2NSLA

E. coli pure h45n mutant complexed with cair
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
b'PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSANRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase catalytic subunit
publication title N(5)-CAIR Mutase: Role of a CO(2) Binding Site and Substrate Movement in Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 53
structure length 162
sequence length 162
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2006-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2nslA00
3KUUA 4Z7JA 2FW9A 4AY3A 2FW6A 5CLIA 3ORSA 3RG8A 5CVTA 2FWIA 2FWAA 2ATEA 2NSJA 2YWXA 4ZK2A 5CLHA 4YCBA 4ZC8A 1U11A 4YCCA 5BOSB 3OPQA 2H31A 5BORA 1D7AA 5CLJA 4JA0A 4YCJA 2FW1A 4AY4A 1QCZA 2FWPA 2NSLA 3TRHA 1O4VA 1XMPA 2FWBA 2FWJA 5C5DA 4ZJYA 5CLFA 4ZMBA 5CTJA 5CLGA 4B4KA 3RGGA 5BOSA 2NSHA 3LP6A 4GRDA 2FW8A 4YCDA 2FW7A 3OOWA
chains in the Genus database with same CATH superfamily
3NTQA 4PHGA 1N7HA 1CTQA 1PR1A 3TKLA 4LJKA 3WK9A 2RHJA 1NGSA 1BSVA 3DVAA 5AMXA 3RVPA 3LC7O 2O7VA 1PQPA 3ET4A 3L6EA 4INJA 2YWHA 1KQOA 3I5MA 4P7GA 4PYIA 3VMFA 1HKHA 1VL5A 1Z4LA 3N1UA 3ZV5A 3E7WA 4E94A 4KUHA 1RCUA 1K6XA 2B6NA 4M1QA 1CRLA 4F7WA 2Y27A 1E6EA 2F3QA 2Q6OA 4O4HF 2FZLA 3B3GA 4RFLA 2CN1A 1W88B 3DXXA 3AYZB 4LUCA 4WLFA 3MCVA 4DADA 1GPMA 1Q0RA 2BDUA 1B0UA 2I76A 2AV6A 2O5RA 1B73A 2N75A 2PBFA 1IUOA 1KH1A 3GVPA 4NE2A 8AT1A 3PE4A 1RIIA 3AGQA 4MQ4A 5F77A 1JEQB 1VG0B 5GGXA 1FDUA 3I6ZA 1V1RA 4MRMB 2Y99A 3ZHTA 1WDKA 3GP8A 3CUVA 5DMHA 2IYYA 2JF0A 2O19A 1TM3E 2R1VA 4FE3A 4J43A 4R2LA 4QJBA 4F3CA 2M1ZA 1Z22A 3SHVA 1DKRA 1KQ3A 4PANA 1BCRB 3B3QA 3KT0A 4WACA 3L41A 3QK7A 2ZGVA 3QVKA 1FP7A 1L0BA 5TS2A 1IY8A 1YHYA 4KWEA 1H1LB 3FZGA 4F2WA 4I7EA 5BP7A 3PRJA 3PKIA 1O5OA 5G3YA 4EDHA 2BISA 1DAPA 1J56A 1AUVA 5E9JA 2GJ8A 3STVA 4WA8A 2ID7A 4X97A 1EDZA 1T36A 2CJXA 3T12A 3NTUA 4BFVA 5DB4A 3UV3A 1WXFA 1Z36A 5D3ZA 5M5BA 1UXGA 2FMHA 2QUJA 4Q9JA 1UOOA 1PAUA 4KQHA 3WI7A 2NO1A 3R23A 1YQUA 1PK9A 5EXPA 4A2QA 4KH0A 2D06A 1JAYA 2OP1A 4S1PA 3B9PA 1L1EA 1QH8B 3EGDA 3S1AB 1F6DA 4KNWA 3PTLA 2Q6IA 1P0IA 4BNWA 3E7FA 5ED4A 1IJKA 1TAHA 2DP4E 4IZIA 3UWSA 5K0SA 4QUGA 4FYPA 1AUPA 1EP2B 3H8WA 2IYNA 4O4LB 3EG9A 1FRQA 3R3ZA 3CV3A 3IUJA 5AKZA 2FEOA 1DCMA 5FPPA 5B4VA 2A1UB 1PJ3A 2H65A 4JU9A 3W8RA 1MRSA 3Q6NA 4B82A 1G8FA 4P3OA 5FH9A 1Z6YA 4YEDA 5CDFA 1YKFA 3SJAA 3ONDA 4ND2A 3MLEA 1OBVA 4XM2A 3B60A 1A2BA 1D9XA 2X13A 2YVAA 1L8LA 1D2RA 3GFFA 1Y7TA 2ZSBA 5IULC 1QZZA 2BGUA 5EYPB 5C8YF 4RTLA 4KFCA 4TQAA 3RC2A 5JQGF 1GPBA 1Y9DA 1XKXA 1MO6A 4QQNA 2DWQA 2QWXA 4QOHA 3V6MA 1IXYA 3VGPA 3HR7A 1HDCA 1OI7A 2XYVA 2OFWA 4Q39A 3RUHA 3GJ4A 1IHPA 1BO6A 1RYYA 3GELA 5KU7A 4YJDA 4BBAA 4WOKA 3PVSA 3BHNA 4EVQA 2B1JA 2IYEA 4G5HA 4OGKA 4YMUA 4DR2B 3EOAI 3P9QA 2CEAA 4L02A 5G4KA 4KV9A 3RREA 5J2TF 2ATCA 2CHEA 2GCOB 4XRRA 1M1ZA 4UCQA 3WLPA 2FSGA 4WK2B 2HA4A 2IDMA 3VKVA 5HILA 2D2VA 2ECQA 1H3NA 3ZHSA 2XTMA 1J0BA 1QRTA 1TQ8A 3KQHA 3OBBA 1FYWA 3RVMA 2O3QA 1NYRA 3WGQA 3CPJB 2R8OA 4RY9A 3IP1A 1XLWA 3CR3C 4QU8A 5FA8A 2YWXA 3AR5A 3LM8A 3GG9A 3GHHA 4ASUA 2PGLA 2HSZA 2IDJA 2C4TA 1N3LA 3G0BA 4WXHA 3VBEA 1MV8A 3PEWA 3C8DA 2I1WA 4RO0A 2CLMB 3I61A 1WXWA 3V32A 3GXBA 2HJSA 5A3QA 2J0UB 1Y4DE 2X14A 3SIWA 3JPWA 4FDLA 3VRHA 3AUSA 1U9IA 5BQFA 3LG2A 3LD9A 1KJYA 4C2AA 1DJMA 4CFYA 3CEAA 2V7GA 5F2OA 4RELA 4F9GA 4X44A 4MUAA 3MJVA 4ZT3A 4AY5A 3T1TA 2MJLA 4FT4A 4BTLA 1PW7A 2O7QA 1MVOA 2GAAA 4IX1A 1GYQA 3VYSB 2VC2B 1Y1RA 2XNDD 4LI3X 2J6IA 3GJXC 3EC7A 3JWHA 3ESQA 3TW0A 4C43A 5H3CA 1B6GA 5FF9A 4EARA 3U4QA 2YJ4A 1IEXA 3OT5A 5CM8B 5FEMA 3STWA 4U39A 2JIZA 2BFFA 4D6PA 4CUJA 5KWSA 5J1TB 1CF9A 1JHZA 1RAIA 1JDNA 3AI1A 3L7CA 1A5SB 5H81A 3CJRA 2B78A 1P81A 2I7DA 1PZGA 4MZDA 1ZA2A 5C5IA 1Z2PX 4MYSA 4RKYA 1PJ8A 4P92A 3ROEA 1XZNA 3VPCA 4U6QA 1AGPA 2PJUA 4FYKA 2HJVA 4UJ5A 4RVUA 1DRWA 4G8CA 4MCJA 2XNSA 3COVA 3KXKA 4ZTZB 3QUTA 3I5AA 2Y1DA 4ETMA 1RPAA 1J2JA 1NPTO 1CJTC 3PPXA 2R4TA 3COYA 4DKXA 5ED0A 4E3WA 5AVRA 3LWDA 2CHGA 5FL7D 4NBTA 3ZY4A 1W5TA 1QYXA 4JODA 3RT9A 4H2DA 1MW8X 3L1VA 3QMVA 5DTQA 2PUBA 5K6AA 5BMVA 3UFBA 4X7PA 1Y3BE 4R9VA 4U2GA 4CKYA 5IDYA 2C9DA 3SAJA 4ETNA 3LCVB 5ERGB 2VO1A 1WXIA 2G0TA 4U4AA 3S7TA 4HDSB 1XRNA 4H9GA 1ZNYA 4WOBA 2A3NA 3LUHA 4U2BA 3UMVA 4AJLA 2ZJOA 4QDTA 1RPZA 5J1SB 5CFPA 1C7FA 1GXSA 3LCCA 1N78A 4X7BA 1UF9A 1C7IA 5DULA 1VLZA 5JWRA 3LV8A 1ECLA 1PT9A 3AWIA 4N39A 1MZPA 4F84A 3FOWA 3D5TA 1OWNA 4IXWA 1JRLA 3GQBB 1I3OA 2VHVA 5E95A 1Y9EA 3CE9A 2BMDA 3DKIA 2BHLA 5KYWB 2ODPA 3TUZC 4YLYA 2NZUG 4A8TA 2REOA 2O2GA 3WJ7A 3I6MA 3WSTA 2ISCA 3IR5A 4A92A 3JQFC 3MJDA 4LMAA 2F3PA 3L4JA 5FUWA 4DCUA 1PT7A 3TSOA 1P19A 2JA2A 5C1IA 4X85A 1QZXA 4YQZA 2XA2A 4JLAA 4IG4A 2BGKA 3RIMA 2J5QA 4E51A 3PBKA 1O54A 4EPWA 3D4BA 1QFXA 4PWYA 4E0BA 2G6TA 2DT5A 3DNFA 5F1OA 2FI1A 1ZVJA 3BH7A 3AF1A 4TXLA 3PWTA 2R6AA 1UK6A 3PR2B 3OZWA 2WZQA 5FOTA 5I4KA 2E6KA 3FTFA 1N2CB 4KDCA 3ZD8A 1ZOSA 4RJKA 3CRRA 4MHSA 5KX5B 2F8LA 2JASA 3OQNA 1HZZC 1ZYUA 4MS3B 1TX4B 5C8DA 5L8VA 3KP1A 1HE3A 2BFNA 2PTHA 2A9JA 4PG5A 5GZ6A 3RBAA 4LWZA 4MJ7A 3HPRA 4H60A 2FJPA 1URPA 3ITDA 5DYYA 1IWBB 1CBUA 1UUFA 4WJLA 3BL8A 2PZBA 4NU0A 1K2WA 1RCFA 4JGIA 5AJZA 5B4UA 1ZRHA 4PX5A 2Z08A 1G6HA 1P4SA 4OBWA 3EPPA 2XCSB 4RAQA 1MENA 2A0KA 2NZYA 4NF2A 3ZWWA 3TCNA 1FTNA 4DLYA 2XWPA 5KJCA 1J99A 2A9FA 3KT3A 4TMZA 2R6HA 4P4LA 3B3AA 3W5UA 3ZE1B 3TQRA 3GL9A 5KSOA 2CFTA 5TR9A 4E5UA 1U99A 1KR5A 1QG4A 2PL9A 4HLDA 2J6BA 4YBRA 4LOIA 1P29A 1QFZA 1KDTA 4GDMA 4KE9A 4NHOA 2VXBA 3D7SA 4Q3CA 1K4MA 3GEMA 3FUTA 4BO1A 3E5RA 1CDZA 4EW2A 4CIWA 4QYXA 5LZ9A 1A72A 3R5KA 3WHLA 3DAFA 1GPJA 4GU5A 1ORRA 2GTPA 4ALKA 3EG5A 5BQ3A 4V1CB 4KFSA 4DARA 3D0KA 3EQ2A 2HPHA 3RWMB 2B3TA 1QV7A 2FDXA 5AVXA 1SXJC 3LLUA 4MRAA 3JQGA 4TUYA 4RK4A 1E2IA 1SG6A 3GFGA 4DNXA 1SUWA 4DJDC 3BHIA 3W6PA 2B8NA 3CF4G 3H1BA 1JMYA 3LUJA 4FC7A 3DKPA 4B0OA 5LP6F 4J49A 3PQFA 2WYHA 4UCWA 3QVJA 5I4IA 3P9ZA 5BSWA 2OZLB 3DS8A 4N8SA 3IUEA 4WESA 3ZE6A 2AYYA 4BGVA 3NHYA 3PQEA 4PNPA 4BLQA 4XOIA 1N0HA 5IS2A 2QMEA 1FP4B 3T9CA 4BWGA 2XWQA 1GGJA 3KKNA 3IEUA 4WA7A 1RSZA 2AZXA 1N9GB 2O8CB 2PUVA 4GBED 4EWLA 2WKWA 3V1UA 5FUVA 1P2FA 1L3IA 5DBOA 1IJBA 3F6CA 4J4TA 2X2PA 3NWEA 4XTRA 5BUZA 1P1CA 1YZLA 3DE6X 1X80B 5DI3A 4A73A 1F8YA 2PX0A 2P8JA 3HDVA 3VHRA 3EQ9A 3R7LA 4DXAA 2JZOA 1UEJA 3D3WB 4Z9XA 2A35A 5FIUA 1E8MA 3N2GA 2ILTA 1XTRA 3LXRA 3THRA 3QX3A 1U9YA 1NM5C 5F5XA 1C9DB 2VJLA 1L8XA 1JHMA 1T2CA 1AB6A 3QRWA 3LECA 3MGCA 2QN1A 5A3RA 5C7IO 1G17A 1GQOA 3UMSA 1U9CA 4W7IA 5DYIA 3MSCA 4LTNA 5E8RA 5EXTA 5LD2B 1OLXA 2HRBA 3QLEA 3CM0A 2YXLA 4XR4A 3PDWA 3DE0X 3N6RA 5LQKA 4GEGA 4S1OA 4LXXA 4OMUA 4AKHA 2V6FA 3B6ZA 3NHFA 3OZIA 5IXJA 4KRGA 4OATA 4OQFA 2BMEA 3RIXA 3ORYA 2W9XA 2E18A 3MGKA 4DB4A 3ISJA 4I2VA 1C0LA 2P1RA 4IDHA 1ZN7A 3U7EB 3DYBA 4KDEA 2X7HA 3VH4A 3U7FB 2JANA 3M89A 4HQRA 3D1VA 1YVEI 5FEUA 9LDBA 3JQBA 1VDMA 1GPDG 3LWZA 1DPFA 2OCXA 3JSAA 1X7ZB 1CK4A 3V7FA 3GROA 3K1AB 1BHJA 2F3RA 4LXYA 3WYCA 1M73E 5AESA 5IDWA 2ZJAA 2I4NA 1YHNA 3B53X 2CLFB 3GLIB 1M34E 1FP1D 3O94A 1IPHA 2O8FA 3LPNA 4RJJA 4ZV7A 4G8BA 5LYJA 4BUCA 2WAMA 5HG0A 3ZTWA 5JNUA 3Q3GE 1Y4UA 1IRIA 4D74A 1JX6A 3M6XA 2JJYA 3FBTA 3MLAA 1RI5A 3D6NB 3G8DA 1XELA 1ZISA 4MRRA 1ZM3A 3AL3A 4FEEA 4IHAA 4B7AA 4D9MA 3TRFA 5HS4A 1AMOA 4PQGA 4UULA 3JZIA 3UFXA 3KBOA 1D6SA 1G5RA 5TS3A 3I5XA 4KGDA 3A2KA 1Y6RA 3OWHA 3GVHA 4FMDB 1G5HA 3R3XA 2E5LB 3UJ6A 1XRQA 4YAEA 4QULA 4QM6A 3T5AA 4ML3A 1FK8A 3RR2A 1Z7GA 2O8DA 4UNQA 2W0MA 3RQIA 3OZEA 4G1FA 1ZRMA 5KOJA 1XXLA 2ZE6A 3WHIA 5JH7B 2IVZA 4B4DA 4U2EA 2QQ5A 3W5DA 1ZD8A 1Q57A 2OLJA 3JQ9C 2XKKA 1FOEB 1PSWA 4GYYA 4RF2A 13PKA 3IE0A 1FNBA 2PU5A 4ZZ2A 1ULUA 1AK1A 1D2AA 2J3HA 1QS0A 5BT8A 1W36D 4YJ3B 4HEJA 4OHXA 4YASA 2WM2A 3ND5A 3D2CA 4XCQA 4O5OA 4WOCA 3R0IA 1T5IA 2C3MA 2ZYDA 3DTTA 3K6SA 2DPMA 2EJWA 1KOLA 4L8WB 3X1MA 2OLKA 4GGPA 4M2LA 4R8SA 4JLJA 5CG1A 3WWZA 7MDHA 1W49A 3TTVA 2EJTA 2DU8A 1AKWA 2DUWA 4N5HX 1BH2A 2WT4A 3YASA 3MJTA 4E1VA 4AJPA 2Q3MA 4EW6A 2GESA 2G83A 4JASB 4OQMA 4WKBA 4UU1A 1WDMA 5THXA 1KDOA 3UYLA 4BLOA 5EJ8A 5HHTA 3FKSD 3KZ1E 4OJMX 3KKLA 4EY5A 3AHFA 5E6RA 4G5XA 2IEAA 2JIQA 2A5JA 3MAGA 4IQ0A 4ZOAA 1OTHA 1R16A 3I9OA 4HATA 3DLTA 1HM5A 4FFWA 4LOJA 1MN6A 5ALMA 5BV8A 3NX4A 1JHVA 4X65B 3AF6A 1KPHA 3BWYA 1M2OA 2YXBA 1V47A 1ZMTA 2H4XA 5CDUA 5I3CA 1YFLA 2HW8A 4Y6LA 5IF3A 1FRNA 2XUKA 3HKDB 4XWYA 2ZYAA 3UMYA 4YAGA 1M54A 1DG3A 2A94A 2QSYA 2WP8J 4KKVA 3KKMA 4FB5A 1CUYA 5CIYA 1SHUX 1XALA 2P1DA 2XMGA 4ROTA 1ODSA 2ONCA 1BS1A 2QPOA 4K8OA 5CVUA 4RIHA 2J7KA 1JXMA 2PEZA 1NVFA 4DV2B 4QJIA 1RBZA 4JC5A 4A0RA 3GD5A 2JW5A 2PUAA 2PY6A 3TYXA 4BXOB 4OI1A 3ULKA 2FR1A 4Y2XA 3MTQA 2H31A 3T3DA 1QP7A 2PQ0A 3VTZA 1HYBA 2VYCA 4RLSA 2YWCA 1IHOA 2P69A 5JRJA 3HA3A 1AUQA 3DOHA 2DKNA 2W2PA 2Z1DA 4I5DA 1CF2O 3FNEA 4JCOA 4LAFA 3E8MA 4UOQA 2RAUA 2FZWA 4UZSA 3U19A 3RADC 3ZV7A 3Q2KA 1KZ9A 3ETEA 3W77A 4O8CA 4ND8A 2IK8A 1IVYA 5CYFA 3DFMA 3OOWA 4TMFA 4AT1A 4R68A 5GY7A 1OX5A 4R9SA 4NONA 2DTDA 3KQLA 3P9RA 4ES6A 1WCV1 4YCLA 4MJXA 5HQ3A 1Y6GA 3O1LA 3VJMA 3H65A 3M9XA 4N6OA 2GD6A 2P8SA 2QLNA 4OQLA 5ANRB 1TA9A 1VCIA 2G77B 2PIDA 2J5KA 4Q4HA 2HZ7A 2KX7A 4MKHA 1GR1A 2GZ2A 2MIIA 4NICA 1JG7A 1P0CA 3O2SB 3ZK8A 3IDZA 2XQJA 1KI3A 3BMOB 3DBLB 3GJ7A 1QANA 4LRXA 2BLNA 3C43A 4MS1A 2O7NA 4NCJA 2VBFA 4BVAA 4BEBA 3QWHA 1ZL0A 4YQEA 1Y1PA 3F9CA 4ZO7A 4TKZA 3ESZA 1VHQA 1CB7A 3H13A 4RE5A 3Q40A 4AG6A 1MQAA 3FJ1A 5HOEA 2OTCA 4BFXA 3PK0A 1ZG3A 3EPLA 2GPBA 1ES9A 1JXAA 3LRTA 3TLAA 3OJWA 1RDFA 1HORA 2IUUA 4M6WA 2AB0A 2GEVA 4F3NA 5CH5A 3V2HA 1CR6A 5AW0A 1RLOA 1W9MA 4AYTA 4I1PA 4TV8F 1E6CA 1FYDA 5E1OA 1QBKC 2HMSA 1MF7A 1U0EA 4LDZA 4V03A 3WADA 6NULA 2DEUA 4CLOB 3TTSA 3BHJA 1IBRA 2RH5A 3MWDA 4V0LA 3TTTA 3HCRA 5GIPE 2E0IA 3NTVA 1G20A 3ZY5A 3VH1A 5JSZB 3IXLA 5C8YB 1F7VA 2GPWA 1QIHA 5EHIA 1Y8RA 5CCDA 2E5FA 3EC2A 4R5HA 4DA6A 4O29A 4NBNA 2FSIA 3AETA 4DB2A 5JISA 4I9HA 3I6YA 2IHYA 3H83A 5BW6B 1KL7A 1SJ9A 1S4QA 1U98A 4LKOA 1U9IC 4D8XA 4L15A 5K01A 1AS3A 3A31A 3BOSA 2OG2A 4BNXA 4Y6RA 5JAOA 2Y2VA 2IYXA 3RUIA 5AI6A 3TKYA 4RULA 1BGXT 3A14A 2YNMD 3NLLA 4LOAA 4MV9A 2PLRA 2Y3IA 5DYWA 4AG5A 2C2MA 4TKLA 5C1PA 2AS0A 1UT6A 4FOTA 4QUKA 2Y93A 4OUKX 3EVCA 3QE2A 1NF3A 3F6PA 3LPMA 3KZCA 3S2GA 4NCIA 2MSEB 4FLFA 4KUGA 1GTL1 2C9BA 3AXSA 4M88A 1OBFO 4WBXC 3AU8A 1V41E 1RI4A 2EGGA 1DI0A 2J3KA 4IGIA 3EIXA 3WYAA 3DE7X 4B7UA 1ZKMA 3N9IA 2HCRA 5IFLA 5J4LA 3OT4A 4HX9A 3U56A 2F9LA 4AY3A 4FDMA 1S3IA 2VAPA 4Y3UA 3TUJC 3PDIB 2CMGA 1M8JA 3FFAA 4JSTA 1XWFA 4OQYA 5AI8A 5IK2A 1XEXA 4KQ9A 5EL0A 5LU9A 4L2IB 5ADHA 4YMWA 1JEQA 1E2PA 1X3SA 1UBUS 3KVRA 4W4TA 3DFIA 1JHDA 2AF3C 4I1YA 4HJRA 3I58A 4M0FA 4I1IA 3AONB 4OJNA 3RUAA 4LF6B 3F6RA 2N42A 2XNJA 3IP6A 5KC8A 2FX5A 2ZJ5A 2C1XA 4DSZA 2JFVA 3IC5A 4KPUB 4XUCA 1BN7A 1P6UA 5K6AC 5DWVA 1XTPA 2TMGA 3A1TA 3LP6A 5A4DA 3W5CA 1L5NA 2GK4A 1CZUA 2GXUA 4UATA 3WWPA 2ZTUA 2I4RA 5D6NA 2VEOA 3FM9A 1M8GA 1R10A 3AIIA 2O06A 4HWGA 1OXVA 3EIUA 3R75A 1EUCA 4MUKA 4NECA 3DL0A 3V7NA 5C0OE 1SVNA 1R9GA 2DSTA 3MTGA 3RIHA 1FYXA 4RPLA 4J03A 4K6FA 4U02A 1SMKA 1ISMA 3EFEA 4NX2A 3Q3CA 4WIAA 1JKIA 4QLBA 3BSFA 5F35A 4PCLA 5BV7A 1Q91A 4BE4A 3AM3A 2P6RA 3DWIA 2A59A 2FPSA 3EH2A 1IB6A 2G82A 3BSSA 4HN4B 1GUDA 4RVNA 2QEQA 4YP1A 4CM8A 3EPHA 2XV1A 3WKDA 2JHFA 5AJTA 2AT1A 2VDPB 2X0DA 2F3TA 3TLBA 4O4JA 3V4SA 3K5HA 5GJBA 4IGEA 4O4LA 5JXIA 2IGBA 2OHJA 3DHYA 4FR2A 2OKCA 3A04A 4DV0B 1C81A 2WWRA 1H4SA 2NZXA 2RI6A 4MAFA 3P27A 5HK9A 1WXHA 1RHMA 4GNRA 5AM4A 1XTBA 1NW3A 3LK7A 2W58A 3ZWCA 1FY2A 2EVWX 4ZCIA 5CXUA 3K0FB 4HQ0A 3DOJA 2EDAA 3Q15C 1FDWA 4BNUA 1P7VA 4EVSA 3NWJA 2Q1SA 1UC5B 4HPXB 3AEXA 1LBQA 5TQVA 1RRGA 1YDFA 3QFCA 4TN1A 5EMJA 1N0UA 2PUTA 3CLSC 2BM8A 3OCXA 1XFAA 3AEQB 4BB6A 3A1DA 4KQIA 1H69A 2VJOA 3N0RA 1X7XB 3MD9A 3ZW8A 1LBSA 2WV7A 4IFEA 2W6ZA 2JCXA 5KWVA 1V5FA 1GEGA 2YQ4A 4RC9A 3NW9A 2COEA 3EBPA 4AS1A 4MQ6A 2VRWA 3IPRA 3IULA 2FMFA 3EPRA 1JJAA 4KQCA 3ZY3A 2GCOA 1W2WB 4ZRDA 8LDHA 4GHWA 2B9EA 4HMPA 1P73A 2YJTD 5EESA 3VNUA 2CLHB 2WLSA 1CHNA 1ZDMA 3TXYA 3L6RA 1N6RA 1YA8A 3ZQ4A 4ESHA 1A5AB 4A82A 4F1KA 1P2TA 3ADDA 1CW2B 2G71A 2P90A 1Y8QA 3DONA 4Z6KA 2O54A 4BC0A 1E32A 3BYZA 3M1LA 3EXIB 3R6DA 2IUYA 3EWIA 3U17A 1UOPA 2YN4A 3S8EA 1T5TA 4RCVA 1ZL2A 4LMRA 4FGLA 1UXJA 4X84A 3U3DA 1ZWLA 1YAHA 3A1UA 2J0UA 4XX0B 2M98A 1BXZA 2XBLA 8MHTA 3VR4D 3W4IA 1AQJA 3HCBA 3R0QA 1BXRA 2YZ2A 2FETA 4M53A 1HYQA 4LVOA 1TFRA 5FBVB 5K6RA 4XLZA 2R25B 3HABA 3WGNA 4PC7A 4UOZA 5IRCD 2A67A 4YMVA 4UNSA 2YINC 4N3NA 2ZXEA 2XA9A 4Y98A 1JW9B 3HKBA 3QVGB 2VDWA 1CIVA 2CXNA 2R1TB 1PDWA 4MEAA 3RU9A 1Y7HA 2BSQA 1E99A 1KZ6A 3G1TA 3IODA 3BIXA 3O8RA 2PXCA 4K46A 5AVOA 1LBHA 1KWKA 2B5WA 3R6TA 3CJTA 4QOJA 3SQNA 4EL5A 2ZUUA 4MWSA 1N3IA 1Z6XA 3TWOA 4DIUA 3OCVA 2C2KA 1P60A 2WYUA 4MVXA 1MOQA 3K16A 4OHKA 2W2OA 1PFVA 3KAPA 1RC0A 3DT9A 2B20A 2KB0A 4L08A 1XTIA 5LJIA 1VJRA 2YRXA 4COOA 3DEAA 2BONA 2DQSA 5JLAA 3QE9Y 1J1ZA 6REQA 2BEVB 3T0GA 1FXSA 1U6IA 1JEEA 4J0CA 5G1NA 3T1VA 1IBKB 1DC7A 1MVLA 4DLLA 3HXOA 3WYDA 2IXBA 2QI9F 5LP6B 2ZYTX 4WHMA 2ZITA 3E0QA 1NRJB 2X5XA 2OWDA 4B8YA 4B6EA 1PBNA 3DL7A 5FOUA 2R7LA 3H5OA 3RFXA 2BKEA 4PO9A 4K28A 5L4SA 4K2AA 3PGXA 2VJMB 3OJ0A 1E1LA 4M37A 3GVIA 4C3VA 4HHEA 3HDGA 2ZI3A 3JARB 2G4CA 5FULA 2I8CA 3PA6A 2YWJA 2B69A 1ZH8A 4KQFA 1K9SA 4Q4DA 3LQ1A 2WJPA 5I7FA 1Z6GA 3F5SA 3HDJA 4NENB 3HYTA 2H3HA 4Q3BA 3BQMB 3JQBC 5FO0A 1PRYA 4MHTA 2V1UA 1DJLA 3EDOA 4P93A 1MB9A 2QENA 4DXHA 4NS1A 2H7YA 2OZKA 1QF7A 1R15A 2NUPB 3G2MA 2DECA 4S24A 1DRJA 1KI1A 3E7XA 4BX0A 2XNHA 5DTEA 3WNBA 3H86A 1AXRA 4N4AA 3RJ5A 5KYWA 1NVWQ 2V3CC 3S0JA 1KRHA 2BKXA 2PT6A 2ZBUA 4RPIA 4EFDA 4N5LA 4TQUS 5ESDA 1MW9X 1F0KA 2M32A 1SD2A 1E9DA 1Q1EA 3AFIA 4CQMB 2FEWB 1HE4A 2E1PA 4EPVA 2I8AA 2UZ1B 3FCCA 1WVMA 1GG5A 3KZNA 2HF7A 3WIUA 4GWLA 3KZXA 4O59O 4C08A 4MB6A 2IZ0A 4EP1A 1ZC4A 3A1NA 1AGYA 1QAQA 3HGTA 4GWKA 2QNIA 3DXYA 1XKLA 2PA0A 5HX7A 5FPQA 5AKGA 3PZBA 3VDQA 2P6OA 3IP5A 3RRFA 4LZZA 2PVPA 3OKAA 1XEFA 2V7XA 3NWPA 2J3DA 4FT2A 2XUQA 4GOKA 2WMNB 5FR1A 2QNBA 4E07A 4B3XA 2C2HA 2CNKA 4OU4A 5AVYA 1XEAA 5BNWA 1I24A 3O5AA 1S1MA 2FSVA 2NPIA 2I6QA 3DW3X 2TMDA 5JARA 2PZJA 3GGPA 2UAGA 4NV1A 4QT0A 5DHSA 4H6VA 2HLDA 1K6IA 4ZCTA 2X58A 5ECGC 5DTMA 2GS9A 4EA7A 4XLTA 4OLFA 2QN7A 3CB2A 1I32A 2I8LA 1ECJA 1N1GA 1Y9JA 3K0BA 3D5EA 1RYEA 4R9NA 4NCBA 4YRGA 2BF7A 3FHLA 1FBTA 1DKLA 1OT5A 4J7CA 3AILA 1RQ7A 1YASA 2FV8A 1UL1X 3BJMA 4OQDA 4LQDA 1PNVA 1TTHA 4GQBA 1K3UB 4JJAA 1MPXA 5LQUA 5AJWA 3C7DB 2PJZA 2WSMA 4GYKA 5HBRA 2BHNA 2CUNA 5LJLA 1LQUA 2HMWA 3E9MA 2B4TO 1WXDA 1RXVA 2I66A 1A0OA 1G8MA 2HRZA 5AJHA 4A15A 4AX8A 1OWPA 1M2WA 5FTWA 4LYJA 4HQNA 3SZGA 1U80A 3UTCA 5AW1A 4FLMA 4H3VA 4RU1A 5K2MA 2CJWA 5GZ1A 1ZK4A 5EEHA 3FOEC 2OZLA 2JGIA 4LZJA 5JG7A 4CN9A 5GADl 1CR0A 1EFPA 3MBKA 3PC4A 4HFJA 1PGOA 3FB1A 5IAKA 4M98A 5FTMA 2FPIA 1D4FA 1RMTA 3AUUA 1ODKA 3L8ZA 3UBMA 3IBYA 3NYQA 1DZIA 4RQUA 1M7BA 3P2JA 1L7NA 3RGGA 4KC0A 4EYKA 4E6EA 1YQEA 3ZDCA 1KKMA 1O6BA 2DHRA 3TINA 2C3OA 4F11A 2FNAA 2WSLA 3TNYA 4GI5A 1SUSA 2JIDA 2VWQA 4HB4A 2H00A 2WF9A 4YVFA 3TOXA 3VJKA 1FLDA 4GOXA 4IIJB 4NMXB 4DE5A 1O03A 3IERA 2W2KA 3AB7A 5CA1A 2YFYA 3HN2A 3EEOA 1AE1A 3I3OA 3HA2A 3KE9A 4QTYA 4CKEB 3KVNA 1W44A 3O7WA 1XAGA 5BSGA 3MWGA 1Z29A 1KC3A 3GBPA 1NKSA 3PG5A 4IVRA 1ETUA 4D56A 1Q77A 1ZUIA 4EF5A 1J21A 3SR3A 4ENSA 4QGSA 1SFRA 2C94A 1T3ZA 4GSLA 5AKJA 3WWDA 1EFDN 4F9TA 3OT1A 2BBSA 1Z35A 3X1JA 1PYDA 3B1XA 1V16B 2EZ8A 4W5TA 2OQRA 2W7TA 1MA0A 3DO5A 4UC0A 3EGCA 4H7PA 4EMTA 4RFVA 2IW1A 2OAGA 3MIIA 4BRZA 2AC4A 2Q28A 4ZEOA 3KWJA 3G2LA 3A2LA 3GLIA 3FHOA 4YDQA 3FUWA 4BQRA 1V8DA 3QP9A 2XDYA 4LRQA 3PWZA 1PJQA 4MGZR 5ES3A 4YAIA 2HLPA 3QQ5A 4S2EA 2BFWA 1JG3A 2O8NA 2O1EA 4HNAA 3WSVA 3ZGNA 4E2WA 3RHTA 5ITZA 5L53A 3TNJA 2IHNA 1RBMA 4R1TA 3TTYA 4E7OA 2A1TS 3BVPA 3EVEA 4LYAA 1VPTA 4C2UA 1WEKA 3HKEB 5IAOA 4YT8A 3BCHA 1ZCAA 2QDXA 2VIIA 1JU3A 1NURA 1Z2AA 2JJ1D 3LQRA 1U3DA 4US1R 1L4NA 1WU8A 4JR2A 1I7QB 2IS6A 2GGSA 5LFAA 1Z2EA 3JXEA 1ZJ4A 1QGED 5LR6A 3GPCA 1E0JA 4LYEA 4P7KA 4H31A 4JYZA 1U0TA 2GB4A 3GRRA 1EWQA 5JH7A 4DUPA 1DKNA 2Z5LA 1II8B 1ESMA 2QTWB 2VBCA 4AB1A 4CF5A 1PQ4A 3P9KA 1YIAA 2ZIXB 2ZS7A 4YJFB 2FUG1 1BXGA 5E0KB 3QVXA 3DPUA 4MINA 3W2TA 1SEPA 3O1IC 1KFBB 1AXGA 4WXYB 5SZKB 1J24A 4RKRA 5COQA 1YBMA 3VSAA 1QRDA 4F12A 3O21A 5KOHA 4U0KA 4OHBA 3UAOA 2JH8A 3O47A 4U2CA 3ROPA 2QE7A 1JR3E 3EEBA 2PIAA 2YL2A 2H1HA 4PYKA 3KLBA 2GN0A 3B51X 3NHPA 3FSJX 4D26A 4HLUA 3ZHBA 4EVRA 3GK3A 2IHTA 3OZUA 4BU1A 4I4CA 3V7UA 3LK6A 4DCTA 2EHDA 2PCJA 4KX5A 1M0WA 4P3PA 5CTAA 5CXSA 1GLGA 3NZEA 1C1YA 2JGNA 3HY4A 2ADOA 3I6IA 4JLBA 1BVRA 1VFPA 2WU0A 2XCIA 3NIFB 1Y6QA 2JGRA 2RKOA 1Q50A 3FLEA 4JU8A 5F9FA 3DHEA 3LTEA 1TUIA 4TSRA 4KP7A 5HSGA 1D8TA 4KLNA 3NOQA 5BN1A 1Q7TA 1ULAA 4PW0A 5JD6A 3HKDA 2X41A 2VYVD 3T61A 3DL4A 1ZUWA 1QIIA 1BS2A 3DLCA 4P2GA 3R9XB 2HQBA 2WSSA 2I71A 4GIBA 1XU7A 2AMJA 4DEXA 1JQDA 3H2YA 3PUHA 4R1OA 5C18A 4MV4A 1C7QA 1MXFA 4MRSA 1OBOA 4IKEA 1O0SA 1ZMRA 3Q10A 4GOND 4NI5A 6ADHA 2KM1A 3RSFA 5J43A 3QX9A 4NH4A 4O4HA 2FWBA 4TXJA 3IV6A 4NU8X 1TECE 3C5CA 1NC3A 3EIQA 4E4YA 2NZ8A 1GSIA 4MPDA 4BNVA 3EVBA 3E3AA 1P1HA 4EY3A 5IVHA 1NV8A 4EBBA 4L95C 3JD2A 4TV9F 5CNKA 2WSIA 4YAUA 1F2DA 1NF2A 4XGNA 3PQ6A 4A0FA 4TL6A 2IYQA 1N6PA 3UGTA 1IBMB 5TLSA 4N41A 1NXWA 1PG2A 3TSCA 4AJ1A 1ILEA 5CM2Z 4KPEC 2HBQA 2AFIB 2QL9A 3C3PA 1EH5A 3OCJA 2EFEB 3LC1O 4IO1A 5EJ4A 4YHHB 2EDCA 2VTBB 3VDRA 2XMRA 2FN8A 1PLKA 4KFTA 5A7HA 3LNCA 5K0TA 4JWTA 1VKZA 1SC6A 4WWHA 1V3UA 1BHQ1 4KE8A 3WTCA 2FWNA 3C1UA 2IEGA 2CJFA 3GLRA 2VUHB 1XLVA 4NG4A 5I9BA 7AT1A 2C5FA 4QFMA 5ADVA 4QEKA 5FBZA 4YC7A 4ZT2A 2DFVA 2PBRA 2DBYA 3OFKA 1NHGA 2GASA 2QSUA 3WLTA 1CP2A 4CYMA 1EFUA 3DQZA 4F1JA 2Q5FA 3UB4A 4JJKA 1ZJJA 3AKEA 5AK3A 4NMHA 6CHYA 3RB8A 4RK1A 1XBTA 5IZ4A 2V74B 3W3AH 3IEKA 3TS1A 4DV7B 2VUIB 4X00A 3O74A 3HYCA 1NTRA 3OEHD 4Y7DA 3TTUA 2PZGA 3GMTA 5K4HA 4N7MA 2QTBA 3KWMA 2UUAB 3UZUA 2C7QA 4V2IA 1XHEA 5J47A 1FJXA 1BNCA 3I9KA 5LUAA 1WUHS 3A1VA 3OLXA 2DE0X 2Q4BA 2R2GA 4WFQA 5ALGA 4J0EA 4KR2A 1M3SA 1U3FA 4AZ0B 4M1WA 4EX6A 2XITA 2H1FA 3OE7A 1N34B 4OL0A 2R65A 5P8WA 3UM9A 4PZDA 1HC7A 1YQXA 3SEQA 4HQOA 3DSRA 5LLDA 4R1PA 2WF6A 2QRLA 3TB4A 2J3JA 5BXYA 2FMUA 1AJEA 4FMBB 5BUSA 1GGFA 4CM1A 2QT0A 2WU4A 1PW5A 2VJAA 4GPTA 5JQGA 1DWQA 1QO9A 4RIGA 3OZ7A 1WPRA 3A05A 3BEDA 2AG1A 3OF3A 3D81A 1PI3A 1DKQA 2ZE5A 2HDWA 3AVOA 1CRZA 2O8BB 3CNEA 1GRQA 2FN9A 4OB8A 4WASA 4HDRB 1Y80A 4PWZA 2YJZA 3KVYA 3K0EA 4Y30A 1IEVA 3ML1A 1NLUA 4ARBA 1WTCA 3SZRA 5CDTA 1O5IA 4MGEA 3LW8A 3WRYA 3K2BA 1X7HA 1YS6A 3PDJA 2WYOA 4JVNA 1RW4A 5J2TA 1S3SA 1T8PA 3KAJA 4ROSA 1R6XA 1V96A 3R0XA 3VUEA 2BLLA 4V0RA 3NEJA 1TVCA 4RM2A 1YS9A 2BV3A 1K8XB 3EXFB 1R4NA 3QOWA 1BCSB 3LX8A 3H0EA 1WF3A 4NK4A 4YJKA 4YMSA 1YB1A 2C7GA 221PA 3NAZA 2HMTA 4O0LA 2J08A 2Z6UA 1TK2A 4HAUA 4NDAA 5H9VA 3LDUA 3OOEA 1GNSA 3MRVA 4M9RA 1TM4E 3GZTB 4PRLA 4Y2TA 2CBZA 3HM2A 2PXXA 2X8AA 5JFOA 4LK2A 1BMTA 1U3WA 2V5VA 2QZ4A 1MEOA 4JMLA 4ZYVA 3OLWA 4BAUA 2JIMA 1NVUQ 1XU4A 2MYUA 3PFBA 4W7HA 4JKIA 2B92A 3B3JA 5HM6A 3LUKA 5LZ2A 4LNUA 5FI5A 1HL7A 5KNLA 2H9IA 4IYRA 2EBFX 4C20A 1MC5A 2B61A 4JFAA 5CPFA 2O6HA 4YO7A 3V5NA 3T9BA 5B3KA 1FB5A 2GBIA 2IE0A 1G9SA 1EJ6A 4U63A 2PGOA 2O2IA 4GMHA 1WHTB 4C1BA 3ZQKA 4LF7B 1IRXA 2XXBA 5F33A 3VR6H 3ZJYA 1HDEA 4EG1A 4MYUA 1EJ2A 1PR9A 4TS9A 5JALA 1XVUA 1Z88A 2J09A 1XCPA 3H11A 3FETA 4MLPA 5EJAA 3TPCA 3T38A 1XD2B 3OPYI 2FB9A 2ODTX 3JASB 2IPNA 2J9FA 2P79A 2VJKA 3MCUA 3NXKA 1C3VA 2Q6LA 4I4NA 4JL6A 3LKBA 1TQ2A 2D1YA 1SZJG 4TTIA 3VO8A 1NU6A 5T8KA 4B47A 1H2YA 3D9QX 1RXYA 1ULSA 1UODA 2V8OA 2VSOA 1YB2A 4KR6A 1X0XA 4BIMA 1UZUA 2FP4B 3G02A 1LW6E 2G07A 3GRCA 4KH1A 4N54A 4MYRA 4DNFA 4EJSB 2JFUA 4GAEA 3TLGA 1MDFA 1JR3D 4GUDA 4UTRA 1C9KA 1VKJA 1KJ8A 1SO8A 2FW0A 1THGA 4IMJB 1UKAA 2JRCA 2ZJ7A 4OXIA 4B74A 3ABZA 3R7WB 1X9GA 4IIDA 3JR3A 4NU5A 4TRRA 4FJ2A 3KELA 1FPMA 4M54A 1AG9A 3G9ZA 1P2GA 3OJEA 1O4VA 4YB8A 1O0CA 1RYHA 1GPH1 1PNTA 2HU2A 4LC1A 1G1MA 3MD0A 3K0FA 5IAGA 1ZJWA 1G3MA 3CPSA 1PFGA 4EG3A 3JWEA 4DIMA 1GU1A 1Y3AA 2H11A 3ZVKA 2PZAA 3HCDA 1Z4IA 2ENUA 3KEFA 1Z5NA 5CD1A 4AJ4A 2XAAA 3VAYA 5KREA 3AEQA 3BORA 2ZRDA 1JBQA 3FPGA 1YXMA 4BIIA 4RTQA 1UJ5A 2QYOA 4E33A 2JCVA 4I0WB 4ZVLA 2X3UA 3TF5A 1GDTA 3M6UA 2D0OB 4L27A 4D57A 4KN9S 2SBTA 4DG8A 4I1SA 1DQPA 4DLPA 2H5LA 3IMGA 2JFZA 4YONB 1JLRA 3MWLA 3N75A 4FKBA 3BE4A 1P4AA 1B16A 3FRHA 1D3AA 2FSVC 1PNRA 2NVUB 1Z0ZA 4HAIA 2R00A 3R24A 4ZREA 5FP0A 3T7AA 1X1EA 1Q2UA 2HRQA 1ICEA 2FPGB 2J48A 2ZLBA 5BVHA 5KQMA 4OXKA 5M04A 5KVCA 5F78A 1CNFA 4NOMA 3GEPA 4ISCA 4MS4A 1Z38A 4N3AA 3FMVA 4QVKA 3UMCA 1EGVB 1XIVA 3H2KA 4HGOA 2LD4A 1EXVA 3NPAA 2DTXA 4E5DA 3CISA 1ML3A 3PEYA 3K4QA 4PLYA 4M0CA 4KGVA 3M3HA 1LBEA 2HYDA 2I2XB 2ZYUX 4BJ6A 4JV5B 1LX7A 5CLQA 1KRWA 3N87A 3PKZA 1ZRNA 2PWAA 1Z2CA 3NM6B 3PGA1 4KIUA 4KQ2A 5LCXA 1TJ3A 1SG0A 2PT9A 3BXHA 4JP8A 1SKMA 4XPIB 4I3HA 7ABPA 2QP3A 2WFZA 3W4KA 2B0CA 3MCAA 4N5DA 4DR4B 5BRNA 3ROKA 2VDOB 5AWFC 4J1QA 1GQYA 3NONA 2WAOA 3MPOA 4HAVA 3CLRD 1O1YA 1FVHA 2PKQO 3MWFA 4OM8A 4FUQA 3C0KA 3W7BA 4NRDA 1UBCA 3CVJA 1FW6A 3RAEC 3LC2O 2XQIA 1KFKB 5F7ZA 3A6KA 5I7UA 1VJTA 4G4JA 1CUUA 1WVIA 5B6IA 1YFJA 2AG5A 2H06A 5SYNA 1J2TA 2FWRA 3DMNA 2HHAA 4URZR 5FNVB 4IRXA 1QMGA 5E7IA 4BLTA 2H2GA 4DYDA 1VHJA 3VI4B 3K9NA 1PR6A 5JYBA 1TAUA 2RH4A 1A95A 3F6BX 1UK9A 3KJNA 1I4WA 1AF7A 1PZXA 3A9VA 4MUXA 2IA5A 3UMJA 3X1XA 4JBWA 4Z1MD 1BEUB 3FPKA 1FSZA 2JCBA 2WIBA 1ZUHA 3GR6A 2J9XB 4ZTUB 5I51A 4CDMA 3MT9A 3OM1A 2IOYA 1X8XA 2VJCA 4YAKA 4WZBB 1QG2A 3WHKA 1YI8A 4DA4A 2V5UA 3KPJA 3VISA 2XWSA 4KQWA 2J3MA 5LP6A 1FX0B 1XEWY 2FW7A 1G6KA 2IOHA 3D2AA 2C0QA 5K0BA 4JYAB 2WJJA 3UWOA 3GLQA 2VPWA 1I36A 2GZ1A 2IXEA 2BEWB 3FOBA 4ETWA 3IALA 2OCLA 1U8EA 2NSJA 3KQNA 1TLFA 2XWJI 4QYIA 4H7IA 3PHLA 3PSAA 1JKXA 3ZZ0A 4Q37A 4TTJA 1M2FA 1NTOA 1P61B 4WLUA 3N7UA 3PIIA 2V98A 3T35A 1U8XX 1HPLA 3AF4A 3MWYW 3KYIB 2QTMA 4L3WA 1NXOA 2SKDA 4Y2PA 3T5BA 1NR5A 3JQDA 3PHJA 4HK4A 1CNMA 2E48A 1FS6A 2ADFA 1NQUA 3EZNA 3LP8A 4NQZA 2D2FA 1PJ4A 1XFDA 4DPLA 1WBDA 3RC9A 1J9ZA 3ZEAA 3KYDA 2NUPA 5JT1A 3KL2A 3VU1A 4O2BF 4CM5A 1ZOLA 2HWWA 1JTFA 2CBGA 3ZNOA 2LNDA 4MWEA 1QHXA 1WNTA 2X5NA 1DB3A 1GNPA 1XTKA 1DBWA 1W8IA 4QRIA 5J59A 1Z73A 3QU4A 2GYYA 1RCTE 1LKZA 3F98A 1DUSA 1KFEB 2J3IA 2KLHA 2OC9A 5KYNA 3R3UA 3EDYA 1NMQA 3I1FA 1QCZA 3H5IA 4U00A 3D4OA 2FQ1A 1SKQA 2BGTA 5EQJB 2XKAA 5FWDA 4PVDA 2COKA 2BMJA 2QKYA 3C15C 3D8UA 3P4UA 4OEHA 4QUEA 3EZ6A 2O48X 2WU1A 3LBYA 4AXXA 4OSOA 4DNQA 4EYOA 4ZQBA 2QE7D 3NM5A 3GFTA 3KLPX 3DHWC 1CUAA 4QXOA 1CSEE 2WNHA 2V7VA 4P82A 2LCQA 4BP8A 1C1HA 5BSMA 3U7IA 3AF3A 1TE2A 3PGVA 4Q1DA 4AURA 3A25A 3RVJA 1R0BA 3DUWA 5EWMB 5CVCA 1WZEA 4FMCB 1U11A 2R79A 5CYPA 1RLIA 4JP1A 3IOEA 4CFZA 4ZD6A 4FONA 1LFDB 1N1EA 2H51A 3TDKA 1Z8FA 1O4WA 4RK5A 3HP7A 4WZAA 4URVR 4GL2A 2DQ4A 4ZVSA 3VQTA 2NTYC 3C3XA 3PFCA 5K8LA 4U7HA 4OREX 1A1SA 3I76A 5KTPA 4JI6B 3BAZA 2E9SA 4F4CA 2H4ZA 4HLUC 1J0DA 1NE2A 4HFNA 3SP1A 3ZR4B 4E2FA 4GVLA 4D0GA 2YHSA 1CYEA 1FJ2A 3GAAA 5HCNA 4C05A 2NP7A 3O0DA 1QMPA 1UK7A 3P71T 3ENKA 5AI0A 4LXHA 2WG2A 1W5BA 2WJWA 1K7EB 5D8DA 4URFA 1EK6A 3ZWXA 2CXQA 1SXPA 1VLHA 1S8OA 3VNVA 1K68A 3COPA 1ODCA 3EDCA 3HRKA 1UMBA 4JELA 4JLUA 4WN9B 4JI5B 5H16A 1N9ZA 3ZS9A 4GE3A 4F2GA 4Q3AA 3L77A 1KEUA 3C7KA 1PR3A 4RSGA 2J0EA 4C89A 4TYNA 5HBGA 3P1JA 2JVIA 2HAEA 5LQMA 5AJXA 5ALWA 1O89A 1DAKA 2QW1A 3H8VA 2ZJ0A 4WUVA 3X44A 2UXDB 1MO2A 2WSBA 4KWCA 5CH8A 1J0CA 4XQ9A 4AG3A 1E98A 1T2EA 1W59A 1ZH4A 1E2NA 1XMOB 3WDKA 1ZRSA 1QAMA 1UKYA 3JYHA 5DHTA 2R8XA 5I7OA 4TM7A 1XTSA 1NY6A 3V8EA 2GCPA 2P30A 3BILA 1MGOA 3AUKA 1ZVVA 4H1HA 5K09A 4V02A 3PFNA 3CURA 1SK9A 4N01A 3ZU3A 3D3EA 2F1IA 1I3KA 2WAYA 3LL7A 1VI5A 4PYNA 2YN2A 4BFCA 3K70B 4P0QB 3R20A 4H35A 2WDZA 1P44A 1YGPA 4BB5A 2G5TA 4Q1AA 1F0YA 1R0CA 2QU7A 3U3ZA 1WPXA 4RD4A 1CR4A 1PDVA 3CVUA 1VKRA 1JJBA 2YYAA 1ZICA 1T3SA 4GKAA 2HJRA 3USZA 1F8FA 1GU7A 1U4OA 2NPFA 4UTOA 4OQEA 3HCPA 5FPKA 5KO2A 1ZEMA 4GLOA 5FR2A 1Q7BA 2G7ZA 1Z7EA 5LBTA 1V9CA 3VVBA 4B46A 5IANA 1II0A 4LDPA 4OJYA 4KQJA 2Q1XA 1LZKA 2Y4NA 3OQHA 2OBNA 1G8AA 4HWOA 5AIBA 2IXDA 1UIRA 4XDHA 1CT9A 1IUPA 4BV8A 2Z6QA 1XAIA 1UANA 4R31A 1KJZA 4EUEA 1G5IA 4CL0A 1J5PA 3OFSA 1V16A 2HHLA 1A3CA 1GHTA 1VE5A 2NXCA 4YLGA 3U60B 1G8HA 3ZZUA 1ZMOA 2P6NA 3ZV6A 3VJRA 3EXHB 1OXTA 2DWPA 4QFCA 3MXTA 4Q18A 4AP5A 3OUTA 2F48A 2B1RA 4KQ1A 1YS2X 3MTAA 1YC2A 4G25A 4IZHA 1PX0A 1E5QA 1PVVA 2FH5B 4G09A 1N0IA 4BO2A 1BJTA 4RVGA 3ZHYA 2JEYA 2O8VA 3C6KA 2Q3BA 3ONWA 3U6BA 2V55B 2XYGA 1ZS9A 4KLZA 3KCNA 2C5GA 4RXUA 4WCFA 2Q5JA 3GP5A 3ZKWB 3WX0A 4NTZA 4TWIA 2A9PA 5G0SA 3CNNA 2GVNA 3LQ4A 1PLLA 1WSDA 2E1RA 5EE0A 4Q7MB 4X7MA 3JPYA 1ZUNA 4MVJE 4UDNA 4C0XA 4C0BA 1C3XA 1Q7CA 5IVPA 3E2IA 1U90A 2NXNA 3SYRA 3W2EA 1IY2A 5GONF 1UFRA 1N3YA 2GFQA 5AHOA 4KLRA 1EYZA 4HDCA 5KAMA 4RIFA 1ZIOA 3NBUA 2ZXFA 1KMQA 4YPFA 3HCFA 1MOPA 1B0ZA 1GA1A 5EIFA 5EHZA 2G1KA 3ABOB 3KM0A 3L0SA 3RSQA 4DRZA 5CCXA 2DERA 3HO1A 2IS4A 1XCMA 2VA9A 1XPJA 1N2XA 2HK9A 2Z5FA 1SCUB 1IWOA 2FPUA 1SD5A 3MXOA 1Z5WA 1MX1A 1S8NA 3PNSA 3R44A 2ZU0C 4HEQA 3V9PA 1GIAA 1C9NA 3WRYC 3F8WA 4RYLA 3OETA 1GCAA 1C0IA 1QGDA 2QTNA 1H3EA 1RXUA 3RG2A 5EQDA 5JJIA 3PX3A 1GOTA 4FZ5A 4LOHA 1Y82A 2FG6C 3TOSA 1TZCA 2GZRA 4TROA 4TV8A 7ADHA 3B6JA 2IU3A 2V9PA 4KXWA 1YDEA 5E7MA 4LV8B 1KH2A 3CBGA 4MULA 2KS6A 3ASZA 2F1JA 2J30A 4B7XA 4DTCA 1SGWA 1M76A 4Z4CA 1N5IA 4XM1A 4B8ZA 4L9SA 5C3MA 1XXHA 4H6XA 5CVDA 4ZCPA 2D5LA 1WUIS 2Y1WA 4R51A 4QXAA 4UMEA 1IMOA 5D5PA 4AJOA 3KEMA 4O4IB 3CTPA 1F8XA 4ILKA 1W4AA 4TVBA 4TS1A 2Q9BA 4AULA 2W6OA 2Q2VA 2UVPB 4LPSA 1JYEA 2WHRA 2WPNA 3FAKA 1W4RA 5FYDA 1C3OB 1Q12A 1QK3A 5KNBA 5LUBA 2JZNA 2QRMA 3F2IA 3B7GA 5EUBA 5BMOA 1ADBA 1DEHA 3IUSA 2QBYB 1Z6ZA 2UZ0A 4HEHA 3S2YA 1K5HA 1CZRA 2CXXA 5ER9A 1HNXB 4OHRA 3BMXA 3HU3A 3R9XA 1X7GA 1EVKA 4QODA 2HO5A 5K0ZA 3ZTYA 5KVVA 3MJSA 1N4AA 2POQX 1S2MA 1G8GA 4JI7B 3R5XA 1JF8A 3TIFA 1R9MA 5A7GA 4I1RA 1K7FB 2A2ZA 1EQ2A 4YT2A 2Z83A 4RABA 4Y6QA 1XDDA 3FUVA 3I53A 1R4ZA 3CCFA 5C1DA 1Y1SA 2PGXA 4FGZA 3IIIA 2G7MC 1UZLA 3RC7A 1TT5B 3UJCA 1EVJA 4E4TA 1Z5PA 4INPA 1RTTA 2XGSA 3LUCA 2E49A 4LYGA 3MOGA 5KTYA 5L7TA 1QIMA 4DIEA 3MBOA 3TCKA 5T8KC 2LZ0A 2QTLA 3OESA 8ABPA 3SJ7A 5AR1A 2W8ZA 2ZRPA 2AFIA 3BBLA 1EX7A 1PVDA 2V6BA 1F2VA 4BJ3A 2VTBA 4LHVA 1XQ6A 4DMFA 5HQJA 3Q7EA 3AVVA 1XNGA 1BMQA 3TCXB 4QD3A 1U7WA 2PKQP 3IAUA 1ORDA 1PFQA 4BNYA 5HKKD 1YRQA 2E85A 3I8XA 4C2TA 4LJSA 1JEAA 4W6QA 2OENG 3N2KB 3T3EA 1LDYA 5JY6A 1T2FA 4RKQA 3QHQA 1TPZA 2JVJA 3INNA 1NUUA 2GEKA 2L18A 5LNK1 3W3ZB 1K88A 4EPXA 1MH9A 1FDSA 4FCWA 4KO3S 3TQTA 3D6TB 5AM1A 1EMDA 3SZOA 2GD2A 5HGXA 2CLOB 3BG5A 1ST3A 4PFKA 5AI5A 4R0MA 4JLNA 1QB8A 3L6BA 3EUEA 1XVLA 2GNOA 3NVKI 3HYNA 3ESCA 4M1OA 5AOBA 1AD2A 4FYVA 3V4OA 4JEMA 1ATZA 4B80A 3FMFA 4Y9TA 3T7TA 2W2NA 5FV7A 1MHPA 2QXYA 1ZQ9A 1X38A 1G0OA 3C8UA 4I1UA 5JCJA 3SKVA 1O57A 4IM7A 3OTHA 5BNZA 3H2SA 4DVGA 2R00C 5D7NA 1YL5A 5LBIA 3RKRA 2IX3A 2RJNA 5DO9A 4QYSA 2OKGA 3F9IA 1RHQA 2WFLB 4F21A 1Q0QA 1T1IA 2FUNB 3SC3A 1XZEA 1A96A 1WXGA 2YBDA 3VH3A 3TQQA 2PL3A 3EARA 2PD4A 4DY6A 5LC1A 2IKQA 2B7LA 1Q0LA 2Q3DA 2B1QA 5CCBA 2P2YA 4OL9A 3ZX4A 3DCNA 4LJRA 5B2EA 2XUFA 1J2RA 4HSGA 1YU9A 2V7UA 4YHBA 3WSWA 1HLGA 3ENWA 4IUYA 2LGJA 1E0AA 3ETHA 3C4QA 1Y7LA 2EEPA 4ZFNA 3NBQA 1WXEA 4GPBA 4RS3A 1H0SA 4BNNA 3SDSA 3E7DA 3FMGA 5KINB 2CYAA 2HCTA 1PS9A 1RRKA 1J49A 1MT3A 2JH9A 2PFKA 1UQUA 3A1WA 3AJDA 4G0MA 4KK4A 4AECA 2QVYX 2Z2IA 1YHZA 1S7CA 5AD1A 2BT4A 5IBRA 3IDQA 1FU7A 3IXMA 2I1LA 3SSMA 1MKYA 2GD1O 3EXFA 3L2OB 4AYWA 1AV7A 4FI3F 4GP6A 4I81A 2HH9A 3D0OA 3ZCUA 4W9NA 2ZB7A 3DZFA 1OPRA 4B2LA 1VYHA 4C4AA 4DVJA 1SH7A 3D3QA 3MC1A 5EZQA 1WSWA 4ERNA 3RTCA 1XMXA 4HH1A 8ADHA 3FXAA 2ZSEA 4FNAA 1FTWA 3KSMA 1P6XA 3MJHA 5B4TA 4Q6BA 3ETDA 3UUFA 2CD7A 2O2XA 2VHWA 3CSUA 2PRYA 1INLA 5LP6C 3HNOA 1Z4NA 2P67A 2VPIA 4ND6A 3TZHA 4BBJA 2I1VB 3HRIA 3OJCA 3QE0A 5FBQB 2YIMA 1F4LA 5JIBA 4BVFA 2RARA 4G01B 4MVJD 2PSHA 4YP7A 1WHTA 1L4MA 1RR6A 3N7TA 4PNHA 3G2NA 2IBTA 1H5QA 5CYOA 4DQXA 5IYZA 1GZDA 5K0EA 2I22A 1A2OA 3DWFA 1OBHA 3NIGB 1L7OA 4JUAA 1YJXA 1Y8AA 1J25A 2JIPA 4A0SA 5JZVA 1PVOA 3LCMA 1MG0A 1QK5A 4B35A 1VXRA 2I6TA 1Z7WA 4K87A 2UXCB 2W4QA 1GKLA 2FQYA 3D4PA 1I4LD 4WQMA 5L3VA 3R1IA 4KYUA 4CQNA 4DSTA 5BRJA 2OESA 3GA7A 4NV3A 4BL5A 4CMGA 5AKKA 1M8KA 2FP4A 4D0LB 4G1EB 4BRWA 1T9GR 3Q85A 3U26A 3H17A 4X7RA 1X13A 4WY8A 3WIBA 1LH0A 1SY7A 2IYOA 4FZRA 1A7JA 1RAEA 1EZ1A 5DGHA 1JIQA 2D3WA 4HLCA 2BTOA 4PU0A 1VMEA 2F00A 5JFGA 4WXRA 1XMSA 1PNQA 1U3VA 1O96A 2IDZA 4HDOB 1GTSA 2JHPA 5EFOA 5T6MA 3QH4A 4D9BA 1P75A 2P3OA 2WOJA 4PAGA 4Z0PA 4D4JA 4EJ2A 4E4RA 3KTOA 4FR0A 3A06A 4H7EA 4K1XA 2GZSA 1N5LA 3BICA 4YQYA 3IO3A 2P9CA 1LU9A 2NMVA 3REQA 4B3FX 1E1CA 4E32A 4MHOA 1SC4A 2VDJA 4EQ6B 4N7BA 3QUCA 4A3SA 1ZD2P 1OXBB 1C9EA 2YXDA 4MPJA 2MSDB 3Q8XB 4KQMA 5IKPA 1QM5A 1OBCA 4KCGA 2XBUA 1RACA 1DQSA 4RIEA 2R4QA 4Q15A 1MMFB 3I4FA 3T99A 4E7PA 3MK31 1Q16A 3T4XA 2RGUA 4E5MA 4CTKA 3JQAA 4R8RA 1CX9B 2FPGA 3ACDA 1RAAA 3P0HA 4AAYA 2HV8A 5JZOA 3SQMA 2W2LD 1KQPA 4Q1EA 1CHDA 2ETVA 2JGEA 2R6FA 4K81B 3FPHA 4CT5A 4ZI7F 1D0IA 5IARA 5E4YA 2M6LA 3ZW7A 2AQHA 4BTVA 3KR0A 2AJCA 3N74A 3FFTA 3KJHA 3WLEA 1M2JA 3W6NA 3AHCA 5JZSA 1W34A 5KOYA 2ZRJA 1D4AA 5I45A 4L5AA 4RAOA 1YBVA 4EGFA 3M1AA 2EW2A 3HP1A 5DRTA 3ORRA 2Z4SA 1YS1X 2ORYA 3CONA 4NYJQ 4PIPA 1GN9A 1QQBA 2BCEA 4ND4A 4XPIA 2HU7A 3EIHA 4NJEB 4RVHA 3X1DA 4C3ZA 3UK0A 4C6RA 3KETA 4DQDA 1Y3CE 1FC0A 2B4RO 4N48A 3MINB 3QPCA 4B3IA 4NZOA 4RPJA 3UPDA 3TEMA 3KC2A 1SCBA 1T24A 3MZ0A 4LRUA 2WWYA 1N2HA 1I3NA 3EULA 2IV3A 5B12A 2YIJA 5EJGA 4U2FA 1H66A 1C3JA 1W4BA 4ZI5A 3WC4A 5IWCA 3UAVA 3HVIA 4HX2A 4BX3A 3FSGD 2VDRB 4F0JA 1JDBB 3ILXA 2P1ZA 3PEFA 4CXMA 3CRW1 5JHHB 1HYEA 2EGUA 3OE4A 2JLXA 3H1AA 5IZCA 5K8VA 3RVSA 5LDHA 1P2UA 2XIQA 4J0FA 5K4AA 5HQTA 3DH0A 3HJFA 4KO4S 1KYVA 4E5PA 4WZBA 5FWXA 1A5TA 1NT2A 4H77A 1SIWA 3VSEA 1FBNA 1QRUA 4NXNB 4PFQA 4YAFA 4MDYA 1OFHA 4QDXA 2REQB 1LS1A 5HF5A 4XAQA 1DRKA 1KI6B 3BMNA 1GAJA 1BE6A 2BHRA 3M6MD 1D07A 2BHSA 2XEDA 4DG9A 1GL7A 2F9FA 1EP3B 2GCGA 2P75A 3T34A 4EUNA 2BEWA 1EM8B 3WGMA 4C03A 3ADKA 1KYWA 5LXTF 5KTRA 5DCYA 1KTVA 3ZWYA 4ENTA 5IEBA 3DOIA 1XD8A 2EKBA 3TAUA 2V6MA 1RRCA 3DXZA 2FW8A 3KLMX 2I1QA 3N76A 2P9HA 1UPAA 3SOPA 5JS8A 4Q4AB 2C2YA 2NX2A 3GLFE 2RD2A 1AV6A 1SKAA 3D59A 4JBHA 1L7MA 2ZI4A 3BGWA 4Y67A 4C0WA 1O9BA 3NHMA 4FKMA 5FBLB 4EB6B 1OB2A 1FPQA 1TADA 3JATA 3P4YA 3SXPA 3ZIUA 4ZCRA 3GLGB 3CLTC 4OD0A 7REQA 2PWYA 1BVHA 2RHHA 1OZ0A 2WAAA 4IG9A 4YREA 3WZMA 2EJBA 2Q46A 2GF0A 2OXTA 3H05A 5GOTA 3U61B 4TWAA 4TWJA 3AQIA 3FPBA 1NG9A 3T3GA 2QW8A 3BKXA 3I0MA 2QW0X 1AQUA 1TZ2A 1YCDA 4JUIA 2RHCA 4WCFC 2EZTA 3VKFA 3X1WA 4CBVA 4AD8A 2RCNA 1N4DA 2FZVA 1NP6A 3HM9A 4DR7B 3EFOA 2PFSA 1E79D 2HDHA 2P27A 1K7SN 2RK4A 2C00A 1WDTA 3AR3A 2ECFA 3A2MA 3IBGA 1TKRA 3OOJA 4WGGA 1RQPA 4C4PA 4TTRA 2B3DA 3K0HA 4LZNA 1FNSA 1B4DA 1ZGCA 4F6RB 5HK8A 1Z7YA 1QU2A 1R6AA 5HZKA 3ACBA 4YCBA 1OFVA 5REQA 2C5LA 5ALIA 1P5JA 2I6GA 2BFBA 3K5WA 2GDJA 3E3MA 4ZMRA 5AOCA 3F7MA 2QTZA 4US2R 2QTAA 3T52A 3INGA 3UWMA 1KERA 2JCGA 4GS5A 2X5JO 4ENPA 5TIIA 2B6HA 1YFZA 4HEA6 4CEJB 3JD1A 2IBMA 2D5CA 4C76A 5SYMA 3LY8A 1X3LA 2ZS9A 3E70C 2LCFA 4O3MA 1Z8NA 1OAAA 5EQFA 4DWJA 1N75A 2VVTA 3ROMA 4JI0B 2FMIA 4GD3Q 1NOKA 1BHSA 1H9BA 2JLQA 2JZCA 5ALTA 2QGFA 2A1TR 5F64A 4DLUA 5GONB 1TUEA 3AY6A 2I6SA 2YDYA 1W52X 3GWZA 4RGBA 1LI7A 3GLKA 1JKMA 1DCKA 1QYDA 3IAFA 4X8OA 3PCXA 4YRSA 4EO7A 5FADA 2EFCB 2EZ4A 1JSZA 2BGJA 1FQWA 2DBQA 4RVFA 3ZU5A 1B6RA 2CWWA 3PEVA 4L6AA 3BRSA 4AMBA 4UM9B 3EAFA 4DQUA 4OJTA 4CQJA 3S27A 2A4KA 2WD7B 2X9NA 4FFOA 3K9LA 5JNTA 1ENPA 1OKKA 4A0QA 4D1YA 1AS2A 4QU5A 4OXQA 5CM9C 4ARIA 2X8BA 2YOHA 4IMPA 4G4SO 2ZIGA 5FBWB 3F7TA 1NZFA 4Q4LA 5DTRA 5BWOA 4NG5A 4ZXFA 3WGIA 5E8JA 2Z4TA 4QEZA 4R8KA 5JNWA 4Q9AA 4H0NA 1QQAA 4R1NA 2NNLD 5DHQA 1QF9A 2CUZA 4PG7A 3IP9A 2XB9A 3KZMA 4RD1A 3V1LA 3S2FA 4Z4QA 3EOZA 4MV1A 4ZEVA 1R7RA 4AP9A 4TS4A 4P22A 1E59A 1M1XB 4HDMA 3QTTA 4KVAA 1N77A 1HQKA 3F4BA 3TQIA 1UZMA 5E3JA 3L6CA 4K6KA 3HBJA 4HPJB 5EMNA 1VI2A 2OV6A 2GZHA 1H1DA 2DC1A 2A5GA 4MVJI 2NVOA 4RL4A 3PNMA 4RVSA 2W6JD 5FTJA 5HIAA 3A3NA 2CV2A 1QPGA 5KMGA 2W6IA 1ICIA 2F17A 2G9VA 2PZEA 1QQTA 1SN7A 2QLMA 3HVHA 3B70A 5SZHB 3WYBA 4P83A 2KI5A 1XF1A 4E6PA 1HT3A 3ZIAD 1JXOA 3IAAA 4ABYA 3CX6A 5LOVF 1XLUA 2MSCB 5E4TA 1JECA 1YZYA 4XWWA 5TC4A 3N86A 4LY3A 5K8JB 3MUEA 1IMJA 2ZQYA 1V43A 4N6GA 3EWAA 4PHHA 5DOVA 1E4EA 2RGBA 3MM4A 4YRPA 3U49A 2WD8A 5A4MS 4BKPA 4JXJA 2GSWA 3ZDXB 1KEWA 1F14A 3G13A 3AL2A 4MMZB 3W1EA 4QECA 1E1MA 4AQ7A 3TD2A 1CUBA 1GEEA 2V7PA 3U3JA 2IFTA 1GCUA 1W96A 2P9FA 3G85A 2VDUE 1MJ5A 3NT4A 3SJZA 4RDXA 1YCFA 3IT0A 3F7NA 4JHXA 3I9JA 4PYMA 3THSA 4GLJA 4EK9A 4EG4A 4P32A 2ID8A 3QW2A 3C7AA 1T1RA 1VBMA 4TV9A 4UDXX 1G3UA 1AURA 1L5OA 2GJAA 3FWPA 4S12A 4ZVQA 5AUPB 2PGNA 3QFFA 2ZSKA 4LZWA 1NXVA 1BN6A 2MSNA 1E1QD 1OMOA 1UBJS 1XN4A 2JFHA 4HZUB 5E6UB 5IH3A 1NVGA 1PTJA 3EXHA 4TT3A 1C7RA 4G67A 3RI3A 3E3LA 3G5UA 3M2TA 4HCJA 1JEYA 4J0KA 4X20A 4NBLA 5DNUA 1LB1B 2ALJA 2ZYHA 5CLJA 2WT9A 4CCWA 1QKIA 4B4UA 3OX3A 1SVSA 3AY3A 4L0CA 3Q5DA 3LLVA 3RTGA 1W5FA 4C5AA 2FZCA 2FUEA 4WLVA 2RGAA 3WK6A 4J2TA 4C4OA 2VL7A 2X4DA 4L7VA 5J9FA 4ZYYA 4QZVA 5B3AA 5HVNA 4FDTA 1FE8A 2CK3A 3SY8A 4D9JA 2XDQB 5KVSA 1I80A 4ZMSA 5C1BA 4BRSA 4DUZB 4WCDA 2AEJA 2C20A 2C96A 4P34A 3LQ2A 3PXUA 4PTYA 1HTBA 1K4YA 2OWEA 1I30A 2HB6A 4HY3A 3SHOA 3AVXA 2H07A 2WHEA 3JYQA 1EGAA 2JIOA 2OXFA 4M8SA 3IVCA 1H1TA 2NGRA 3QYFA 4HYQA 1NW7A 3PHGA 4RIIA 3E5MA 2RC6A 3QMPA 3NH9A 4P7FA 4YN3A 3RHZA 2JG3A 4EECA 1EVEA 2TRSB 3MWKA 1MBZA 2FSFA 2XVMA 1NPYA 1I7PA 2D1TA 2A0YA 4W7SA 4XI9A 2AN4A 3MUFA 3HUDA 4MW0A 3SOZA 1B14A 5LA6B 1NBWB 2P9GA 3AJ8A 4LI0A 3V6LA 4BQOA 4JEIA 2AOTA 2H1SA 2IL1A 1XZFA 3BC1A 3I2YX 4ZVRA 2WKQA 3WGKA 4FOSA 3THXB 4HYEA 3VPXA 3R8FA 2Z8ZA 2MU1A 4JZKA 1C0KA 1BQ3A 4M1MA 4W9NC 2VQDA 5E6SB 5ELXA 2PKYX 4K9LA 3SLKA 2RDMA 4L28A 1IOZA 3KQMA 2WBLC 1BXKA 4XQCA 2OQVA 5JCPA 1RJ9A 4INAA 4DV3B 2XXJA 5I9MA 3EQ8A 2IP2A 4LBVA 1MIOB 3PPVA 1W19A 2QHXA 2BFDB 2AUNA 1YDMA 1V1MB 2XQGA 3AUJB 3Q8WA 4JC4A 2GNAA 1G8PA 1RRVA 1E6LA 2AXEA 3RS0A 4CT4B 4E22A 3QVTA 3HY6A 1G21A 4UXIA 4DILA 4F60A 2AUTA 2H1RA 3SQOA 3ZZTA 2EYUA 3M5DA 5B1HA 1P80A 3DQPA 1LTHR 1T15A 3EB9A 4XB2A 3TD6A 1G3IA 4A8JB 4D5EA 3DHVA 1PFUA 3I8SA 1KAEA 1NE7A 2OV8A 4UUAA 3FPEA 2Q3JA 3VVLA 2D7DA 1MQSA 2C2BA 2FGJA 3GJ8A 4JJZA 2AF4C 1FFWA 1QSGA 2AX4A 2J4DA 2VPQA 1E9AA 3N0WA 1AKEA 1NX6A 1D04A 2JL1A 3SNKA 1SVKA 1ZWKA 1MR3F 1ISPA 4V3BA 5C7YA 1LZLA 1OYYA 2FZGA 2PU7A 3JZDA 3VOTA 1SPXA 3BIOA 4FWIB 3HDYA 2P41A 5KTOA 3FVVA 4W5JA 2WFAA 2M2IA 3A9RA 3QBTA 1ADFA 4ZAWA 5CVJA 1ISFA 1TT5A 1UMCB 3WL4A 4D45A 3D2BA 3L1UA 1QTQA 4F8YA 1YV9A 4D9GA 1NR1A 5F4ZA 4UAVA 2GR9A 1XL0A 3CUWA 5HS6A 2QI9C 5ITVA 3AU9A 3C14C 4RA6B 2W70A 3K5IA 1AK2A 2V7TA 4YP0A 5DP1A 4ZT4A 3ZCQA 4OGGA 4PSUA 3JZMA 2F8MA 4RA9B 2FEKA 1UFQA 4DQKA 4EJSC 1RZRA 1AZTA 3MW8A 3SZLA 4ALLA 1JSLA 4RY8A 3M4NA 3PV0A 1UZNA 1X6VA 2CLKB 3GRVA 1W0JA 4JJ6A 3HEMA 4CMHA 2Y0BA 4P53A 1FDTA 1JT2A 4KBGA 3OEWA 1WG8A 4IICA 5JSKA 3TRHA 4EHNA 3NHJA 3VHLB 2GFIA 1O94A 4U9IS 1J4AA 1D1TA 1VSQA 1YJAA 3DV2A 3DUFA 2JCYA 1EE2A 2R97A 2QD4A 3K94A 2IE8A 3G5LA 4JROA 3L0YA 3WL7A 2NACA 3RNLA 1EK1A 2RHOA 1VBNA 3AI3A 2PEYA 4HYYA 2PYIA 3ZCTA 5HFNA 1WMFA 1HDYA 5BNTA 3V4PB 3F90A 1P33A 2YQ5A 2LW7A 2YY5A 3A36A 3M0EA 5BSUA 2YWEA 1U2RA 3UEOA 3PI7A 3I1IA 1PJZA 1ZBQA 2G8NA 3LRXA 3NUGA 5C8ZA 1WX1A 5EIHA 4B3BA 4X8LA 4BYMA 5A5GA 5JLJA 5JFTA 1RWMA 1EIWA 1E96A 4UTNA 2ZRGA 4MUJA 1ABEA 1JDUA 1FS5A 2CBXA 3CGWA 1CG6A 5DNYB 1QTIA 4ZOLF 1PO7A 2Q41A 2Y1FA 1L5WA 4PLGA 1C1DA 1QJCA 4H15A 5AW5A 4YRBA 4HS9A 2HV9A 5H5JA 5TEWA 2X15A 3ICVA 3HFJA 1QHEA 4QSMA 4EITA 2JGDA 1Z0UA 1V8PA 3DDOA 3WJ2A 1E0SA 1ZM2A 2ZTSA 5KYXA 1U94A 3O2QB 2WAXA 4R0VA 2JLWA 4ZJPA 1WTAA 3BDVA 2AKYA 4BAZA 4JYCA 3ZJ4A 4C06A 5HR5A 3ZS8A 1BEZA 2BIFA 2OAP1 5E3IA 1AC5A 4II7A 5AKEA 4CDGA 2X42A 4BLSA 4DMKA 4LZLA 4YACA 4DCGA 4RTPA 2RHMA 2NU6A 3QNWA 2Z2XA 3DO6A 2JEZA 4KU4A 2CSXA 2IEZA 2RG7A 3LY5A 1P8AA 3RVDA 1MOSA 1ECBA 3TEJA 2C92A 2H8KA 2X23A 3TE7A 1A50B 1K66A 4GWGA 2RGNA 4YJ2F 3KJQA 1NVVR 2JIBA 5BN4B 1ORWA 3CLUD 3MELA 4FC6A 5DHAA 3HUTA 4YDRA 3SK0A 1DWUA 5JCJD 1U31A 1NSFA 2QRVB 3CG4A 3EISA 4AWXA 4ZI7B 4BB0A 1VKOA 4ICIA 1Y5MA 4QLAA 3CSDA 3HKCB 1F8UA 1N2CE 2X9QA 2JHCA 1EP9A 2QN6A 4Z2YA 3SF8B 2LP4Y 2VJQA 2IHUA 4X63A 3AL0C 1EJBA 1J2YA 3WLKX 1E1RA 3QG1A 2OXCA 1FLVA 3WICA 1PEDA 2O2EA 3KS9A 5LB4A 1YJ8A 3DMHA 3O31A 4PX9A 1SUPA 3FFBA 4L0QA 5TQ0B 4HH4A 1AGRA 4DQ0A 2HJHA 5CFMA 2GHQA 3SYLA 1Y5LA 1X87A 3AIKA 4PTZA 3SJCA 4U7DA 1PUJA 4D9HA 4JOCA 4F5ZA 4LS3A 3LHIA 3UBTA 2QK4A 1ZK0A 1P5ZB 4J29A 2IWRA 2BEUB 1IL0A 4L4SA 5AVVA 4I8XA 4EB3A 2XUZA 4WPGA 3WS7A 3QKUA 4H4DA 1KWGA 2Q3FA 2X76A 3H0KA 3M9LA 1NMZA 3BK7A 3EGOA 3N5CA 3IAM1 4KXMA 1J8QA 2VJDA 4KXYA 4EGAA 5KWJA 3PNVA 4P80A 1ITZA 1CIJA 3CSSA 1AUOA 3VR2A 1CP3A 3NXSA 4OHFA 4UAJA 4FS8A 3WL6A 3NJ8A 4CMEA 6LDHA 4TX1A 3AVYA 4GXRA 3Q9LA 1PWEA 1UT5A 3B6IA 4Y1RB 3V2IA 4FYMA 2C1ZA 4IGAA 1XCBA 4OKSA 4YJGA 4B5LA 1A7AA 1P45A 1Q7RA 4BLVA 3ILSA 4AROA 2DUUA 2VJBA 2QA5A 4NYMR 4IKPA 3ZNQA 5KNCD 1E5TA 4LQ4A 4M9QA 4R1UA 3M1YA 4UNRA 4ZO6A 2QTCA 1NJ8A 4FB4A 4GOLD 4L73A 4HNSA 5A2QA 1T5DX 1VJGA 4LHSA 1N6IA 1SQ0A 1VZ3A 1DKUA 1OYWA 2WIDA 2ZUWA 2QRKA 3I9MA 2EW8A 9ABPA 3PCTA 1H42A 1TFUA 1UZAA 2BFCA 5DV9A 4YS6A 1TDJA 3GG2A 3TE6A 1VSBA 3QXHA 1G1AA 3LS2A 3T1HB 2I4IA 2HLHA 4YWHA 4UDOA 3I5YA 1RLMA 5CA0F 1N2GA 2Y0DA 4ZT6A 2YC2C 3LX6A 3EF0A 3KQVA 5DBIA 2GFHA 2X2EA 1M7GA 4MR8B 5FBRB 3W6ZA 6GPBA 3ER8A 2P2SA 2GUWA 1C30A 1ZR4A 3L7JA 3MCWA 4B3TB 3SDBA 2C54A 5ABPA 3ZHUA 2UV8A 1G60A 4E5KA 4G2TA 2V9ZA 1SBHA 1W0KD 2XLBA 4D97A 4L6IA 4LYFA 5TPZD 3VH2A 4W9MC 2WF8A 5LZ7A 2JFXA 1BWSA 1ESNA 1XKQA 3CEPB 4D99A 4E13A 3PX7A 1BYIA 5IUNC 1ODIA 5CAEB 1BOOA 5ER6A 5LMUB 1WMBA 4O2BA 5D3QA 1DCTA 5AJVB 2AFHA 2XGJA 4XH9B 2MMCA 1DDOA 3AEKB 4QOIA 1YFKA 2WG1A 5DNVA 1V8FA 3HZRA 2C83A 4Q66C 3LW7A 4QL3A 3S99A 3SBOA 2QRJA 5K0NA 4JXKA 3JAMA 3W5JA 4CR7A 1UDCA 2DQZA 2O2SA 3ABQB 2IWHA 2BGMA 4R8VA 1OXXK 2JGAA 3G3EA 3PL5A 3RRZA 1O9HA 1C8VB 3PJFA 2VT6A 1LS6A 2GK6A 5JOQA 2JEOA 4ZRNA 4K40A 2RHBA 2R6JA 1Y5NA 2AHRA 1VKNA 5ILQA 1LLDA 3AJAA 2IEDA 3VHXB 2L82A 4CT0A 3EXEB 4ZKEA 3B12A 3KYCB 4KX3A 3R5JA 3RHSA 1AA6A 1GPLA 1WZCA 1WA5A 1QH0A 1KK1A 2V54A 3LQFA 1QH1B 3GLSA 3CIFA 3TG2A 3LGSA 1AQNA 2BWJA 4DT1B 1WQ4A 5HZMA 3QOFA 3QEAZ 1C14A 3G9TA 1T0HB 4IW3B 4MO9A 3THWA 1GCOA 2DHEA 3K0AA 4JKOA 4XYMA 4ZI3A 5I5EA 2HREA 2P7IA 5LBUA 1X7WA 4NJEA 3F7OA 1KJJA 3M6FA 3L7KA 2RGDA 1K7XB 2ZJ1A 3ODPA 4JD5A 2GUGA 4R5MA 5CJPA 1TVKB 4UPVA 2DMRA 3TR6A 2OCYC 4MYCA 3RTDA 4DEYA 3DGFC 3LKZA 5FI1B 2Z3VA 1U8AA 4R7TA 1DIAA 2J7PA 1EVIA 3B1JA 5EXXA 3UC5A 2JJ2A 1V11B 2CJPA 3EQ6A 2QPTA 1MC1A 2PG3A 3GLVA 3O4FA 3Q0EA 1YJQA 2IOQA 4MV0A 3CLKA 4YRKA 3ZD7A 2VWGA 4TL8A 1L9KA 1PV1A 2RGWA 5EG5A 3A1CA 1UP4A 3IHKA 4L0MA 3K8ZA 2BCJQ 5DTIA 4OLBA 4DG5A 2BP7B 3PUKA 4FVTA 1LF5A 1POXA 1H8HA 3VSDA 3KAQA 3TQSA 2WK1A 1O6CA 1XQWA 4KFUA 4RZQA 3I1YA 3THYB 4EW1A 2IU6A 5FUMA 3WFZA 4B6GA 3A4NA 5KSZA 1G16A 2RGCA 1IUKA 2BI8A 1GV1A 2AX3A 4FN5A 3TQOA 3HO8A 5EP1A 1EBBA 2BMFA 4NYIQ 5BR7A 4P58A 3IOMA 1RQXA 3OHPA 2VYNA 3N2IA 1L4GA 1EM8A 3TIVA 2ZJBA 1DG1G 2HWYA 4LBZA 4MB2A 3ZDRA 1JAIA 4GX5A 3F9RA 2OGTA 1JQEA 4US0R 1NMSA 3QBVA 1FUUA 2OM2A 1PS8A 1QX3A 2X86A 1J7JA 1YUNA 2XE8A 5T6BA 1PEAA 2OECA 4UASA 4KREA 2Z5VA 2ZRLA 1GTMA 2OVFA 4PZCA 4AWAA 1L5LA 2YFKA 4DDKA 5JRDS 3DE4X 2CNWA 3ND9A 2O2YA 1PGPA 2YS6A 3JD0A 3SX4A 1CUCA 1SM4A 2YHAA 2QTVB 1DKOA 3GEBA 5IFKA 1N36B 4OX9Y 2P9BA 5LOVB 2QG4A 1PTJC 3EXHC 3H5VA 2F1KA 3U09A 3BXEA 3U7QB 4BNTA 1EM6A 1PGNA 2IXGA 3H4VA 2I7TA 3QLVA 2ECOA 1VPWA 3G0OA 1SVMA 3IVRA 2FN4A 3DDZX 3PJDA 2R7NA 1U0LA 3NWOA 2FZ4A 3PIRA 4PZUA 4A10A 2GRAA 5DM60 4E2XA 1DEKA 1TM7E 1JIUA 1SA0B 4CKCB 3A3PA 3E3NA 2P4QA 3ZZNA 1R0YA 3BF7A 2IPLA 3F97A 1EA5A 3BTVA 4Q82A 4YAOA 5D01A 3RYHA 4CG3A 4U3JB 5JAMA 1YC5A 3A7DA 4A6EA 2FXIA 5BSFA 5HRUA 3SD7A 1ZN2A 3FF1A 2DPGA 4FW9A 2VEDA 1E2UA 4F6RA 2FCAA 2WM3A 3BMQA 4MMXB 2JAHA 4DKJA 1K27A 1SUFA 2ZWVA 4JWKA 1L7QA 4MDHA 2W90A 4UHBA 5HYVA 1O95A 1V4NA 4HOYA 2V7QD 1EK2A 5HWSA 4UHKA 3WLQA 5ECWA 3MS4A 4EB0A 2Y67A 4D6XA 1P1FA 3ZU6A 4LWOA 3PQ5A 3QZUA 4PF1A 1HOXA 3I2HA 2R7MA 1IHUA 1X1RA 4OIMA 4OQXA 4KK3A 4D4HA 2DKFA 1VTKA 1T1SA 1C9YA 1Z5GA 4G8JA 2FLVA 2Z6AA 1EI9A 1CJMA 2L42A 2J4FA 4B71A 1Q0UA 1SXHA 4ISBA 3LT1A 1UPCA 5IKOA 3UCFA 3P45A 1IN7A 1JPVA 1Z74A 2B35A 2O2ZA 3G2PA 3IAS1 4YDSA 1Q7EA 3NKLA 1R27A 5DN6A 3TMKA 1OGIA 2ZJYA 3EUWA 3T94A 5GONA 4Q7KA 2E4VA 3UK6A 3AESB 5A9SB 1AGXA 2D5BA 4XZ3A 4IY1A 3RKSA 1H9CA 1MJHA 1N57A 2FGKA 2UYCA 3CC8A 1XDGA 1WIWA 5BR1A 2VQFB 3QOXA 1UKZA 3WRVA 2I3AA 2I91A 1U3CA 3QKSB 3L7IA 2Q3HA 1TUBB 2ZW9A 4L5JA 2OV1A 1W85B 5IBQA 4DNOA 1X19A 4JYPA 2E82A 2EV9A 3C3KA 1XK7A 4MR7B 3VUFA 4W5RA 4N03A 1TYDE 1XHFA 2ZSFA 3DTNA 1I1OA 1ZMXA 3HB1A 1BE8A 3JTEA 2RHDA 1OX4A 3QW4B 3KO8A 4M3NA 4TLCA 3IT3A 4Y7CA 2PO7A 2GEDA 5JPCA 1C2YA 1NXTA 4X90A 3HZOA 5FOSA 2WWXA 3S7ZA 1ZESA 1K0UA 1OREA 2G17A 3DMGA 2C3YA 4URWR 5KDOA 1DWPA 4JOBA 2QXUA 4UHHA 3GRYA 2J45A 5HCUA 2A5YB 5H68A 5BSTA 5TPWA 3WNQA 1L7PA 2R84A 1T9CA 2BMVA 3ESYA 2Y1EA 3KDSE 3S40A 3QVOA 4JUBA 3IQFA 4UNPA 1PYGA 2WWTA 2IQ5A 3SQWA 2Y1XA 4BMSA 4GX2A 4PGAA 4MP8A 1NBEA 3OEYA 4B32A 4OH7A 2VUSA 5MF6A 1TXGA 2RI1A