EE1A 4C4SA 1WSFA 3Q8PB 1WCLA 2Z1HA 1ATRA 1XHZA 1QQ7A 2ZIUA 4GMJB 2FXUA 2IVPA 4I27A 4FWNA 3NF8A 4KHPK 3ZETA 2HHSA 2ZE2A 3AGKA 4K43A 4YR0A 4N76A 3IN5A 3AL0B 3V81A 5J0XA 3DLGA 3MWTA 5GTIU 3GIJA 4QZDA 5H2FU 1SIJA 1C0FA 3R6MA 4CEDA 2OYQA 2ETJA 1IG9A 4A62A 2WC9A 1NJIO 4MFCA 2EAOA 3EPIA 4PQUA 4KI4A 4DV3K 1F5SA 5F2RA 5F9LA 4WQ4A 4B1VA 2JR5A
chains in the Genus database with same CATH topology
2HBMA 4ED2A 5KFFA 1HKCA 1S76D 3W0LA 3D7EO 5KFJA 3WUHA 4Z94A 3ZX3A 1QSLA 2V7ZA 2HVHA 3GILA 4RNOA 4UB3A 3L6QA 4BY9C 3E9LA 1X2IA 5J2DA 4ECWA 4RZRA 3CJ1A 1B43A 2ASLA 2W8LA 1NJWA 5M1PA 4H5TA 4XH5A 1LV5A 4GV3A 3FZFA 4FBTA 3CETA 4DEZA 2PFPA 3PMLA 5E84A 5DB8A 4H0XB 3WXLA 4ECUA 1TKDA 1HUXA 1DGSA 5DKWA 1BPDA 3ATUA 1T44A 1YUWA 5KG4A 4F50A 1MDUB 4O9MA 3TSPA 3G6XA 4IEEA 3D6RA 1N56A 4U7BA 7ICNA 3PLAA 4QS7A 2XY7A 2HHXA 9ICVA 5DBAA 4PKHA 2C2EA 3A5LC 3ULEA 7ICJA 3SBTA 3FR0A 4NO7A 3M9OB 3GIMA 5LY3A 1AROP 5ADXA 3CD6N 4WCEL 5DG9A 3PIPL 4OPHA 3SK3A 4BWJA 4G3IA 3KHGA 4DFPA 4ISGA 3UKUA 3OJSA 3SMPA 4J9QA 4FWOA 3CC2N 3U8XA 5KFBA 5D46A 4QW8A 3MN5A 4BRHA 5JICA 3MBYA 4CZFA 4M0AA 1NBWA 3ZX0A 4DO9A 3VGMA 4CZJA 4GLXA 1Z6RA 2PFUA 4K4IA 3SI8A 2Y1JA 4H0TB 3EKSA 5J2FA 2BPFA 2QTDA 3GBTA 5KFMA 1ZQQA 4F8RA 1IJJA 1GLFO 3OBWA 5KT2A 1K73O 2XY5A 4I6MA 5HMLA 4RT3A 1VQ8N 5KFAA 2RDJA 2KTQA 5GAGP 3H8WA 4JKGB 3CJ9A 3HTVA 2JEGA 1YVNA 4F4ZA 2YHWA 5AFUA 1XU4A 9ICSA 5L1IA 2QI2A 1HUZA 2GWJA 1DKGD 2P9UA 3CJAA 3H6EA 3Q7CA 4JD2A 3QMLA 5HL7L 3N4MB 8ICZA 4QZCA 3PO4A 2FF6A 4RTFD 4CZIA 4O3QA 4DWIA 2V9WA 4YN4A 3HI0A 4CD3A 4DL4A 4I28A 3SMSA 4PKGA 2P9SB 2E88A 4CJ7A 2Y1IA 3O08A 4F5PA 5KFHA 1T4GA 7ICOA 4C1NK 1BOTO 1BWFO 3SZ2A 3BJYA 4M7XA 2FMPA 1XQSC 2BCQA 5BOMA 4A2AA 3T5LA 2QEXN 4CD1A 2NRWA 5M1NA 4RQ0A 4RQ5A 4JD2B 9ICAA 1K8KB 3V6JA 3ENBA 3P38A 4IQTA 1ZQTA 3PR4A 3P4IA 5KG6A 4B1YB 4IOCL 3M3ZA 3ETLA 4H0VB 1IM4A 2AQ0A 3C1ZA 4QZEA 4CZGA 3N97B 1NKEA 5KFXA 1M90O 5D49A 3LM2A 5EWGA 2KLAA 2ITMA 3C1YA 3T3FA 3C2LA 4QW9A 4K41A 1XC3A 1NK7A 4C8KA 9ICUA 1T3VA 3H46O 4GV9A 3UB5A 3MFHA 5BN8A 4B9MA 1JX4A 2R8GA 5AR0A 5DDMA 1ZETA 1XSNA 3PW0A 2XGPA 2WFBA 1XS9D 8ICUA 4OPAA 2F1HA 3AU2A 1TUYA 1KFDA 5DQGA 4J8FA 5J29A 1G99A 4DSFA 2JEIA 5KFVA 3WQUA 3EPGA 2KZZA 3MR3A 1GLDG 3NTUA 2XGQA 4F4KA 3LM9A 3PY8A 1X9MA 2V52B 4PGXA 5KFYA 3C7NA 3CCLN 4BRFA 1VQPN 3ZEUB 2CGLA 8ICGA 4EBEA 1NGCA 1NMDA 3DXKA 4YOYA 2D1KA 3GDQA 5DG7A 5C12A 2PFNA 4XRHA 5AQPA 3U4LA 1S0NA 2UVRA 3LDPA 2NZTA 4B9QA 1KAXA 3M1FA 4R8UB 3CI5A 3B0XA 2ZGYA 3VPZA 3LWLA 5C10A 1JCFA 5FPDA 2R8IA 3C23A 3VF2A 5C2DA 1ESVA 2BCRA 4KH6A 5TKWA 4BRGA 3JPTA 1YITN 4I29A 2AU0A 4ECVA 4Q45A 3C5GA 4YMMA 1YJ9N 4M7YA 2E2PA 4RQ4A 3OBYA 1ZQZA 2OTLN 3FZKA 2W8KA 4YDUA 3DXMA 5AQXA 4I2GA 4PH5A 4B9VA 4F5RA 1JXLA 8ICOA 4QZ8A 4DOCA 7ICTA 3R3LA 3UE5A 3LDAA 4XEIA 3C2KA 3DLLL 7ICGA 3CMAN 4UQGA 1D8YA 5AZIB 1D9DA 3RSEB 4YOVA 3RH5A 2KHOA 4R8UA 5KFQA 4J9LA 5AQJA 4RUCA 3OHAA 5KFKA 2DFLA 5BOLA 3CQXA 5C0YA 3D2FB 3H1VX 1JIHA 4BQLA 1ZQVA 4GNIA 4K4GA 4JK8A 4LZDA 3QICA 4DF8A 2LYHA 4QWCA 4NB4A 3T7ZA 5AQKA 2Q31A 5TKYA 4BR2A 4R64A 1ZQFA 3IMXA 5MLCQ 4FPBA 3A5NC 4ILHA 5KT4A 1O13A 1ZQHA 1U45A 2KZ3A 3H8JA 3TFSA 3M9NB 2A42A 4FWLA 3CCJN 1MA9B 2AGQA 2QWLA 4QS8A 3EL2A 3KHRA 4ECSA 4KITB 4O5FA 5AFUH 4RQ3A 3KZBA 1ZQOA 5GAEP 1L3UA 3VESA 5AQSA 2E1YA 2JEFA 4I2DA 5J2KA 4F5NA 4F4YA 3EWAA 2YHXA 2ASPA 4MO4A 7ICQA 1D4XA 1T3NA 5H1SQ 5KFRA 1TYQA 2PBDA 3PNCA 3Q8RB 3VMFB 1VQ7N 1VQKN 2XCPA 3H40A 5DB7A 4GXJA 1GLJO 3ZDCA 5DGAA 1UT8A 4FS2A 4CZHA 4CZMA 2FSJA 4DKWA 3H8SA 2FMQA 2Q36A 4EYHB 5GADP 4TUSA 4O5KA 2BTFA 1SAZA 4B1WB 3H3NO 3UKUB 1EO1A 5DG8A 5B8HA 1NKBA 5KG1A 9ICIA 2A41A 2F9TA 4QZHA 5KT6A 1Q82O 4CZEA 4UB2A 2HVIA 3MK6A 4IRCA 3FZHA 5HHIA 4PHDA 2FMSA 4FL9A 9ICMA 1NOMA 1C0GA 2HHUA 3Q8MA 2FLLA 2KFZA 2A6AA 5L1JA 5JVHL 5F1XA 1V4TA 2F9WA 4GY2B 4JV0A 3J7ZO 5EY4A 4JUZA 3ISBA 1GLLO 3WQTA 5DBCA 3TANA 2HHVA 2P9NB 5HNKA 3JPOA 1YF5L 2ZJQL 4Z6DA 5IIJA 4IQWA 4HTLA 1MWMA 4IDHA 1P8ZA 3ZX2A 4FWMA 2D0PA 3GE1A 4E0DA 3KHLA 4C8LA 1M1KO 2Q97A 2WUSA 3EE9A 3G25A 5KG7A 2VCPA 4JKDA 2B21A 1RGIA 8ICIA 1GLEG 4O3NA 4BWMA 3O4WA 5KFSA 7ICPA 4DQIA 3IDHA 4EYIB 1S22A 3PX4A 3OHBA 4BG9A 3C65A 4PGYA 5BPLA 1RYSA 3IKMA 2FPLA 5BPNA 5CHIA 3K9KA 4ECRA 4RWTA 3U9DA 3TFRA 2FLOA 3WXIA 4QS9A 8ICLA 3HOTA 1NGIA 1QZ5A 5FPMA 2P66A 3MN6A 1RPLA 2ISOA 1JCGA 1RXVA 2VA2A 4BROA 4YCXA 1NGAA 4ECZA 4FOEA 4F93B 2Q0ZX 1NJZA 3PW5A 5CR0A 4PKIA 5BRDA 5AQYA 3CCEN 4QWDA 4HWIA 4X5VA 4RQ7A 2BUPA 8ICEA 1VAZA 5KFDA 5CWRA 1BDGA 2OANA 5M1FA 2QWPA 8ICBA 1T6DA 3RJJA 1HPMA 3CJ7A 3WXJA 4EHUA 3R9PA 4J9PA 3IM1A 3QEBZ 2R8JA 3GG4A 3BP8A 1ZQRA 3F9MA 4YOUA 2ZTDA 1TK5A 4P2HA 3VOVA 4FSVA 3C6AA 4NLKA 4IQVA 5L1LA 3G6VA 2HHQA 3HRGA 2Q0RA 2PFOA 9ICGA 4EBCA 4QWBA 5AQHA 1QVGM 4TURA 4BGDA 2QW9A 2YX6A 3TU5A 3T69A 3MR2A 4R65A 2HOEA 4A57A 1LCUA 2PAVA 2DPNA 4FVUA 4H5WA 4YD1A 3RAXA 2NRZA 1NJXA 5KFLA 3EO3A 3VGLA 4B1ZA 1HUOA 4ED8A 3JPSA 3CJCA 4FWPA 2ZJRL 2BQUA 3A5OC 4DQ8A 2ZTCA 3FZLA 4KLSA 4KN4A 3KVGA 1U6ZA 4JKEA 4ILJA 5J0WA 4RNNA 3HWTA 3ORYA 7ICVA 3UKRB 5EWEA 1ZQPA 4ECXA 4PHPA 3SAHA 4PHTX 3BUZB 4Q8EA 5KFTA 4KLTA 4F91B 3GV8B 4YOXA 4ELUA 4UAWA 4BVOA 2EWSA 1KXPA 8ICXA 2YJEA 1ZQJA 9ICWA 3O9QA 4B9UA 3C7NB 1NWKA 4A5AA 1E4FT 3SLCA 4YR2A 3IUCA 5KQDA 5EX5A 3UXNA 3C6HA 4QZGA 8ICMA 5IIMA 2ZUDA 2WTFA 7ICSA 2ZJPL 4I2JA 1WUAA 4DSKA 4IWVA 3FGUA 5C2FA 5GIOA 4KMUA 4KLQA 1ATNA 4RU9A 4TQSA 2WBNA 3VEYA 4ED1A 5TZVA 1HX1A 1XWLA 4RNMA 4F2SA 3FE1A 4C8NA 4BXOB 5BRFA 2P9IA 3PV8A 1KAYA 1X9JA 9ICPA 3AU6A 2I7PA 5DDYA 3O5BA 1X9WA 5JLFA 1W97L 1N8RO 4Z6CA 1NGFA 2IIRA 2IBKA 2E1ZA 3VF6A 3H1QA 4BRIA 4H5VA 4F5QA 5AQGA 5AQWA 3PO5A 2P9PB 2W40A 3AAQA 2UVWA 4AM7A 4Q43A 2HBJA 4ISEA 3DWLA 8ICKA 4M04A 1SKRA 3TPQA 4WFAL 2V51B 4B9NA 3R8EA 4M6WA 3HM8A 2NRVA 4Z6EA 4ED3A 4DQQA 2ZJAA 5JMVA 1S0VA 1H1VA 3ULEB 4A61A 3SV4A 2ASDA 4K25A 5HMMA 2E2OA 4RQ8A 4WFBL 4MF8A 3UQ0A 3DJCA 3BF3A 1KFSA 5BR9A 3SAFA 4RUAA 5J2IA 1NGDA 3KWGA 1JN3A 4DSLA 4M63C 5HHHA 3VEZA 3V6KA 1IG8A 4MEXA 3TARA 3QB0A 1T6CA 5EWFA 3PIOL 2BCSA 4RPZA 1NGBA 4KLHA 2HF4A 3ZDBA 4FWRA 3S41A 4PL7A 3D2EA 4BRCA 2VANA 4DOAA 3RB0A 3SAGA 3GFKB 3L0QA 3LWMA 2P9LA 4CZLA 1WCNA 5IINA 2QWOA 4NLCA 2D4WA 4JK1A 3KWIA 1WOQA 2J4RA 5KFCA 1NGJA 2E2NA 5M1KA 5KFUA 2XCAA 4DLGA 1L3VA 2PFQA 4XH1A 1BGXT 4JKCA 3L4QA 1JJ2M 5J0OA 2F1JA 1TK0A 3OHRA 4DHYA 2RDIA 4JN4A 5J2JA 2A1JB 2GWSA 3UXPA 5AQMA 1HJOA 4DFMA 4BREA 5CR4A 1BPBA 4H0PA 4R63A 3QFPA 1BG3A 3AARA 1NKCA 4BR4A 4O8KA 3M6GA 2AJQA 2FSKA 1L3TA 3RAQA 4UBCA 4WFNL 2AA4A 3QBWA 2XY6A 4DL7A 8ICWA 2H3GX 2C2RA 3NVMA 3ENOA 2NRHA 4P4OA 4BDPA 4M9NA 3BQ2A 3MX5A 2CH6A 3O9TA 4B1UB 1TAUA 4LVSA 5KT7A 3VTHA 2DPIA 4H5RA 2W9CB 4F5OA 3HW8A 2OTJN 1U2VA 1Y64A 4QZAA 1BPXA 4DCHA 4JKGA 4YMNA 4DFJA 4FOIA 4NLZA 3GOIA 4WQ4C 3JPQA 1YAGA 5J2GA 1SS6A 2BKEA 3WXMB 1S0MA 3RJHA 1NK4A 1MC8A 8ICAA 3OGUA 4WYBA 3TTDA 3SJHA 1SZ2A 1Q7YO 1LB2B 1KQSM 5AQNA 3PX6A 1OVYA 3RRHA 3I33A 3PW7A 3OJUA 2HHTA 4WQ5C 4UB1A 9ICXA 4AM6A 1VQ4N 3BQ0A 5L1KA 9ICEA 1S0OA 1VQMN 5BPCA 4ED0A 4J9NA 1W2BM 2HF3A 3LL3A 2NRXA 3EYZA 4ELVA 4GC7A 1Z00A 3HOSA 2Q2RA 4O0IA 4JK9A 1QZ6A 2OWOA 2C28A 1BA0A 5F9NA 1SQKA 3CXCM 3EW9A 4H03B 4K4HA 4NLBA 4IO9L 5KFZA 4ECYA 2VWBA 4NLNA 2GUPA 4BRPA 4BRQA 1XSPA 5KPRA 3R1XA 3DXKB 2BHNA 4KLMA 4UAYA 3CIPA 4LZGA 3CMEN 2KZMA 3ENHA 3RTVA 9ICTA 1RDWX 2FSNA 4XH4A 4C8OA 3G6YA 3NMUA 4I2HA 5GIPA 1NK0A 3MR5A 5JLHA 3AGRA 3IFRA 2NRTA 4JKBA 3F5TA 4O8UA 5IIOA 4KH5A 2P9PA 3ZEUA 1KTQA 3UKRA 2VGNA 3VENA 4P4MA 4YP3A 2JZBB 3PVXA 4YXMA 4DQPA 4M9HA 4WQ5A 4KLJA 3C5FA 4TUPA 3O9RA 3KHHA 3A8YA 4F2RA 5C15A 1QVFM 2RE2A 2A40A 3JPPA 3RR8A 1ZQLA 2Q1NA 1GLCG 4C23A 3GIIA 3CC7N 5E26A 3CCQN 4MFAA 3VTIA 4JHDA 1P90A 3KTQA 7ICUA 4BC4A 4FWQA 4DS5A 3MGIA 1N48A 3EE8A 1TFRA 3AY9A 1J6ZA 8ICYA 3O8MA 3HSCA 1VQNN 3MN9A 5KT5A 1ZC6A 1RYRA 5KG5A 2FLNA 4RPXA 4DLEA 3RJIA 4ZH4A 5KTQA 1YXQA 1ZBSA 4IO8A 3JPNA 3JPRA 5DB6A 4DL5A 4BXOA 3VEXA 1K1QA 5J2HA 3MGHA 3HZ6A 3VEVA 1BVSA 5LJVA 3RRGA 3RJGA 8ICCA 3RBEA 5AZJA 5IIKA 3H4DA 2QA4N 3QE9Y 1RFQA 4KBOA 4JWNA 1U4BA 2AQ4A 4NY8A 3V72A 1Z00B 1JXEA 3Q7BA 1HJPA 1UA0A 7ICRA 8ICTA 1C7YA 4O3PA 4BR9A 2GEMA 3ZETB 4E1JA 4BR0A 4TUQA 1KFTA 5JVGL 1S97A 4NXZA 2BQRA 3MMVA 3CF5L 4EFHA 1BPZA 5ELZA 2W9BB 1V9PA 1KC8O 4JKHA 1VQ5N 1KLNA 5CE3A 2BGWA 3LDQA 3E9OA 5KFGA 3HP6A 4IOAL 2HW3A 1S77D 3I56N 4BRKA 4M9LA 4CI6A 1Q81O 4BGBA 1QTMA 5F0XA 4DL6A 3E2EA 3BDPA 2P9KB 2DPJA 4L3QA 1YJWN 4Q44A 4J9KA 1KAZA 3TSQA 3T5KA 5M1OA 2ATLA 3ZDDA 3VF4A 5C5JA 4FBUA 2IVNA 5AQOA 1IXRA 3QFUA 1U49A 1NLVA 5J2EA 1EQYA 4FPAA 2P6UA 4YOTA 3H3OB 2I9GA 1ZQUA 5J0SA 3A0IX 2W9MA 1H38A 1CZAN 3PMNA 1BU6O 9ICQA 3IHQB 1L3SA 1V4SA 3VGKA 3GV7B 4WF9L 4KLFA 2AP1A 1ZQEA 4KN7A 1ZYQA 5FPEA 1X9SA 1L5UA 3QDKA 3JXUA 2P9UB 4F9OA 3E66A 2VYPA 3H45C 4BRAA 1DGKN 3N4QA 1NK6A 1U48A 2R8KA 3CQYA 3WEEA 4KLIA 4YQWA 5CHGA 4J9RA 4XUSA 1D8LA 3V7LA 2GELA 3W3DA 3V7JA 2ALZA 1NM1A 1ZXOA 4B9LA 2GX9A 5DLFA 4JV2A 1UA1A 4BRMA 3SBGA 3ID6A 4IFEA 3Q8SB 1QQOA 3MABA 9ICJA 3RB3A 5AQRA 2A3ZA 3K75D 4DOBA 4I6MB 2FPKA 4MFFA 4Q8FA 2JEJA 3RJKA 2PXIA 5DM7L 3UQ2A 2HBLA 1PZNA 1DT9A 2Q0UA 4MO5A 3HX0A 3GV5B 4QZBA 4JK7A 1Z05A 3KK7A 5CJ7A 3OSPA 4UB4A 4R79A 1KEJA 1ZQNA 1NGHA 2ZJ5A 3VEWA 2BDPA 3ZDAA 3K4GA 1Q86O 3FYHA 4J9OA 3RR7A 2HSTA 3ID8A 3O6WA 4F4XA 3B8AX 3V6HA 2FPMA 3QBXA 4BRDA 4G9ZA 4JKFA 1CUKA 2A5XA 2IMWP 3TTFA 3LDNA 2BH1A 3L4IA 9ICBA 1Q18A 2HBKA 4PHAA 4I2EA 5DM6L 4GXIA 5M1QA 4YORA 3V7KA 4QWAA 3RH6A 3RBDA 3BQ1A 5KT3A 1K1SA 7ICLA 1T7PA 4YMOA 3THVA 4TQRA 3D2FA 4IR9A 3O1WA 3H4BA 2ASJA 1ZQKA 2GTDA 2I7NA 1SZPA 1YI2N 8ICHA 4RQ6A 4DSJA 5KQ8A 4BC5A 4I2IA 1X3MA 3HT3A 1TVAA 4Z6FA 3MCPA 4MLHA 3CERA 4ISFA 4YG2A 3E1YA 4JHDB 4CZKA 2KN7A 3LK9A 4NM1A 3I8BA 5CP2A 8ICSA 2QWNA 4BR5A 8ICJA 4JV1A 2RHKA 3DXMB 3CPEA 2ISPA 1BPEA 4QWEA 4IRKA 4NM2A 5BREA 3RB4A 3P31A 1MSWD 2ZGZA 1S3XA 3VETA 4M47A 2P9IB