2NSLA

E. coli pure h45n mutant complexed with cair
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSANRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase catalytic subunit
publication title N(5)-CAIR Mutase: Role of a CO(2) Binding Site and Substrate Movement in Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 53
structure length 162
sequence length 162
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2006-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2nslA00
5BOSA 4JA0A 5CLIA 4Z7JA 5CLFA 2FW8A 2NSLA 4ZC8A 5CLGA 1O4VA 3TRHA 3RGGA 2FWIA 4AY3A 4YCCA 4AY4A 5BOSB 5CTJA 4ZJYA 5C5DA 1U11A 5CLJA 2YWXA 2FW7A 3OPQA 3LP6A 4YCDA 3OOWA 2FW6A 4B4KA 4YCJA 2FWBA 5CVTA 2ATEA 2H31A 2FWPA 3ORSA 2NSJA 1D7AA 5CLHA 2FWAA 2NSHA 2FW1A 3KUUA 1XMPA 3RG8A 4ZMBA 4GRDA 2FWJA 4YCBA 4ZK2A 1QCZA 2FW9A 5BORA
chains in the Genus database with same CATH superfamily
2HFKA 4HQKA 3ZWOA 3FMGA 3CW2A 1ZJZA 3MD0A 5BQFA 1U5CA 3EXG2 2WJWA 1Z0FA 3A2MA 3PFWO 4K2HA 5I48A 2UYCA 1IY0A 3EBLA 1T8YA 3LUHA 3FPLA 3SYLA 2V6FA 1QFSA 1U1GA 3OTQA 4X00A 5KTNA 1I2DA 2XRYA 4TKUB 1NA5A 2NU6A 1E5VA 2VDOB 3A1DA 4DMGA 1U9IA 3C5WP 5JWRA 2XIQA 2YOGA 4NY1A 5I7AA 5KBYA 2JLBA 3Q72A 4G5YA 4Y9DA 3WHPA 4QYIB 3QLEA 4ZV7A 2R68A 2FUG6 1DX4A 4AKTA 1Q2XA 3IEVA 3GFTA 2V4ZA 4MV0A 5ELMA 3ABIA 5AKKA 2NUAB 1W29A 2B1GA 3A32A 2D8AA 2F9MA 2FLVA 1W1IA 1Q3TA 3F6YA 4L9RA 4RV5A 3L8DA 4YJHA 3R7LA 4X65B 1ZR2A 1DDGA 1N6NA 3I37X 1H5QA 1Q14A 4LK2A 1AC5A 1FTNA 2XA9A 2X58A 4EIWA 2I1WA 5BVGA 4OFZA 2PCLA 3GRKA 4PQRA 4R1LA 3IIKA 4BCDA 3FIJA 1XRQA 5KOYA 5KTPA 1RZUA 4ZT2A 1NW3A 1H6AA 1H94A 1GLNA 1M2VB 2CFSA 2VXCA 5J58A 3V33A 1CKEA 1NI3A 3L8MA 4UVIA 1RZVA 1E61A 4WLFA 3W5IA 4JQSA 5CA0F 2UYYA 3GP3A 1YE8A 1C7RA 2WA2A 4NMHA 3EXIB 3M5CA 5DV9A 1EGHA 2WM9B 3UY4A 3N8GA 4PYQA 3KTOA 4UNRA 2JBHA 4N5IX 1W75A 2EF0A 3AL2A 3N28A 1XL0A 1Y8QB 4ZICA 1UAAA 8ATCA 4CMGA 4DJFC 3KKKA 1K2WA 2C88A 1N6IA 3TL2A 4BNXA 4BVEA 5KX5F 4B76A 3SYMA 1A69A 5C4GB 4CL0A 1BQEA 1OXVA 4FW9A 2ZVDA 4LOJA 3ZEAA 4URVR 4C5BA 3IOMA 4L5IA 3OJXA 2FPIA 3UJ9A 4AYTA 4EBBA 1M2WA 3SFTA 4C2AA 3FGOA 3HM2A 5K6TA 4DR6B 3O4HA 4BMDA 4V0SA 5FPTA 3RD5A 2IY7A 3M6FA 1FVXA 1W2GA 2Z6AA 4RD4A 2H2HA 4PLFA 1EA5A 1ABEA 1Z07A 3AI1A 3UG6A 2FPPB 1D04A 3SEFA 3CUTA 1KMCA 3L7YA 1N0VC 2DUWA 2V7QD 4BFVA 1YQWA 1NVKA 2BE9A 4BEWA 4N76A 1CRPA 1N3IA 1KI4A 1T1JA 4DMLA 3ZNNA 4ED9A 2O5RA 4DC0A 1J90A 4B43A 4I50F 3DCIA 1MQAA 3DCJA 3I1FA 3OQIB 4QPDA 2O1XA 2Z8YA 3PQ7A 3AERB 4E07A 4QM7A 3FHLA 1Y1LA 1ISPA 1TQDA 2V3WA 4GWLA 4WK0B 3H5TA 5EP3A 3LRTA 4DMMA 2AZMA 3M8KA 5LXTF 2V0NA 3ISJA 3KXDA 1NP7A 3AEKB 5G0VA 1PBNA 5CFMA 5MN4A 1PRYA 4TPKA 2KPOA 3ICWA 2O2HA 3KQSA 4OXKA 4OMUA 4XW2A 4AJNA 5E6RA 2G9VA 3FNQA 1KEZA 3H1PA 4BC0A 1GQFA 3C4QA 5T3YA 3IHWA 4JXJA 2JASA 3GEIA 4G5RA 4TL9A 5EIWA 1F5SA 2ENUA 3B3QA 3K9BA 4OPMA 3QKSA 1MJ5A 5JBNA 2RC6A 3KX2A 4L75A 3THRA 2DWUA 4G4JA 4MV9A 2OTCA 1QYIA 2JIZA 4QUGA 1A1VA 1TU4A 4DQUA 3B5EA 5KSPA 1LPMA 5KNCH 5AXAA 1PF7E 1Z4OA 4J1NA 1U9ZA 5FD8A 3BD8A 4IXTA 5CVDA 5LLDA 3NWPA 3IHTA 5DP2A 4BNYA 3K8ZA 1YFKA 4HTFB 2PT5A 3PQ6A 3QM1A 2JFXA 2XXBA 3QVXA 1U7TA 4HG2A 5AFSA 5LB4A 5BV1A 1JDVA 3JXEA 4BFUA 3CVVA 4D8WA 1E4YA 2OZKA 3LWZA 1TU0A 2XWJI 1XA0A 5CM8B 1HYBA 3G2HA 2DX7A 3ADKA 3HEAA 3H9EO 3IODA 4ALJA 4WBNA 1NP6A 2IYEA 4CMBA 1GAEO 3S5UA 4YLYA 3PXAA 2A9QA 1QHNA 2CL0X 2FUKA 2JEZA 1V5WA 2XYHA 2YNMA 4GICA 3BK2A 5BSFA 4DR4B 4AZ3B 2D1SA 5AW0A 3JQAA 1OVMA 2G9UA 3V7WA 4HC4A 4IIXA 1O97D 3QX9A 3WAJA 3PG5A 3N9IA 4PCLA 4BVFA 4MW4A 4CEHA 5DNDA 3R7AA 1U2RA 1ZH0A 2ZBGA 5I9MA 1D7OA 3MMSA 5CVCA 1KRWA 2QTMA 1ZW6A 2BR5A 3F6EX 4OU5A 3PJRA 1UDRA 2XODA 4MGZR 2QT9A 4CQMA 3WL3A 2BEVB 4FTWA 1IH8A 3M7IA 1JNXX 3IDAA 4GUAA 1RE0A 3JRWA 3SJUA 2AS0A 4FW8A 1WXIA 5D85A 4FCWA 3X1MA 5EOVA 3EX7C 1NVUQ 3K0SA 4UOEA 1IK4A 2R47A 4UHHA 4X7MA 4Y2GA 4G1VA 1ZCZA 1J8QA 2ZR9A 1RRPA 2A84A 2DHRA 3NTUA 3A1TA 4C2BA 2VJAA 4BFLA 3NQ41 4LQ4A 4HNGA 4Q5IA 5BSTA 3ZV7A 1UEIA 2DC1A 3KUXA 2ZP1A 4R98A 1AF7A 1LW6E 1LDEA 1JG4A 2KX7A 2L82A 3W3AA 3ZY6A 2HLHA 5L3ZA 3UCEA 2Y2VA 1Y33E 1X6VA 1XXHA 2GARA 2HMWA 2POCA 3BWDD 4DT1A 4Q03A 2PBZA 4DLBA 3ZWXA 1TQ6A 5H02A 1FRNA 1FDTA 2QTAA 3OU7A 3T3GA 2ZI5A 4CUJA 4DA0A 3L5KA 4BKOA 4FXPA 1ECPA 3AUUA 3QE2A 4IV0A 4D42A 3W2IA 9ABPA 2HGSA 3D3JA 1N78A 1DU4A 1P3DA 4O0LA 3REQA 4RJKA 4DGQA 1J8MF 1GPNA 2PIAA 3KSMA 4NQRA 2LRHA 4QDOA 1MV5A 2CLHB 1ZRMA 4J16A 4RKWA 3TDKA 3IOBA 2MCFA 1MIHA 2DF8A 1NJ2A 4EX6A 1EHCA 1Y42X 2PCJA 3NJ8A 3E8MA 3NKLA 2RIRA 4Q39A 4EZBA 3IMKA 1QHFA 1I1NA 5JJLA 3VV3A 3AR2A 2AN1A 5I7OA 4GMKA 3K31A 1ZHOA 2OZEA 4GPIB 1YRHA 1UZMA 4G5SA 4OJNA 1K5PA 5KTMA 2CLKB 4P98A 4Y2VA 1MB0A 5AVZA 1M54A 5G4LA 3UWOA 4RH1A 2E5WA 2QMQA 4L8VA 4RPJA 4JI3B 1CNEA 1B00A 1I2CA 1NNI1 3B53X 3ZD9A 2I8LA 1N5DA 2VNAA 2O8NA 2YHUA 4TSFA 3ICPA 3UZUA 3FWKA 1C8KA 4YEDA 4K8RB 3S3TA 3VNAA 4MDEA 1FFXB 3K70B 1O5TA 1PJ4A 3TW8B 2QGNA 3JZDA 1P1BA 3RC3A 2YWEA 1M8JA 4QJ3A 1JKJA 1ADGA 2WSYB 2G9NA 1SCBA 5IM5A 2ORIA 2WFAA 3Q9LA 1G8GA 4EG1A 4CIYA 1BE1A 1IC6A 4ZHQA 4LV5B 4O4HB 3VSAA 5A06A 1R18A 1ZDMA 3WWOA 2VWQA 3CR7A 1KVRA 2FYTA 1U11A 3MFYA 4R3WA 2BFCB 3DBLA 1G18A 3P20A 4EGJA 4ALNA 1RWPA 1REQA 3GRRA 4NZYA 1J4AA 4GYKA 4E15A 1PS0A 3CLTD 4ESOA 4ZI7F 2NT4A 3OHMA 4FEAA 4JI0B 3B5IA 4C0HA 1SVKA 3I45A 3RVLA 3VTFA 3LX8A 1X8LA 3MIIA 1YOVA 2C2HA 3TTYA 2FQYA 3RRNA 1ZK4A 4NBNA 1EMDA 2BFMA 5KYWA 1VPDA 2BH2A 2EIHA 4HT3B 4PC3A 3EOZA 3B6JA 4PNPA 3QVVA 2G9ZA 1CVRA 3DZGA 2NXCA 1E3JA 3IOEA 6PFKA 3SVLA 5ALHA 4DV0B 4BGDA 4B35A 3MBKA 3E15A 2XDQA 3L7MA 1V16A 1W85A 1YH3A 2A57A 2CC2A 4XOUA 4ZAVA 4NCNA 3G0BA 5LU8A 4H35A 3A9CA 1V1JA 1YKFA 3CEPB 3R3HA 4LSWA 3CF4G 5IUKC 4DTIA 4CL2A 1E1CA 4MP8A 1VSQA 2C2YA 3HFRA 5GJWC 1NOIA 2XCLA 2EQBA 2I3DA 3QA3E 3EQZA 3EVTA 3FTEA 2FW1A 3N8DA 2O3TA 4D99A 2P2LA 1VL6A 4JL5A 1I10A 2AI1A 4AQ7A 1RP7A 2D7CA 1GUAA 5BNZA 2A8YA 1SCIA 2G83A 2KQUA 4LZLA 4XYLA 6REQB 1E9EA 1HORA 3F5SA 1A96A 3RUPA 1XAHA 1RKVA 4RCYA 4BQOA 1VP3A 3O4VA 2Q9AA 3BEDA 4B6RA 1SXQA 1UM8A 5FJJA 2HH9A 5JCZA 2I6SA 2DFVA 4EJSA 2WQ6A 4KTVE 2JCXA 3DDUA 3WMWA 4DABA 2NV0A 1EFPB 5TGDA 3F7MA 3TL6A 3U81A 4XDGA 3ENVA 1O77A 1UJ6A 4YJ2A 3STXA 4ZJUA 2XNKA 3LYHA 1SC6A 3AEXA 1CDEA 4BEVA 3GJ5A 3EXHA 3LXMA 1RQ2A 1CF4A 1F8UA 1Q22A 1AJEA 2BCJQ 3Q1KA 4ZV9A 4NMXB 1L4YA 1MO4A 4O5OA 1AH2A 2F1RA 1NFFA 1A8QA 3B6MA 1JR3D 2VUSA 3G2OA 4N6OA 4YAOA 1UK8A 3UK6A 3ZBTA 1I5EA 4QGGA 1TL7C 3G2QA 4CUZA 1CZKA 1PT6A 1GVNB 1G21A 3IPAA 3PNPA 1LZKA 4JQOA 3EPHA 1K0FA 2R48A 3PFBA 5JH7B 2V9PA 3CLSC 4KK4A 1HMPA 3C43A 3I9LA 4AXBA 3VVCA 4CVNA 5DNUA 2JGNA 2O14A 4Z3DA 3G0HA 5AJHA 1TM5E 3VNUA 3CZCA 4HQNA 4QECA 5HJ5A 4BX0A 2I2WA 1AKTA 5AW8A 5LLTA 4G5OA 4QG7A 3KSBC 2EC5A 4J0QA 3KB1A 1GGVA 4IQGA 4ZVRA 4FZJA 3LECA 5MFPA 3PLAE 4WOCA 3M6WA 2RKBA 2CCGA 2DSNA 3TD2A 4YY3B 1E6MA 1UMBB 4UBKA 5CEEA 3CZ9A 1Y7HA 3Q85A 2Q1TA 3P26A 3PB3A 5BORA 2V5VA 1SZJG 1Z0SA 2DHQA 1ZLXA 1YKGA 2VWPA 3CW9A 5EKSA 5A9SA 2HHHB 4A23A 2AUMA 3FD8A 3PUHA 1HMYA 4HYYA 1O0BA 2FMTA 1U5BA 3UJAA 4TQAA 4RYLA 3RAFC 2ZR8A 4BXOB 2FQXA 1YC2A 2QM8A 1ES9A 3WY9A 1EX6A 3H3XA 3OURA 5K3SA 2PT9A 2V7PA 4JAVC 1CJBA 4L08A 2HAEA 3TLXA 1XKTA 1O96B 3VPXA 3X0DA 5K4HA 5FYDA 1Z7EA 1AN9A 1PZGA 3WG9A 1KR2A 2GNOA 5HEKA 2P9QA 4B4UA 2OHHA 1UBEA 3E5NA 4HK4A 2C57A 3CVYA 3HJRA 3LNTA 3V1KA 3NM6B 4K6MA 3PNMA 3Q8MA 4C78A 1E5XA 1DBRA 3PXXA 3ZDAA 1GAJA 3QFRA 1UQTA 2WPNA 5JDIC 3K6JA 4KQ6A 2WT9A 2BGGA 4UMFA 4QA9A 2WV7A 1FTWA 1ZSNA 2OK7A 3C41J 4DYDA 5AVYA 4URYR 2IDKA 1GZVA 4N1AA 4O4IA 4G8BA 5ENZA 2PM8A 2EKZA 3DTNA 3O8QA 2BF7A 4D43A 3ADPA 4TKMA 5CVVA 3E0QA 2XHZA 1KQ3A 1LSSA 1MO2A 2Y1KA 1LX7A 1HZZC 1AQ6A 1R8JA 2GYUA 2JGRA 5T6MA 4D3ZA 5JV5A 4ZAFA 1R8YA 3HBMA 2EFHB 2CBXA 2IYWA 4JIGA 4Y2QA 5DHUA 1DKPA 1EK2A 1YAHA 4GM0A 4QNNA 2CFIA 3PDIB 1QH8A 3I9V1 4EGFA 2OAP1 4FCTA 4FBMA 1W35A 3SOPA 1BFUA 5E8JA 4YIHA 1UBMS 3IC5A 4AURA 4J9VA 2SNIE 4XOIA 2QZPA 5AIBA 1NRIA 1W73A 1C81A 1R9NA 3L02A 3L92A 2ZUEA 1VLZA 5KNDD 4J07A 1DRWA 1IY2A 3MINA 5FNZA 3AUJB 5FQNA 2G6TA 2A58A 3WBFA 4UCWA 3UAYA 4CF6A 3P9PA 1I0IA 3KR0A 1DXOA 3CGGA 2A9FA 3G2KA 2BFBA 3N3BC 3PUKA 2EFEB 1X77A 1N6KA 2A4KA 4TRRA 4F7WA 3IE2A 4L9WA 5JS7A 3HYLA 4FIDA 4ISBA 1IIRA 2IYQA 4JJFA 5JYBA 1TYEB 3SX2A 4NBSA 3LYAA 3O9MA 5JFOA 4TTJA 1KAQA 5H4HA 3WADA 3KBOA 3LA6A 4M9UA 1BKYA 2B8JA 5K3OA 1F2UB 1GZ5A 2OHOA 3IUMA 1RQGA 2VJLA 4M1KA 5CB4B 4RK0A 1OBVA 2EKLA 2Z1MA 5IARA 2GBGA 3FRIA 3IJ5A 3IO3A 4FDTA 3AB3A 4IAOA 1J42A 2NU7B 1N6PA 4EKYA 1T3HA 5JT1A 4ZV4A 3VX3A 1E2QA 3I73A 3QU9A 1T29A 1YR1A 2W93A 2B30A 1N2IA 1VI5A 2JFWA 5AXBA 3RC1A 3SK0A 3TSCA 2WB2A 3GLFE 1Q2UA 4YCJA 1DJNA 2IT1A 5GONF 1SU8A 4RULA 2QVCA 2XIJA 5A2QA 2H3HA 2R7NA 2UUAB 1X42A 3BA6A 3FOFC 2JJQA 5DM70 3DFIA 4ZU3A 4BLWA 1MC8A 3TGPA 2EFDB 2I71A 1MKYA 1ZXLA 3MWEA 1Z33A 2YOFA 3BGIA 5ALTA 4Y7CA 3VKFA 2XQFA 1JU4A 4D3FA 3A1FA 3KB2A 2P2SA 4HEQA 4KWIA 2UV8A 3R24A 4IMJB 3GB9A 3TOZA 1J0EA 4DRZA 2ZRHA 1P2TA 3PJGA 4PE5B 4NENA 5HF9A 2GAFA 4EYKA 3DBRB 3DTVB 5LMUB 2HL6A 1FVOA 3BORA 3V8BA 1C41A 4MCAA 1J5PA 2N1BA 3EIUA 4Q4JB 3SDSA 2JI8A 2JJ2D 3ZS9A 2NXWA 4KODA 5HIIA 4AVYA 3OJCA 3ZVMA 5B3JC 1WV0A 4RTOA 3O38A 3JR3A 1ZRSA 4YO8A 3ROPA 2ZGVA 1EH5A 1Z35A 3LHKA 1KEUA 3LPCA 4I6JA 1QB7A 3UT6A 4EVRA 5CXQA 5J43A 4ABTA 1UZUA 1AS3A 3DMDA 3H1GA 4I9NA 1PWEA 3OO0A 4YRFA 3AJAA 1H42A 1UWLA 4UASA 3DT6A 1SULA 2ZIZA 4M9ZA 5SYAA 1WCWA 2Y6VA 5TGZA 2Q5JA 3EZ9A 4PNZA 5B64A 3KDSE 4FEYA 1B14A 1FX1A 1P0IA 1UMDB 3R3WA 5BSUA 4EF5A 4EJ0A 2VI5A 3K3PA 1A71A 3HRKA 1IQUA 4QRDA 1N8KA 1VTKA 3W8RA 3U09A 3GLVA 4HAZA 2X9GA 3G02A 1TX4B 2CLSA 3KOZA 1QZTA 1VHWA 3QIVA 4HWSA 4H2DA 3TSYA 4GH5A 1RYYA 2VSQA 3BTSA 3KSRA 3VPCA 4LOAA 4RMHA 2EDCA 1OV4A 2GK3A 5FNVA 3SBXA 2BM8A 3JSAA 2R5NA 1ZICA 3KYBA 3O8OA 5TXGA 1CIPA 4QU5A 3HSKA 2FPSA 2GKGA 2OORC 1G7TA 4QDJA 1G41A 2ZBFA 1YBVA 3FA2A 4B3MB 2QMYA 4LYEA 4KRYA 3DZHA 4XUEA 5EVCA 1CJVC 1BEEA 1FYEA 3FR8A 2CF6A 2N42A 3OETA 2ODQA 2DVMA 4M87A 3TQFA 4YMHA 5KTYA 4YR9A 3CX8A 4E08A 4A8HA 1DC7A 1ZUNB 1KO4A 1AHHA 2ONYA 3F1LA 3GEDA 3MBIA 4KKVA 4QU0A 4BZWA 2CFTA 2QXTA 3D5EA 3H4TA 5HKKD 2ADFA 3VKWA 4AI6A 4JWKA 4JBLA 2O20A 1J00A 3MWGA 1ABFA 3QKRB 2WYVA 4EDHA 4GW3A 4Z51A 5KNBD 3C5EA 1QFJA 1EFKA 3RJ5A 5KPJA 2I4MA 5DX0A 2XKKA 2CT8A 1A5BB 2JW5A 3DBVO 3I32A 1Z13A 1RXSA 2UVPB 3DL4A 4HLDA 1VSBA 3V3KA 2J9XB 4DZTA 4L72A 2HK6A 2FX2A 3J81k 3Q5DA 1FU8A 1D8AA 1YIAA 2AKAB 3GEGA 1K9SA 1RHQA 3WHLA 4QGFA 2NSLA 3EZYA 4H4EA 4CEIA 4XVQA 1NN1A 1N7GA 3KTAB 1TW3A 5D87A 5G3ZA 4P3YA 4BVHA 1WRBA 3KHSA 4QLBA 5JTUA 3NCHA 4HDMB 2DPMA 3H8SA 1JB1A 3AFNA 2OCPA 4YI5A 3W5HA 1SC1A 4HI0E 1R4MA 2FW7A 5JZMA 4IO0A 5CB4F 4GQIA 1T5BA 2AL7A 4NSNA 4P0TA 4ZQGA 2CUTA 1I6LA 4KWTA 1PV2A 1KI9A 1GUYA 4R6WA 5H4GA 3WKCA 4HQFA 3VM6A 3I9NA 3L8HA 4PLYA 2QYTA 2AI3A 5EIOA 1YWGO 1TZJA 2HCRA 2QDXA 3CU5A 5EIFA 3SZOA 2QT1A 2PGXA 3N75A 2HUNA 4J49A 4FYJA 1IPFA 4PAQA 4MRNA 4OX9B 3C48A 1F7VA 2REQB 3UK0A 4RTMA 4GZLA 5D5PA 3QWHA 4JXZA 4R8SA 1ULAA 3ACCA 3B6IA 1X7ZA 2J9YB 4QYXA 5CX4A 4QUEA 4C6SA 4LPSA 3EJ6A 3OLYA 4Z1OA 1ZOSA 1T9KA 2F3PA 1G20B 4YROA 4FEEA 4RVOA 4CI9A 3AV3A 4M6WB 1GNRA 3FDXA 3G5MA 4JOSA 4WKCA 5FUXA 3RROA 5AVTA 1KEVA 3CEHA 4NHOA 2ZFUA 5DFAA 1OXBB 4JFAA 1X1BA 2FX5A 5CIWA 3D7MA 4HUJA 1S2MA 3UOAB 4BQQA 2A14A 3VO8A 5LQJA 2YWCA 5IH7A 1KE2A 4UVGA 2JEYA 2J3QA 4YV1A 2Q7DA 5KQGA 2IYTA 1VFNA 1L1RA 4FFPA 3EFHA 5AKEA 2ZXUA 1RXYA 2Y92A 2ZATA 3WWYA 1CP3A 1D2CA 4EFMA 2C31A 2L0XA 1CY2A 5IUJC 1T0BA 2NXEA 1PJ8A 4ADSG 3UMFA 2NVUA 2Z2XA 4A8JB 3E2PA 3LQQA 3I5MA 1C7JA 4PHGA 4Q9JA 4F72A 1QIKA 1LBQA 2PU5A 3RRXA 4WZBB 4LJLA 3IGFA 1Q74A 2FQ1A 1C80A 1WVGA 3L06A 4GGMX 2BWJA 4RZIA 3IHLA 3MTDA 5HIKA 4ID9A 3D1VA 1EGVB 2YHIB 1SD1A 2H1WA 3A1EA 2OEPA 5CGQB 5TQVA 1T9GR 3ZCSA 1SVMA 3EBOA 1GQYA 1FDWA 4LGYA 3E9YA 2GK4A 2QLMA 1H4TA 2I4OA 3FB1A 4K6OA 4MKXA 4NYJR 4XWYA 4Y2PA 1XB2A 4NBTA 4BBAA 1UBOS 3K1TA 1NN3A 2VFAA 1THMA 1G16A 1TYZA 2D4HA 2E4UA 4QHYA 3GJXC 1OPXA 1KFBB 2YZGA 4AWAA 4GE3A 1QP8A 2Q5HA 5CR9A 1IPEA 1JDBC 5EHZA 1FXWF 2LGJA 2Q29A 3X44A 4CYMA 4X92A 3OT1A 1BA2A 3ANMA 1GG2A 4FFLA 1IN1A 4JZYA 3UPUA 1JWLA 2OC4A 1AX9A 2DPLA 2IZ1A 2P5UA 4B3FX 4JYZA 3E48A 2WILA 3NT5A 3OZTA 1A4UA 5SZKB 1PFGA 3MT9A 1PJSA 4MLDA 2IHNA 3GDFA 1RIFA 1OFHA 2AW3A 3CH4B 3H9JA 1W76A 4QGHA 4AUEA 4EYOA 4DV7B 1MZPA 3OCYA 4DIKA 3R0JA 2C9DA 3R20A 4RORA 2R7KA 3MLAA 3KHUA 4PZYA 5GZ3A 2P5YA 3GUZA 5DGCA 3SE0A 3PTZA 4Z1MA 3IIJA 4I5GA 3DVSX 4MV4A 4MW6A 4NCHA 2PMEA 3TR0A 1WXHA 4D9FA 4DLTA 2Q1XA 4GL2A 2EJCA 5B7GA 3QLTA 2YICA 2E4ZA 3ZE2B 4ZRNA 4ZFNA 1KFCB 3QE9Y 1M5TA 1GCAA 2H7YA 4ARUA 1K86A 3OMLA 1XEXB 3OOYA 2GPTA 4DHEA 3BZBA 4I9UA 3FSGD 1X9GA 3FNGA 2RHBA 4MQ4A 4BC1A 1H0RA 1J0AA 3AOEC 3EZ6A 4N12A 1QYRA 2W6PA 4UHJA 5DCWA 2JHAA 1RJ9B 4L6AA 2QVGA 1VI6A 4JN6B 4B3IA 2OOSA 3GK3A 4Z9BA 2P40A 3TGWA 1O94C 2O1SA 1XVVA 3H1EA 1CRQA 3A4NA 3A8TA 3ZTWA 5KTRA 4JJKA 1I80A 3NIGB 4MVXA 4OMFG 3OX3A 4YJ3F 5IBPA 1U6IA 2PZGA 5BT9A 3S8EA 1BOOA 1P45A 2EX1A 2HA7A 1T3SA 2QZ4A 4ZYLA 4QXQA 1KERA 5HQTA 4FMPA 2PL9A 1Y82A 4JVOA 1BXGA 3L1IA 4NEHB 1X8XA 4OKIA 3S68A 5KIAA 3I61A 1GQQA 2IXDA 3NNSA 3WX0A 2HF9A 3HGTA 3L01A 4OATA 4MVWA 4TMYA 4YAKA 1IZ9A 5KDDA 4EENA 5JS1A 3BE8A 4IUYA 3MJCA 1WL8A 1JBQA 1ECFA 1KDRA 4FYMA 5DULA 4OSEA 2BHLA 4IJUA 1FIUA 3RSZA 1NWCA 2ABWA 3B78A 3K0AA 4D56A 2BFEB 2BR3A 2Q41A 4UEWA 1S0UA 2G0AA 5ILGA 3U62A 1FFEA 2PYDA 2WOJA 3WB1A 1OBFO 1BYIA 5KDOA 5EIEA 4QXMA 3E3LA 3GAFA 4IO1A 2RK6A 5J5VA 5KYXA 3GG2A 2P67A 4AY4A 5DHRA 1MR3F 1OWNA 4ZYYA 1AK1A 1NR1A 3HLYA 4RA9A 2C29D 2XAUA 2P41A 3TNLA 1UOPA 1IOWA 4D8VA 4WCDA 2EQ5A 4F86A 3EJWA 2RFLA 3CUUA 2FETA 2D0OB 3KUDA 5KYYB 3PI6A 4MGYR 3R41A 3SJZA 1AGNA 1COZA 4Y6OA 5D84A 1MB4A 3RC9A 3ZLTA 1UBRS 4MVJE 3DOJA 3VU3A 2OGZA 3RUEA 4K9DA 5J4LA 1NZDA 3ITEA 4CU2A 1X7YB 2MOKA 2JFBA 3DPUA 4IDEA 3HPRA 4XR9A 1GFZA 1PT5A 2OXEA 2X0JA 3LC1O 3G59A 4GPTA 4IHJA 1ELOA 4I6EA 4UMVA 3ZV4A 4A1OA 3SAJA 5IKPA 1V8ZA 2O54A 4HOYA 3FX2A 4U02A 5HG0A 5IG2A 4X1OA 4DLSA 2ZR7A 4ZQBA 4HX2A 1PYDA 4R9VA 2I29A 1Z4PX 3THWB 2ZLBA 3RUDA 3C3WA 2VDJA 1AUVA 3JYOA 4FBLA 3M89A 4G0ZA 4AECA 1A7KA 3PX7A 4K88A 5F2EA 1QR6A 4B2IA 2OK8A 3TXYA 3TZQA 4EKDA 4J2HA 2G67A 3BBLA 1E0KA 3AF6A 2A5DA 1WUIS 3ASVA 1G4UR 2FEOA 5ISMA 1GPUA 1NTRA 2VP5A 2Z1DA 1CR0A 1MN6A 3G79A 4H7EA 1SHKA 3C3MA 3KR2A 4FX2A 1BQ4A 4P7GA 4U3JA 4P7BA 1P19A 4V3BA 4WKBA 3FVTA 3STYA 4I1YA 1KR5A 2B0CA 3OZ7A 3BMXA 4IXWA 2VC2B 3V4PB 5TQ0B 4F9FA 4CLEA 1OREA 4CT4B 4P4SB 5LM3A 1M1YA 2O8FA 1VCHA 4DMKA 1FPQA 1N5IA 1PO7A 2HCFA 2HF7A 3NASA 1PQPA 4F5DA 1NW9B 3WMXA 4B4KA 2WM3A 4TTAA 5BSHA 4U7HA 4X20A 2PZBA 1J5EB 1BU8A 3FNEA 1GSHA 1XCBA 2WHEA 2QORA 2CXHA 1OBHA 5BSVA 5JADA 2OAGA 3LT0A 4FHFA 5IANA 5CNMA 2IZ5A 1FP6A 4RAOA 3GC6A 3NEJA 3ZLBA 6LDHA 3Q7PA 3U1VA 3UFXA 1PV4A 2B3TA 1J8VA 4HLUC 1FUKA 3THXB 5MGBA 1DAEA 1E59A 2V1XA 4DA7A 4G0NA 2RGYA 3GFBA 3HJCA 1OLUA 3DT8A 4IZHA 2Z2YA 2AC7A 1YF3A 1CJUC 7ADHA 5DNCA 5IVPA 1ONNA 2J0SA 5IP5A 1B3BA 4PZUA 4MWTA 1KSJA 3II6X 1A1SA 3A3KA 3L7NA 4YT8A 1I4DD 2NO1A 4NJEA 3RVJA 4JB2A 3PGKA 2PH1A 4NYIQ 4PXYA 1H2AS 4M21A 1U98A 2H65A 3O83A 4RV9A 4YK7A 1AXEA 5DDIP 1D0SA 2EBWA 3BILA 5EZ5A 1KP2A 3EDYA 3QLVA 1ZIOA 3QKUA 4MUEA 2ET6A 4KO2S 2ODPA 4YP7A 4W5JA 4X7BA 1CR2A 1QVVA 2YXDA 1WNFA 3DHVA 2V58A 5TEVA 4S05A 2GETA 2GWHA 3GH3A 3HI6A 5F4BA 2QN2A 3BH6A 1YA6A 1J24A 2RAPA 4LBYA 4JR1A 1WCV1 1YBMA 2BELA 1SY7A 4YRNA 1SEVA 1PZNA 2H5LA 3QZUA 1FNCA 1OTYA 1QFMA 1R4ZA 1UPUA 3ABSB 2FMIA 3OLXA 4NFHA 5A62A 3ELBA 4D98A 1A3CA 5KMGA 4PAGA 2P6NA 2ISSD 4HNAA 4LYHA 4E03A 2VF5X 5F2KA 1IHYA 3PDJA 3F2VA 2QMUA 4FYPA 2DKNA 1E1RA 13PKA 1U2GC 4W5WA 3L0ZA 2FPKA 3IT1A 1OX4A 1BH6A 3OFVA 3E53A 5DN9A 4Y7DA 1BAPA 2J0UA 3P96A 2VNHA 3QYFA 2GCGA 3L82B 3VYSB 3HN7A 1Q3HA 4EF6A 4QUDA 3WIOA 2AC4A 3AR3A 4MQ6A 4UDYX 4X71A 3HBFA 5LQDA 1NBWB 1OYOA 1BKSB 4GD3Q 1KZHA 1MHTA 3RVBA 1QVRA 1W96A 4IOKA 5KVVA 3R3ZA 1R6VA 4EG5A 2VYVD 3SZLA 4KHZA 5CDFE 1RQRA 2GCOB 1EPUA 2IK8A 2IOHA 4D96A 1MTZA 2KLHA 3TQSA 1GKLA 1IHOA 1U3GA 3GT7A 1H1DA 2V7WA 2O2YA 4JX8A 1YQ9A 4EY3A 5IVDA 4EHFA 5ENVA 4GEKA 2OFFA 1Q21A 2QLNA 3IV6A 4Q66C 4ALIA 4H9GA 4QJ4A 5LP6A 5B2FA 4EGCB 2HJGA 3RJTA 2Q6LA 5LBTA 4BLRA 4OMDA 4CTOA 1E6WA 4DUGD 1JKFA 3OPXA 2V7UA 3QYJA 4UPDA 4ZALA 3B7GA 4S04A 1J2YA 1XLUA 1ODIA 2QG4A 4DIFA 1E3QA 2XUPA 3NRJA 4YJFA 4QVGA 5DSTA 1MO6A 2XMCA 5B6PA 5JEDA 4R1OA 2VEOA 1PDVA 3R1IA 1XTRA 1NC3A 1GZ6A 3W5JA 2IPXA 2BGKA 1W5BA 3D3EA 3A6PC 2Y0PA 3IDOA 3SNKA 1AE1A 2V0GA 4ZVMA 1YVEI 3T4UA 4IIUA 3TTWA 1QC5A 4QTTB 3TKLA 1VYTA 2H0RA 2Q9BA 1TD1A 3LUJA 4JKIA 6CHYA 5IXSA 3ABZA 1K6EA 2VKQA 2GZAA 3OM8A 4TSRA 2E9SA 2B7CA 1LY1A 4KVFA 3CS3A 4QBTA 4F93B 3I01M 4OQFA 5FULA 3CZQA 1TVMA 3GDOA 4B46A 5FTLA 4O2BB 4S3MA 1EE2A 1VMAA 4JP1A 3U3MA 4MWSA 3PDUA 2HK9A 2QNBA 4MPJA 3T5GA 4BWGA 4C7KA 3K53A 4GG1A 2ZW9A 2I6XA 1C9MA 1D2MA 1GPYA 4FDLA 1EVKA 1K5HA 2H4HA 4OHPA 4Q3KA 1ODKA 4AMGA 2RJ3A 4LPKA 1YR7A 1MIOA 1P8AA 1RWMA 2F4NA 2UUOA 3EB9A 4CV2A 3OECA 1W0JA 4PLHA 3GWGA 1DMRA 2VH1A 2VP0A 2VHJA 4JHXA 1P17A 3BE4A 1NOJA 1OQAA 1OAKA 1WXFA 2ID4A 3KS9A 2GF0A 3ZLJA 2I2DA 2CFCA 4BLOA 1EESA 1WMAA 2ZE8A 3G8DA 4LBZA 5FUBA 2P2DA 3WO1A 4AY5A 2GPWA 3E3OA 4ZODA 5G2OA 4CU5A 1PR4A 4Q4HB 2C59A 3A4MA 3BQNB 3EC2A 3O2SB 2RMKA 3SXPA 3OQJA 4P6VF 4TS4A 5DK6A 1F60A 1US8B 1DXYA 1Z6GA 2FWAA 2XTZA 1YUMA 2YIJA 4CLRA 4LJ4A 1QPZA 4CI0B 1C3OB 4V0MA 4GLOA 2FSHA 1DEKA 2CHQA 3A1CA 1DG3A 1EFRD 3I04A 4RIEA 2OFPA 1SVNA 3I83A 4UHEA 4DY4A 1MOQA 1NN5A 1ORRA 1T4CB 2C5LA 2Z9BA 5JCOA 4F4IA 1T5LA 3RTGA 3JD4A 5C5EA 5HF6A 1A82A 2OESA 5KC8A 4CM7A 4MJ3A 1K7FB 2NU8B 4QEZA 4UNSA 1K6XA 2I7VA 3DULA 3W04A 3ITNA 1Q16A 3B6ZA 1U0TA 2Q6IA 3IJEB 3W2HA 4FGJA 2ZIXB 3EK2A 4DMHA 3CMCO 2WWVD 1J97A 4P1ZA 2RBGA 3CUVA 3HYNA 2HPAA 4CTJA 1TT7A 1NMEA 1PEKE 3HYTA 5EXXA 1KQOA 4PBTA 3TXXA 3ZZNA 1XX6A 5FR2A 4V0RA 2O6HA 1YE3A 2HRRA 2A0UA 3HGMA 3CZPA 2J4CA 2YN0A 1VJRA 2GS9A 4FD2A 3E5RA 4HAIA 3S0JA 2VBIA 4LFCB 2OCXA 4TYYA 4BNFA 5FUYA 2FWNA 3IXLA 3NORA 2EEPA 2NVOA 3LHIA 2OFWA 4L7VA 1JAYA 1FX0A 2CJWA 2YHBA 4HDSA 1AGYA 3GGPA 3WNDA 2FPLA 2H1FA 4EJFA 4NAUA 4OIFA 3RREA 2IKQA 1Z63A 3N7AA 3C85A 2C92A 2XMDA 1NRWA 3HB4X 4G2TA 3HM9A 4PZPA 2I91A 4C43A 5J23A 4M9QA 4YRGA 1TC2A 1JTFA 3FPJA 1JHZA 2RCYA 4XEUA 2Q6KA 3MTGA 2XNCA 1BWRA 3QW4B 2AHRA 4H3VA 4K26A 3MWDA 2P3LA 1CZUA 1OCEA 3U7FB 3PI7A 2QZSA 1BDIA 1Z2PX 1NQTA 5FF9A 2Z09A 5HP4A 4WKOA 1YRYE 2J4FA 3W7AA 3WO0A 3F90A 3JW8A 1ZX1A 2FN4A 1UBCA 2VDRB 2VHYA 2W6IA 1VRVA 1HL3A 1TJ3A 2Q3DA 3D2LA 3DEAA 3PQCA 4TL6A 1KI1A 4ASUD 4F8YA 3EEBA 4IDAA 2JIOA 1GA1A 3IDZA 3OWHA 4DGSA 3DP9A 5KVCA 2PSHA 2V9ZA 2VF7A 2HBYA 4KBFA 1WV1A 4EHHA 1V7CA 1VHQA 3E9MA 4GX1A 4R9RA 2PMFA 4HDNB 1NNEA 1XZGA 1TKRA 1THTA 3UWPA 4IJVA 1GD1O 5BUCA 1NPTO 3B13B 2WV9A 3VYTB 1ZK2A 5LZ9A 1B7GO 3E2IA 2GYWA 1M3SA 3B8EA 3CZ5A 3K9LA 4LAFA 2NVBA 3E8XA 4QUAA 3D6HA 1S2GA 2X2FA 2HF2A 3B9QA 4HZGA 2H00A 4ETNA 2C3MA 1RLIA 1ZCJA 3I9V6 5JFTA 3SPXA 1K97A 1ZVQA 2VJBA 4P92A 5D5QA 5FB3A 2O3RA 1K8ZB 3N59A 3F98A 2EOAA 2Y0CA 5IAKA 3BXXA 1OUMA 2J67A 1JYFA 1AKYA 1YDHA 5FV4A 4KGZA 2XBLA 1EZ4A 2SECE 2ZYTX 4PINA 1A95A 4G56A 3L0OA 3TEJA 1PFWA 2ORWA 2GEJA 1M73E 4OHCA 5AI8A 4GT1A 5HMLA 1EK6A 2J4DA 2ZSJA 1YS2X 4ARCA 3QVLA 4TYPA 5KZMB 5LOVF 3SFVA 3BCHA 4C2UA 2HA2A 3ZOZA 4OKSA 1WCIA 3SR3A 1I6WA 2I4NA 2XNJA 5EJ8A 1PNQA 2FX3A 2Q45A 2XTAA 3SZ3A 3MHTA 1FSPA 4X64B 5C1PA 2VDWB 1CZHA 1P7CA 3CA8A 1L5QA 2QZZA 1R00A 1Z2DA 3FBWA 4RL6A 3RNLA 5A2GA 3D4PA 3O93A 4JB8A 4KR9A 3HP1A 2VNIA 4UULA 5ALVA 2PXAA 3P8ZA 4EW2A 1Q84A 4D3YA 3IAM1 4FM9A 4V0QA 1XMSA 4HEJA 2H1SA 5DBEX 2I2FA 3ZKWA 4EG0A 4XCQA 4J7CA 3K4QA 2D6FA 1XTKA 2BEWA 2HZ7A 3KB8A 3DMFA 1NR5A 4XVUA 1W87A 1W0KD 4US0R 5C18A 1G66A 3IMFA 1L5HA 3NBQA 3ADCA 1P2FA 5D2CA 1UOQA 3KVRA 3SSNA 3WE7A 4J2OA 1VE1A 3NM4A 1JHPA 1W4RA 1SA0A 3AEUB 4RW0A 4F3YA 5AW2A 3LBYA 4MI9A 4NCKA 2QX4A 4UBIA 4G8CA 2V96A 1OGJA 3NAZA 5AK4A 2IU0A 3DDZX 4LZAA 1ZUHA 1TT5A 1GTL1 1MZVA 1SR8A 1XR3A 5AM1A 5REQB 4B3JA 1SUDA 1WMDA 2ZYSA 2QW0X 3B3AA 1JAZA 4PO3X 4EPTA 2D0PB 3GAAA 1IONA 2K4MA 4RPIA 1IXZA 1IZYA 4OH1A 5BUQA 4OXXA 1A9RA 3CLSD 3NWJA 1BS1A 5AP9A 3PLNA 1YASA 3GT3A 3KLMX 3T38A 5T3UA 2FFJA 1SQ0A 3VISA 3TD6A 2NP7A 3D8BA 2DBZA 4Q7KA 3LMKA 4G4SO 2Z8ZA 4EYSA 2CD7A 2IDJA 2XMBA 4JJ7A 5KOJB 2YV2A 5EYPA 3D4IA 3FVWA 4M0DA 5JRZA 5LZ4A 3I4LA 1K7XB 5C4IA 2O8BB 4BVLA 3Q5GA 3WYDA 2PJZA 1QQTA 3FRJA 2Y3IA 4PLCA 2J3KA 5ADHA 3ZV5A 4L22A 2BFDB 5A3VA 4RKRA 3JQGB 1PW5A 1W52X 2AVNA 3DYVA 2REOA 3ISTA 4L8GA 4LV6A 3VR5D 3ZE1B 2EDAA 1SXGA 1QDUA 3O4GA 5EHIA 5E1MA 2CLIB 2JC3A 3I72A 5FQOA 1CY4A 2VP4A 4YWHA 3ZU4A 2FZCA 5EJEA 1G8YA 4AJOA 1WQ4A 1KMHB 1L4HA 2TECE 3SZUA 1JDUA 1MC5A 2IOFA 1YDGA 2WDPA 4H1HA 2F9LA 3PE6A 4BFTA 2O59A 1FDSA 3GAMA 1B1CA 1NF3A 4RK4A 5COAA 2XPCA 1R0SA 4DLRA 1P81A 2G77B 2GCNA 4ZCLA 4RTJA 1QUFA 4LTDA 2WVHA 2JJYA 4MCIA 1JIQA 4D45A 3AX6A 1KY3A 4L27A 2EWWA 1ISGA 5T4HA 1LDYA 4JVLA 1SXIA 4Q7EA 4PQFA 2CD9A 3EE6A 3BH0A 5FO0A 1TLTA 4RSRA 3THOA 2MSEB 2X8WA 3MCWA 5BN3A 1T6XA 1SN7A 1T36B 3EGDA 4AKHA 4B75A 4WGFA 3JZAA 3IH5A 4DZRA 3V7UA 1TQ2A 3ZU3A 4BU0A 4AICA 2JI9A 1BX1A 2ZREA 4HMPA 4I3GA 5DTQA 2OB1A 2GFHA 1B6GA 1ZC3A 1DKOA 4DG9A 5BNWA 3D8HA 1ZKMA 3DMTC 3K72B 4AJEA 3P0FA 1ZI8A 2CMGA 2L18A 3LY8A 3LZCA 4II7A 2W0SA 2OCLA 5FI5A 1N6RA 4AU1A 1A7AA 1E3LA 1R0WA 5DX1A 3ZXXA 1R8SA 2DPXA 4ZGBA 2A33A 2ZS9A 4RY0A 3BGSA 1MB2A 1ZCAA 4K5QA 1MT0A 1KSFX 3OQHA 4HDQB 5H8WA 4I4TB 2IBMA 4OH7A 4YMIA 2UXDB 2C54A 5BOVA 1T13A 4YRZA 3D0KA 4UM9D 3UJ6A 4DSOA 5CA0A 5DOZA 2A5LA 2BI4A 2V65A 1V1RA 3KJNA 3PUIA 4O02B 1FDVA 1KZ7B 1ZXBA 1RJEA 3L1VA 4G5GA 2G72A 2YXBA 1C7EA 1K6JA 1E0JA 1PGNA 1QNLA 3U3ZA 2XUHA 2Z08A 1PT7A 1PJRA 3PUYA 4GF5A 3AV0B 4YJGB 3HKCB 5HRCA 1AUPA 1J9ZA 4OHFA 2HDNB 1RYFA 3DZKA 4JITA 3VPHA 5LBIA 1I5OA 3COSA 5IF3A 4H17A 4L4UA 5IULC 4NJMB 5IF9A 3D7SA 2QBYB 3OEWA 1JEQB 3KZNA 5JY6A 4PXAA 4DRXB 3TPFA 2OHIA 1ZHHA 5AW7A 1LPSA 4LSGA 1R0XA 1K27A 2QUKA 4TLAA 2IHJA 4YFVA 5G02A 4ZOBA 3K0KA 3RNOA 1T1GA 2F3SA 1DBQA 4ZYVA 2FRXA 1KY2A 1E9FA 1NGSA 2CJYA 1SFRA 1FFBA 2CHUA 2AOUA 2JGFA 2R65A 3O82A 3F4KA 1SB9A 4KDCA 3SMVA 1OWOA 3RYFB 1GV1A 4X7RA 1YU9A 3NTXA 421PA 2FEWB 3PXBA 2ZT7A 1QIGA 4K9NA 3DLPX 4PSUA 5HM6A 5JSFA 2RI6A 1NSFA 3CX7A 1OXSC 4KH1A 1YB4A 1Z4IA 1E7MA 3HA5A 1IBCA 3KWLA 4OUKX 1M6WA 2DQKA 5I8ZA 2GBIA 3HBAA 4BX9A 1NP3A 4BU1A 2AH5A 2D13A 4D46A 4WRRA 2ALJA 2K87A 4URZR 4EHNA 4DWWA 4MA4A 1OIWA 2OKCA 3HBLA 1Y0BA 2H9IA 2OKGA 1U0LA 5ESRA 3OICA 1L7EA 4M1EA 1XCOA 3IUPA 5AHRA 5EJMA 4EQZA 1KS9A 3T3IA 5I01A 1JLRA 3FFTA 4N6GA 3BL5A 3RRFA 3LQ1A 4ITVA 3HO8A 3N2GA 4I2VA 1CXZA 4C5CA 2WP8J 4ISCA 1Y5NA 3P7MA 4UZFA 1AIPA 1U6KA 3QV2A 2WLTA 4HKTA 4AG3A 3DTTA 3M33A 1JMVA 4F5WA 1AN0A 3V00A 4X1KB 5HUQA 4N7MA 3ZQJA 3WICA 2OBFA 4RIIA 1I9GA 3RHZA 5BWLA 3ZY2A 2C1XA 4L4ZA 3OCXA 3BTVA 4L07A 5DGXA 5J5CA 3UATA 4AUNA 3B7WA 2L19A 1L9XA 3NBFA 5EI5A 2HQBA 5HIMA 4ZAXA 1U7WA 4EW3A 3FKSA 1RXUA 4RK6A 1WMFA 4WXMA 2PGOA 1Y5IA 4CW7A 3NAGA 2RHHA 1M83A 2DR3A 2G9QA 3MCZA 4PPNA 4XYGA 2R84A 4FYYA 2AFIB 3B51X 1LNQA 3T1OA 1DKRA 4L2IB 3VU1A 5I7SA 1WDTA 2RB5A 1CY8A 4G24A 2GD1O 4K7JA 1DBSA 4OBBA 1T6NA 2HCTA 4BCCA 3SQWA 4AP6A 5A1JA 1Y98A 8ADHA 2E87A 4O63O 4NHEA 1ZNWA 3W3AH 5TDHA 4N41A 3SX4A 1M6EX 2R6FA 3KVNA 1G8AA 3GG9A 3GEPA 4CT5A 5C1OA 1NBIA 2F1IA 4PLZA 1F2TA 5I9BA 1ECLA 2HO4A 2IQ5A 2ZROA 4I0WB 4PVCA 3RTDA 1V3VA 4GGPA 4ZYWA 4X8MA 5A5GA 3UGQA 1L1EA 4Y67A 1QAQA 1POXA 4PGHA 4XASA 1V96A 2HQRA 3K0FA 5JAMA 1CZNA 2PU7A 1KIMA 3DQPA 4H3SA 5IYZF 4NZZA 4B7XA 4MUNA 1NQXA 4CNBA 3CUYA 1WQ1R 1OIVA 1WULS 3LPNA 2C7PA 1HURA 1GLVA 2R85A 2XSZA 4WOKA 2B4RO 1NVDA 4UNPA 2VPWA 3I42A 1HE1C 3A9RA 2PS0A 1CK4A 1OYYA 2JD1A 3ZDFA 4R0MA 5F23A 4PG5A 1VECA 1C3XA 1R4AA 1ZI9A 4Q9DA 4F6RB 4UU0A 1F5NA 2G09A 1QK5A 3C8UA 1ZP6A 1LJLA 1MCZA 3RADC 2X14A 3V1TC 2FSGA 3B1VA 3DAYA 2FA9A 3O91A 4Y2XA 2Q1WA 3ZOKA 2JIBA 2UXCB 3NBKA 4JQCA 4EKIA 3FNRA 3RFUA 3AHGA 5IVIA 5JNRA 3R77A 4AD8A 2K2WA 3EVCA 4U8HA 5CNKA 1IBSA 4RH3A 4KU4A 1S96A 4XIYA 3T5CA 1LQTA 4HH1A 3Q7SA 1HYHA 1CRLA 1SU7A 1XU4A 3PKIA 4NCXA 4GXTA 4JNCA 5DTRA 2Y1OA 1WF3A 3MSCA 2FSSA 4U2EA 2X5XA 5EY5B 3LT2A 5K0CA 1DV1A 4OJYA 3TQHA 5BQ3A 2P7HA 1MJFA 1ATIA 4CKEB 4XA8A 1CUAA 2CN1A 3S2FA 4D7AA 2OBBA 2ZXFA 4DV1B 4R2HA 1A4XA 4HLCA 3S29A 4QULA 5A5FA 1KFJB 3H5VA 3DF9A 3UMBA 2C97A 1XA4A 2QRQA 5TY0A 4ZCMA 3B85A 3GN1A 5TPZD 1U2DA 1ZAYA 2CNDA 3L7DA 3SIPA 3EPJA 2WJIA 3GJ6A 5HTKA 1LVHA 3NI2A 2AOWA 3M1AA 4W5NA 4QJ5A 3TIFA 2BIFA 5EWMB 5C2JB 3NVKI 5CDGA 3PPXA 1KU0A 5LQSA 4UZEA 2N9UA 1KYVA 1FSSA 5FBKA 4HQ6A 2FP3A 4N0MA 3KJQA 4FFRA 1JR3A 3KYCA 1TPYA 3MXTA 3P94A 2AQHA 3G8CA 1TU3A 4QZVA 2H2AA 1Z6TA 5F12A 1Z0DA 4KAAA 1R16A 5AKLA 5IXYA 4AB1A 4M1OA 5LU9A 1A97A 3GZ4A 4PLPA 4OTZA 2ECKA 5ALPA 5FLXA 2R751 4P31A 1RM0A 3ZHBA 1PK9A 5ITWA 1KAHA 1YCHA 2CDCA 2GHQA 2WD7A 2V0CA 2YINC 3AJDA 4KXUA 3TM4A 3LQ2A 5I7EA 1HR0B 2WU0A 1EGMB 4P82A 4BWYA 1YDWA 4C6RA 1XDGA 4B31A 1J1ZA 2F8MA 3U4QB 1VG1A 1F2DA 4NLLA 3C14C 1HBJA 4X3CA 3S1AA 3T1VA 1V95A 2ZTSA 1P1HA 3NHBA 1XN4A 3UK7A 4L0CA 2FOLA 3K9WA 3KT0A 1B0UA 3DC2A 3OAAA 4I1VA 3W5AA 3INRA 4HZUB 3AW8A 2GX6A 2AZ4A 2G1AA 2JFZA 2ZCVA 4PYJA 4LDNA 3GLFA 3GLQA 1ND5A 1GSOA 2HWKA 2YC2C 4IYRA 2GEUA 1NC1A 1E9SA 1VPVA 2BBWA 2KLBA 4ZVUA 5D00A 3K9CA 4ND7A 1RAGA 1SHJA 2V4UA 3T3HA 2X6TA 1NXTA 1DE0A 1VHDA 2W5UA 3DL7A 3JD0A 4FEGA 4PPGA 5BMVB 4INJA 4YR7A 3H6GA 3N2KA 5FWAA 3AJEA 5CLQA 1N2HA 3TAXA 5EJ5A 2ZJ6A 4UUPA 2PNFA 5AK5A 4IDQA 5B6JA 1AGRA 3ZHTA 5IAOA 3WLKX 2Q6TA 4KWHA 4W7SA 1QHXA 2HIMA 3VJLA 4QDUA 5J2UA 2H4YA 2RGEA 2BV3A 2PLWA 2WIBA 3O92A 3X1JA 4QRHA 1VYHA 3X43A 4B6PA 1LI7A 1E4VA 3KEMA 3HB1A 5AKJA 2PBFA 4R7TA 1V4VA 3K9HA 1KDOA 1PQWA 1IEQA 3MRXA 3ZCVA 1E79D 1G5HA 2ZYRA 3K1JA 4W9NC 1SJ9A 4A26A 3FOCA 4R81A 4N3CA 3GIWA 1J2TA 2WJHA 2B5OA 4BBZA 5JARA 5KHOC 3QKTA 1KZYC 1V11B 4IXMA 3AM1A 1DT5A 2P2GA 2R60A 1YVPA 1G42A 1HTBA 3G6WA 4N5LA 3W6OA 2J9GA 5DXAA 4KQIA 5JMOA 3IUNA 1CS0A 4MV7A 1JU3A 3BQ9A 4F5ZA 2QENA 1QIMA 4NBUA 4LF7B 3KO8A 4G6ZA 3I28A 1MG5A 3X1KA 4WN9A 2MSDB 4MUXA 4RTNA 3U3KA 5G1NA 5KNDA 3CSSA 1T2UA 3Q6IA 3MJEA 4F2GA 2ILVA 2XAAA 3EAGA 3VJRA 2GASA 3BRWA 3D54D 1TCCA 3FPSA 4FR5A 3X2FA 2AXEA 4JR2A 2NO7A 1DIGA 2VO1A 3I92A 4JBXA 1E1DA 2OHXA 4JCCA 4REOA 2XV1A 2Y4OA 3VRHA 1KARA 1PD1A 2E82A 3CEAA 4V03A 5DWVA 1GDDA 2W22A 3ND5A 2P9BA 2PT7A 2D2FA 2R97A 1O94D 4P3NA 1U4OA 4OREX 3NGXA 3JZFA 4C76A 2Q28A 5CFPA 1WDLA 4BFWA 2FP4A 1M8KA 1V9CA 3LYLA 3DWGA 3QG5A 4OAPA 5CYPA 1FFWA 2ZEJA 3DZCA 4FLFA 4LYFA 5EIBC 4ZO6A 1YGPA 5K8CA 4ARBA 2C5HA 2MYUA 3EHEA 3SFZA 2I6UA 3M9XA 1RKBA 3NBZC 2QD1A 4LSZA 5H16A 2OHJA 5JAZA 2EF1A 4Y8VA 5DWQA 4P36A 3RSOA 3A9TA 1NFQA 5AW5A 3KXIA 1T8TA 1RYHA 4REMA 4F6LA 2BEKA 2WE7A 2WTXA 4C0AC 3GGDA 4B74A 1Q1ZA 2C7VA 3CR3C 1NMXA 3C3PA 4RVSA 5CT8A 5BMOA 3QX8A 5FBRB 1PFQA 2L42A 1L7OA 1KZ6A 4KRGA 3KKZA 3OE1A 2BEJA 4TWRA 1W30A 2C7QA 1KVUA 2YWXA 2GM5A 3X1DA 4JJ4A 4QOEA 3SMQA 1MDFA 1EWTA 3EVNA 3NOVA 3CTPA 3T7SA 1N25A 3JQFA 3USZA 1N8SA 1W1UA 4FD3A 4HRAA 2EU8A 1CJTC 3L84A 4CQNA 1XVIA 4WXPA 3TOXA 1L1FA 4DMCA 3LUFA 1W34A 2CYBA 2UZ1A 1KZ1A 2IP1A 1E3TA 1EQ2A 1UOOA 3JYQA 4FU0A 2JATA 4TLEA 1L5SA 2C2KA 2ZT6A 5ESXA 2PDAA 3ZCPA 4HR7A 1WZNA 4UVDA 2ARKA 3A70A 3DDNA 2JJ2A 3QMPA 4DV3B 5ER6A 1XD9A 2SKDA 3PEFA 2CVZA 4L7QA 5ERXA 2YMPA 2FSFA 3LRXA 5EMJA 3KUKA 4PBRA 4EO4A 2GRJA 1CNFA 3TAUA 5HRAA 1DCMA 3M9WA 4ZVTA 3AETB 3RTEA 2WJJA 2PS3A 3REGA 2HA4A 4V1CI 4KIGA 3KT8A 3PDCA 1MV8A 2MU1A 2WHPA 2OO3A 3KWJA 3W9UA 3G85A 3LP8A 2WJYA 3IP5A 1Z6ZA 1ZI6A 3PCTA 3GJ4A 4DDVA 3K73O 3T1YB 4AM8A 1K9VF 1N5OX 1YJ5A 3F9IA 4B6JA 1YOVB 3VKGA 1OKKD 1V39A 3BEOA 3IKMB 3WNVA 1OX6A 2RDMA 1GKKA 4W5OA 5EL0A 3DSRA 1I4TD 1G5FA 1USIA 3HVRA 2IXAA 3FGPA 5ES3A 3FKJA 4BRSA 4EHBA 3TB6A 4OFBA 4FJ1A 1S2IA 1CHDA 4M9SA 1UL1X 2XBMA 1F4VA 3C97A 4INOA 5KEIA 5K0JA 5DM2A 2XUFA 2PRJA 4J0GA 3TM5A 4HY3A 4NS4A 1CUEA 4MP3A 4HNVA 1JQBA 1DUVG 1WB5A 3DOUA 4KSCA 5CDHA 1ZOLA 3MK31 4YALA 3M82A 2PWPA 4BX2A 5K8TA 4JBYA 3OCVA 3TRFA 3ZWNA 3ESDA 4YCNA 3UPTA 1P72A 1O9BA 4YQYA 4OFXA 2XYQA 4QHSA 3AONB 4EHKA 1EYZA 1TYDE 1L4KA 1SCDA 4OEHA 5ECYA 1ZD1A 1H2RS 1Z34A 2WMYA 2B98A 1JUDA 2Q27A 4MX8A 4OCZA 3WRWA 1X80A 1E3WA 5JXHA 2P6UA 3U17A 4S1PA 3STUA 2F00A 3U6BA 1RHUA 1UXGA 3R5KA 1MNAA 4KXFB 2CCKA 5DASA 4YV7A 4EW6A 4B71A 4KQKA 2BJWA 4Q4AA 1HQCA 1AD2A 4LYGA 2KWIA 3EEIA 3E70C 4W1RA 4EPYA 5K2OA 5KB3A 3OY7A 5ULLA 3KG2A 1IRIA 1E4OA 3SBEA 1JP7A 2NP6A 2RJOA 2ZANA 1PZFA 1II9A 2O2DA 4JSYA 3K2QA 3WHKA 4XFKA 5IS2A 4TVBA 3HEMA 4QELA 4XDYA 2J5KA 2IYFA 2VHZA 3E3NA 2Z6VA 4U2CA 2Q4OA 4RDCA 1GZ3A 4GMGA 5I7VA 3MT0A 4PTZA 2C7OA 3OCCA 2BCGY 2F90A 2ZYUX 1SUWA 4XB6B 5ICEA 1U63A 3R9WA 3LLVA 1G21B 4PS0A 3RV3A 1PR2A 2PZEA 2NLOA 2XKJE 3FYUB 3G7SA 3GL9A 1G8PA 1MX1A 3JYPA 4WCFA 2WY2D 5EGNA 2YWBA 4UE2A 3HR8A 4LV8B 3MF4A 1ITZA 2PH7A 4CMCA 3RFTA 5C8ZA 4E5YA 2FWPA 4FHZA 5LYJF 5LA6F 4M89A 3AR7A 1P1IA 2GHIA 4DC1A 2J3HA 5KU1A 1RTTA 2CY0A 2I4RA 2YUTA 5CPFA 4RZSA 5DGDA 2KHZA 4FKZA 4M1ZA 1PJAA 1SH7A 2FMFA 4M99A 4MUGA 2QE6A 4X6UA 2HJRA 3CKKA 2YXNA 4BTLA 1S1CA 4BGVA 1GPKA 4ZU1X 3E27A 3EMKA 1JIJA 1PE0A 1YSCA 1RI3A 4PHHA 1SKMA 3P9ZA 4YUVA 2W2OA 2QNRA 4MZXA 2KW5A 3LAWA 2JGDB 2B3DA 3B60A 4LE2A 3WDKA 5CLHA 2Y1GA 2P6OA 4FC7A 2PGDA 5K4AA 4ZMBA 2PO7A 2MT9A 1YQTA 1VDZA 4G4IA 2QXUA 4KMMA 2ACKA 5GP1A 2A1UB 5BN4B 1B8UA 5MGNA 1RVDA 4N5NA 2GN9A 3T7JA 1X13A 3CE9A 3VNBA 1FQWA 3HN2A 5CITA 2O2XA 1RYBA 2VHTA 5D1NA 3OZIA 5AYVA 5CMLA 2GN2A 2ETVA 1DLIA 3MM4A 4IV5A 1VP9A 3E4DA 2WZBA 2GN0A 3ZHYA 2QG9A 5I4IA 2ZRKA 2BLLA 3QQ5A 3M4ZA 4QM6A 4QNMA 3Q40A 2C00A 2NZJA 3FNIA 3UIEA 1TK9A 3E6AA 1V7QA 1CP2A 1A77A 3GVPA 3TOCA 2AF3C 3UMSA 5EUMA 2QS9A 1Y8RB 4C05A 3GLGE 1GGNA 2W8BA 3NDRA 3DEYX 2G0TA 4UBMA 4OQZA 4FLMA 1XZDA 3UKDA 2CBZA 4HN2A 1VBMA 2IEGA 3R7NA 4B81A 2XI4A 2FZWA 3A6EA 5DO9A 3T0FA 4EUNA 5L8VA 3Q8LA 5UKDA 4PAOA 4DA6A 2HMAA 1JEOA 2WF8A 2PSFA 4UTXA 3WL5A 3LQ4A 1V8BA 5CIQA 2F4VB 2P9FA 3R44A 2D7DA 3ND7A 5F7XA 1YDEA 2WIFA 3IQWA 3TZEA 1E9BA 4P0QB 2OG1A 4IBOA 4BJHB 1E5QA 2XHEA 4A6EA 4BNNA 3DLBA 3BDIA 2NV6A 3NDPA 1ZJ6A 4OIMA 2ZPAA 1Y7TA 3IELA 4KIFA 5IKEA 4ZEXA 3FOZA 2X5JO 3DTYA 1MVOA 1XLWA 3P71T 5HA5A 5EVJA 4M8IA 3AVVA 5BYJA 4YJKA 1NXWA 2VG8A 4NNPA 3LLUA 4F0JA 3EEOA 2CVHA 5CFNA 2JLUA 1J07A 2BUCA 2ZB3A 2JG3A 3RVKA 1XVUA 4MIKA 3AF4A 3FXAA 1IWOA 2C78A 2GCIA 1H23A 2QTBA 1ULUA 4O33A 3UJ8A 4YXFA 1ZRNA 3RK4A 3EIWA 1K7YA 4TKUA 1WCXA 2EJBA 5KCMA 3SEAA 4E2YA 3GLSA 5BSGA 2JLAA 1NNUA 1RJFA 3QELB 1S3IA 2XB8A 5LWQA 1ZN7A 1Z0ZA 2DCUA 2E55A 2NTYC 2NUAA 4JLOA 3S81A 3CG4A 3L4BC 2RGUA 1X9IA 4MW9A 1C8LA 3EZ2A 5IDQA 4DM3A 1E9DA 2BGNA 3IQXA 2N3ZA 1L9KA 2VZ0A 3WP0A 4D92A 1TQ4A 1I33A 2P9CA 3IQGX 4ZARA 2ECOA 3AMVA 2X5KO 4EI9A 1YUBA 1Z7GA 1M2VA 5HGJA 4OYHA 3UTCA 3FIUA 4MRVA 5CFRA 3A26A 3P2EA 3WK4A 3QLUA 2JLXA 3RU7A 3QOXA 2E6UX 3RE1A 4EMBA 2BYTA 1NKTA 3MWYW 3T1HB 2R1ZA 3EXIA 4I14A 4RETA 4GDFA 3DPSA 3P2JA 1D2EA 4NBLA 1LPAB 4B73A 1CLEA 4U2GA 2GKOA 2ZUCA 5C1DA 1KWKA 5ARCA 3UMCA 2V3CC 2PLRA 3A31A 3KKLA 4H77A 3JQCA 1JHVA 2XE7A 5BSEA 3B52X 3BAZA 1AS2A 1E69A 3KJHA 3PT9A 2X77A 2AFVA 2CLFB 4CQLB 3HTXA 2AG8A 1SURA 1U7ZA 3WBKA 3EA5A 3BXOA 3T1QA 3ON5A 2A1TR 5DT2A 5LR6A 2B94A 1MUUA 2ACWA 5I9IA 4HVTA 5JRDS 2E4YA 2PBRA 1PVOA 2JA1A 3DBOB 3JAKB 2FLWA 1MABB 2QL9A 2GZ1A 3KNZA 3O31A 4IG9A 4I1UA 4M98A 4PCAA 1QGUB 4U5QA 1N9GB 3CRQA 3ED1A 4D74A 2FPPA 1EUYA 3H16A 3ULKA 3OIUA 4GXQA 4AFNA 3CZ4A 1S9DA 4NYJQ 3HVHA 3GNLA 2VJPA 4MMZB 4X84A 3ENQA 3NPMA 5K0NA 1LJUA 4RADA 2WF5A 1D4OA 1U3DA 2IHTA 3BB1A 3OQIA 4OBXA 4AO6A 3CVJA 3EODA 4CCWA 4G81A 1VLJA 2H29A 2OOKA 3IE0A 4F2PA 1X74A 3AERA 3KAKA 3N2LA 4QFMA 4MZDA 4Y1FA 4B2PA 3TECE 2PX4A 2W4IA 1SKQA 1NW4A 4N4AA 4R9SA 4EHJA 1OFTA 4PZ9A 3AEKA 1PVVA 4MQUA 1B93A 2PHZA 2GJKA 1A7JA 4C9BA 4CF5A 1VMKA 1WAMA 2BKXA 3R40A 2QRPA 3HL0A 3KOOA 1QTNA 4XTRA 1SXJB 1WOMA 1VCNA 2YYSA 4CV1A 1RYMA 4I36A 1N32B 1OSNA 2GTHA 2EFJA 2I3AA 2WG2A 5AJYA 5T4FA 3SI7A 3UAGA 5ADUS 5JQGF 2KI5A 3B2NA 4O2AB 3Q3IA 3RVRA 1XEFA 3U3XA 5LL6P 2YV4A 1LQ2A 3GVXA 1OI7A 2YY5A 1KI3A 4Q34A 3VOSA 2YYAA 2EHDA 2OGWA 4OJTA 4WXEA 2X9LA 2WZDA 3SQLA 3UA4A 2CMFA 2Q2WA 1DX9A 3C6XA 4BP9A 1UT5A 4DE5A 4KXYA 5K03A 4JP2A 1X19A 4F38A 4ZIRB 3LPAA 4HTFA 3ZY3A 2NOAA 5CBKA 2I4LA 3BN3A 1KSHA 4PRYA 4XB1A 3FTQA 1AUQA 1TM3E 1OXMA 2IF0A 1W581 2IUYA 3K35A 3RVQA 5C5CA 2VHUA 3R5XA 3NXKA 4GPD1 2GJSA 1W5FA 4BLSA 4PHCA 3KZMA 4KV9A 1Q15A 2YN2A 4UFNA 1M33A 1U3VA 2D0DA 1N5JA 1SIUA 1D0VA 2PN1A 4AZ3A 1ADFA 3CF6R 2R6R1 2VNJA 1OHHA 1P77A 4FQ8A 3ZCXA 5JNVA 4EEXA 3WDLA 1GGKA 4ZVVA 1LF0A 4DG5A 4EAAA 4GAEA 2YZ7A 1UBGA 4PIMA 5AESA 1FTGA 2CE2X 1PLJA 1ZK1A 3C8HA 2PSSA 2G04A 2XT0A 1G4AE 2NAPA 3QOFA 5D3ZA 2I78A 2P30A 1W44A 2PMKA 3HFGA 3SJBA 3TG8A 5BPFA 1D2RA 4IGFA 1E7SA 4MEJA 2BEVA 3KZKA 3LSTA 3PSHA 4MUBA 3QIAA 2FFBA 3IBTA 1L7NA 4M8KA 4QYWA 4LY0A 2I9KA 2YDYA 3U9SA 2YFKA 4IW3B 3Q8WA 3VH3A 3E7DA 4JOCA 1T8RA 2P65A 3T3DA 3DL2A 3MS4A 4QEKA 2XQVA 1RC1A 5DXFA 3UWDA 3HXOA 2FUCA 2V7TA 1GR1A 1B42A 1QHGA 3LOQA 4JENA 1ZLYA 3PZBA 3R7WA 4DCSA 2XY4A 4U7GA 1S1MA 4IG4A 2I4IA 5AUPB 1QO9A 2BE7A 3AU8A 3MC1A 5K3DA 1C9KA 1M2EA 2QN6A 1T0UA 3ESXA 2I6QA 5C8VA 4P84A 3ZIAA 1QAOA 3ZU2A 3MS2A 1G8SA 2CYCA 5B4VA 4TZTA 1YVDA 3LQFA 1NW6A 2FEAA 1B16A 2P5TB 2AD5A 2C96A 2FUNB 2GM3A 2OQIA 1XZQA 3MGCA 5DYYA 3RC7A 4F3KA 4DIEA 1HXHA 4Q3OA 3LBIA 2C4HA 3DOFA 4P4GA 5HYVA 2FR1A 2A30A 3WYCA 2H8KA 3U40A 4BVKA 4CF7A 3G9XA 1AZSC 4BWFB 3N8IA 1MX9A 2FZVA 1AS0A 5G1OA 4KXNA 221PA 2XVAA 4BEJA 5C46F 5B36A 3MAAC 4DDTA 4JDUA 3TTVA 2BKEA 3WK7A 1TJNA 1U99A 1Y3IA 3A3YA 1MH1A 1VQ1A 4IHQA 4LC9A 2FKAA 2OYSA 1YFLA 4JI7B 1LJ8A 1Y4UA 3OP4A 5SYMA 3TE7A 1MAVA 2Y1EA 2WSSA 3MTQA 1VJDA 2H18A 3NWBA 4B2YA 3T9EA 3PXEA 4GZ5A 1GVHA 2VL7A 3OFNA 1WPQA 1H8EA 3OOHA 3ZN2A 1Y9JA 3DOOA 5F1YA 1P4AA 5A0FA 3VSEA 2X6QA 1XPOA 1E0AA 1QNFA 2IOFK 3Q12A 4JBNA 3NDIA 1FFXA 1NYTA 2ID9A 2PKWA 2SKCA 4PY2A 5IASA 3TW8A 2GPAA 4ZVQA 1PWHA 1LC3A 2J3LA 3OX2A 5A5EA 1JMYA 4FFVA 4ZK6A 1DT3A 1TQ8A 3DDHA 3RAJA 4DUGA 4O4HA 2DFKB 4XUDA 4B3HA 1VM6A 3ERCA 4HAYA 4XIJA 4MR7B 1MD9A 5L40A 3I6YA 3O47A 5EZYB 3O8NA 1XQWA 2BFCA 2YZNA 4ZXPA 4RMNA 3WYGA 1ODLA 2RGNC 1J33A 3T7RA 2I5PO 1RBYA 3F2IA 4QBKA 2FZEA 1XP5A 3EUAA 1RBQA 4WFIA 4TWJA 4UEOA 4WESB 3V1YA 3WIDA 2C2GA 2AOVA 4JJGA 2B4KA 4DR1B 5H70A 3AU9A 1GT91 4WVFA 4YPOA 2J3JA 4GI1A 1JG3A 2HW8A 4JXXA 2P1ZA 4J0KA 1FLDA 2PZJA 3TCKA 5JPIA 2HCBA 4RMJA 4CFZA 4YMGA 3VQTA 1R64A 2AYXA 3ZV3A 4DBLE 4BMNA 1KI6B 2NYAA 1L7AA 2Y99A 1RWOA 3LU1A 3QWBA 4R2LA 2BMVA 3EPKA 1EUCB 3ANYB 2QD2A 2X8LA 721PA 3JVDA 3FNBA 5CCXA 4PZDA 5LP6C 5KWVA 3DEKA 5I7WA 1V26A 3GCXA 1WXWA 5LQUA 3TPZA 2HDOA 4I55F 4R7GA 1NKSA 1EWRA 3ZS8A 1KBQA 4E09A 2QN7A 1D1TA 4BMOB 3DBHB 1PX0A 4PYOA 3T4PA 3OZSA 1LW7A 1UXJA 2I76A 3MVEA 1N92A 3GHYA 4LISA 3DAOA 1R74A 2NXNA 3GOHA 3JTEA 6REQA 1TEVA 3CN7A 4MJXA 3CISA 1H1LB 2NTJA 2ZJ2A 3LD9A 2O8VA 2G1UA 2VH2A 4LXQA 3THWA 1R6DA 1XRRA 1JFFB 2G08A 4EPWA 3I8OA 1EG7A 1F14A 1N3LA 3OPMA 1JMKC 1CDDA 1FB5A 4C20A 1BHJA 2FWIA 3ZK8A 2GBLC 4MV5A 3WSTA 2NW6A 3E22A 1E5TA 3HJTA 4CN9A 5ES4B 2VHWA 4RF2A 3ZI4A 2FW0A 1ZZEA 3HY6A 4D9NA 1MLDA 5IBQA 1D09A 1Y9EA 3GBSA 2P3OA 3KEOA 1IHUA 3IDFA 2HXGA 5GY7A 5DHQA 1J1UA 1FEZA 4J0DA 4HAOA 3Q5EA 4KQ9A 3AVXA 4ZN6A 2OWDA 3N2IA 1E2PA 1X7WB 1Z4KA 1Y9AA 2BUBA 2RG1A 4Y9TA 1W2HA 2WWWA 1ULBA 4HVAA 3W90A 2AFIE 1OXXK 2OCDA 1W8IA 4UNQA 2DBRA 4L3OA 4IH4A 2ZRDA 4DSAA 1W0CA 4OQNA 1E99A 1G55A 1Z4QA 3P2KA 4L28A 2C9BA 3L0YA 1OGYA 2GZMA 3O8LA 3UKJA 1P5FA 2FE1A 3MBOA 1C0LA 4KPYA 4H0FA 1M7HA 2GEFA 3E9DA 3ZJ5A 2PGLA 5HBRA 2ZAYA 4MV8A 4RK7A 3OEHD 3CT6A 3K2EA 3KV3O 4UQPA 5KTTA 3FTPA 4KGXA 1R0KA 1Q1GA 3DDSA 4IIJB 4NG4A 1Y6GA 4KW7A 3ME5A 4FGSA 2WF9A 4ZQIA 5IK2A 3T3EA 5LUAA 1COWD 4H1VA 1LUAA 1RU3A 3RU3A 4A91A 1CFZA 1IHXA 4U7FA 4UZSA 1WUKS 5HCNA 2YFQA 4G63A 1UMBA 1X7DA 1ESNA 4KTTE 5LYYA 1L5YA 3IQZA 5TLSA 3TSZA 4Q12A 4YRBA 1Q7TA 5EP4A 2CK3D 2XNDA 2YVQA 1JNYA 3BQMB 2ZB2A 4LYYA 2O3JA 2WHYA 4U63A 3U39A 1CQPA 4BXOA 1J23A 3ASZA 3PRKE 4ENPA 4BQIA 3HXPA 4F4FA 4M55A 4DBZA 1HT2E 2OLJA 2OYRA 1O96A 3UA3A 2MSNA 1Z39A 4PIVA 4U3JB 4F7DA 5J4YA 2PRKA 2DFPA 3CF0A 5JAUA 3BFKA 2CXRA 2PFKA 3BFVA 3NHFA 4IGAA 3NO4A 3ZHCA 3WLPA 4FOTA 4J4TA 2J9FA 2UVDA 4A5SA 1IL0A 3EXEB 4A0GA 1M1YB 4DXHA 4MW2A 2O8FB 4NH4A 1UPCA 3CH6A 1F0NA 1NULA 2X40A 3R5SA 4GRAA 4IEEA 4EB6B 5KQSA 2V4MA 3O7MA 1H22A 3HU2A 1U8ZA 1D1QA 3KPWA 4IZIA 2HY7A 4UCFA 4ZKDA 2I2AA 1DJOA 1M76A 3ROEA 5CAEA 3S2YA 1P0MA 2DY1A 4ZAWA 3EUWA 3ESQA 3H8WA 4XR4A 3C7KA 4AQYB 1XHLA 1PJQA 3NHPA 1N3YA 1KGSA 5JR3A 5L3QA 2W2LD 1W36B 3NAMA 3PQ8A 2I3GA 3C87A 2ECPA 5FPPA 4D97A 1IHPA 3LY7A 3WKBA 5F33A 5K6RA 4AF6A 4EI8A 4TTIA 4X8OA 3HJAA 4M9XA 3QG1A 1QRDA 1NONA 2XCIA 2WU8A 1KF0A 1N1EA 1RR6A 3CCBA 3GMIA 4R41A 4UAJA 1GNQA 3AP3A 3GFFA 1XVAA 3CG0A 2BTEA 2EFYA 2O3UA 3NS7A 2ZWOA 1C0EA 3DD5A 3OKPA 1UZNA 2BTQA 3GUCA 3Q4GA 4J75A 3PDWA 5C8YF 3K5WA 4UM5A 1XYVA 5H3HA 2EERA 4GQBA 3I9MA 4M22A 4LVCA 5D3QA 4BQEA 2G17A 2IOQA 4AJ2A 3KAPA 2XRFA 2GILA 2QJWA 4YV0A 1GRNA 3BTUA 1NW7A 4AT1A 2C61A 4M7OA 4LZPA 3TTTA 3RI3A 5BWMA 3VR5H 5EWJB 5IJZA 3NBUA 3MPUA 1F20A 1ENPA 3D31A 2HYIC 2JHPA 4RXMA 1EUQA 5AKHA 2O05A 4KPEC 1YV9A 2G5CA 2IJGX 1QM5A 4QSMA 4YDSA 3V7NA 4KIWA 3MB8A 4HVCA 1V6AA 1U8TA 4HMQA 2IYVA 2FSVC 4RZUA 1UXKA 4OK6A 1DAGA 1F2UA 4KH0A 1KL7A 4GI5A 4RA6A 3GP8A 2H4ZA 3FJOA 5GV8A 2GO7A 2IW1A 2IXBA 2J3MA 5IJ9B 3HDGA 1VSUA 1Y9ZA 1JDTA 2C2OA 2NZUG 2P7IA 3A7EA 4B3GA 3DBIA 4ZANA 2NU7A 1Q0LA 2OVFA 2RAFA 2DM6A 4RFVA 3W5CA 1M8FA 1GYPA 3BWXA 3PRHA 3R6TA 1QE3A 1WW8A 5KNCD 5CD1A 1ADBA 3OIDA 1GGJA 3CO5A 3R5JA 3ZZ1A 4J1TC 3PXCX 4TMFA 2PYZA 2R1UA 4LSMA 1QLWA 5E1BA 4BHTA 2VP3A 5K3BA 5ALSA 3UF0A 3I1JA 4BP8A 2A94A 1LPNA 4QPPA 1TKBA 2ZIWB 4Q3EA 5FI1B 3STHA 2IXEA 1J39A 3FHJA 1EWVA 1ODCA 1L2TA 1TFUA 3PC8A 3DW1X 2BMDA 2GHTA 2AEFA 4YUYA 5BW6B 1FOEB 3CZRA 4BTVA 3QHQA 2FR8A 1C9YA 1V6SA 1YMVA 2C98A 2VWGA 1EIZA 3EH2A 4QO7A 5FHRA 5GJVC 3TB4A 3WGNA 2V7GA 4S12A 3HJBA 1RP1A 2ANBA 3UHAA 3BH7A 3H5OA 2B37A 1SBCA 2ZS8A 5CFOA 1M75A 3EPPA 1JS1X 3O8CA 3GPLA 4GR9A 4Q4JA 1DOAA 4XH9B 1ZUIA 1G8JA 2XUIA 4Y0AA 2OV2A 1RCTE 1BSVA 3HUDA 3TIGA 4XB2A 3VVBA 1A4RA 4B3BA 5JJIA 1ML3A 2JZOA 1VC2A 3FB4A 4PXSA 4P2GA 3I76A 3OLWA 2JANA 3RSHA 1UIMA 2ZBVA 2GK6A 2IIBA 4I9GA 3JY6A 1FRVA 3N07A 3JQ9C 4OA8A 3AHFA 4MHSA 4BNIA 1LV8A 1M2HA 2WJ6A 1DKLA 1UMDA 3ICOA 1IZZA 2E5LB 1DBVO 1DOHA 1MNQA 1UXHA 1EK1A 3Q3JB 2B1RA 4FMDF 3UHPA 2NZYA 5I5EA 1A27A 1LK0A 3PR3A 4GOXA 4O4JB 1ANKA 3AKYA 4M1SA 4XAQA 4DR3B 2Q0QA 3V9AA 2KMLA 4BP1A 4KG7A 1MMFB 3UAZA 3PVCA 4BO8A 1BYUA 2QJTA 4JLSA 4BGIA 2B6NA 2GYYA 3Q88A 4WDQA 1Z45A 2IU4A 3N74A 3A05A 4QASA 3EIFA 4RHUA 2Q9UA 3ORSA 3A1SA 3PD1A 3G5TA 5JWOA 4PGFA 1EVYA 3E5HA 3AF1A 1YIDA 2V6GA 1L4FA 3DWEX 3PHBE 1BEZA 3BERA 3PEVA 5ED0A 1XJQA 3LSYA 4KLRA 1PKXA 1EU1A 3O4RA 3DOEA 2ICAA 4CUKA 3I04M 1XXHE 4WLEA 3FCEA 1B43A 4Z5XA 1ZUNA 1I9CA 2D2VA 2JD2A 4EVQA 3IQFA 1GFIA 3LA8A 3UM9A 2FWRA 2O7RA 3DNFA 3MYYA 4NOKA 1FDUA 1QP7A 4CDMA 1X94A 2YMQA 3QVWA 3QKRA 3O3MB 4J7XA 4AMVA 2HYDA 3RS7A 1J20A 1KOFA 2XQGA 2ZK7A 2HU7A 3ZDEA 1C30B 4ZMSA 5T5QA 1O3YA 4DSUA 4K05A 4IJWA 2COUA 2UVPA 4WD3A 3OPNA 2Q6VA 2IV3A 3D3QA 3PFFA 1YRQA 5JAPA 1B8VA 3R3XA 5E4FA 3UCFA 3B9BA 3P9QA 1E6UA 3IT0A 3KTAA 3PCRB 4E5KA 5KYUA 4FSXA 5U9CA 3FPGA 4HDMA 4IILA 4NOLA 2IF2A 4HWPA 4ZVPA 2FVXA 1NBAA 4D25A 1JRLA 2NG1A 5C1IA 2WAMA 2JIRA 1J25A 4M49A 4FONA 4BQFA 3NRBA 4Q3NA 3C7TA 5GIPE 2UZ3A 3RT7A 2DERA 2FOXA 3SVTA 2DXIA 3VU0A 1YB1A 4LF4B 3AUXA 1INLA 3HCCA 3PFHA 4H7IA 1DG1G 2AEJA 3MFQA 1WD7A 4RDXA 2GAIA 3TEFA 3QNWA 3DE5X 5B2EA 3GIDA 3FWZA 3IOCA 5EIBD 5LDDC 5B3AA 1TUEA 3WGIA 3DAHA 2R66A 4HATA 1J5XA 2SBTA 4UFPA 2OE2A 3SS7X 1Q6ZA 2H0QA 4ZCRA 1UKYA 1XD8A 3E1KA 3R0ZA 3SKYA 2JRCA 4HXEB 1NXXA 2VAVA 4YASA 2CLOB 2G7MC 4DNOA 1G20A 3QXCA 5FFFA 1N75A 4JI1B 2Z83A 4M6WA 4YO7A 4CDRA 4LDPA 2SCUB 1XMVA 2PR7A 5C5DA 5DTIA 1Y7LA 1AVTA 5EKTA 3IVRA 4JSRA 3ED5A 1GPBA 2O2ZA 1XC7A 3HUEA 3RBAA 2OFXA 2PAFA 2H1VA 5EHNA 4JYPA 1XALA 1I2AA 3VMFA 4E14A 5ELLA 5L6MB 4BNZA 3CKLA 5K3EA 4UQOA 1QIHA 1Z6XA 3WIVA 3UMRA 1WPGA 4XSVA 4EBFA 4Y1GA 1G5PA 2I65A 2H2GA 2O2EA 3BULA 3WWPA 5C1BA 5LJIA 4HEHA 2Q7XA 4A8JA 1UDCA 3PPWA 1UF9A 2LP4Y 3NHSA 5A4FS 4AJPA 1M2KA 1SCUB 2FFHA 3FMOB 3HE3A 4PLVA 4TM7A 4WZBA 4Y2HA 4OI1A 3WLTA 5IJ9A 2VRCD 2WPDD 4HFJA 4V39A 1QDLB 2ID7A 4PIPA 5EZQA 5TVGA 2J8ZA 2XZDA 3V5NA 3KOXA 4O4LF 3OLCX 1G6OA 3C74A 2EWVA 3IAUA 3E9NA 2XQKA 5DSXA 1P4GA 3DUFB 2KM1A 4ZAYA 4BLPA 4Z6KA 1F6BA 2DJ5A 2H31A 2XZLA 3NYIA 2C7BA 4LY6A 1JR6A 4JUFA 5TEWA 3TL3A 1FFSA 4FHGA 4X95A 3AVWA 1LSUA 3QOYA 3HA7A 1AUXA 5ESWA 5L53A 4WY5A 4CM8B 2JFPA 2QAIA 1Y1PA 3R7FA 5C3MA 1YZTA 1QTQA 2GDZA 1ICIA 3DLCA 1ONSA 4AIIA 5L4NA 4BFXA 2BZSA 4V0NA 1GDTA 5DW3A 2O2CA 4E5PA 3R6DA 5KTOA 1RBZA 1YQGA 4XYMA 5CPBA 3PKZA 1MFPA 2DT8A 2FK7A 3CBQA 2WMDA 2VCYA 3FWNA 4LDAA 4WXHA 2Q4DA 1DC6A 1E2JA 3OFJA 5BQPA 3RKRA 3UVEA 1L7MA 1U9IC 2VUHB 4QNRA 4WWHA 1MA0A 2QAGB 4RJIA 1T35A 2X4DA 3WI7A 4B48A 4Q48A 4QG3A 4HO1X 4XWGA 1G21E 1JZQA 3EW9A 1USGA 4KWCA 3W7VA 1IN6A 3JVIA 3KSAC 1NNLA 4EA6A 4DDHA 1DUIA 4OF4A 2NACA 3BIWA 3PC4A 1R3UA 3OQ1A 1I2MA 2OCKA 3PJDA 5HE9A 4B3XA 1XEXA 3AR6A 1A76A 4HQRA 4W9RA 2AN5A 2R6GA 2R4UA 1DELA 5EKDA 1KY5A 3K7EA 4FHDA 1Z5UA 3RK1A 3C3AA 1ZOPA 1SU6A 2IP4A 1RJ9A 1Y7IA 3MJSA 4WVLA 1BDBA 4O2AF 4PYLA 1E4EA 5C9ZA 1RWVA 4Y1RB