2NSLA

E. coli pure h45n mutant complexed with cair
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSANRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(5)-CAIR Mutase: Role of a CO(2) Binding Site and Substrate Movement in Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase catalytic subunit
total genus 53
structure length 162
sequence length 162
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2006-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2nslA00
3RGGA 4B4KA 4ZK2A 3OPQA 4GRDA 1QCZA 4YCDA 4YCCA 5CLGA 1XMPA 4ZMBA 4AY3A 5BOSB 2NSLA 2FWAA 3OOWA 2FW8A 2FWPA 2FWIA 2NSJA 5BORA 4Z7JA 2FWJA 1O4VA 4YCBA 2FW1A 5CLFA 2ATEA 3KUUA 5CLHA 4JA0A 4YCJA 5CTJA 2FW7A 5BOSA 4ZJYA 5CLIA 4ZC8A 2H31A 2YWXA 2FW6A 2NSHA 3TRHA 5C5DA 2FWBA 3LP6A 1D7AA 3RG8A 1U11A 2FW9A 5CLJA 3ORSA 4AY4A 5CVTA
chains in the Genus database with same CATH superfamily
4E09A 2E2WA 2GF2A 3MK31 5CJ2A 3DNPA 4KVFA 4AMBA 3SJUA 1OW3B 1W0CA 5JR3A 4WNAB 1MX5A 4JC0A 1C8KA 5J43A 2B1GA 2ODEA 3ONVA 2Q3EA 1QYCA 4PZ9A 1RQRA 5JDCC 4DBZA 3B6KA 1F12A 3QJYA 3E0XA 3SD7A 3U7JA 1Q0SA 3IQXA 4NOKA 3ZCUA 4DCGA 5C1PA 1Z6ZA 4Y6RA 5JE8A 3W3AH 3WRVA 4E5YA 3QLUA 5KOIA 4Y2YA 3QE2A 1NVTA 4TMWA 3L0DA 5CFOA 4WNAA 4CEIA 4RDIA 2KX7A 3DE2X 2JARA 3O3MB 1O8CA 3I6YA 1WMEA 3OZ7A 1NF2A 4RPGA 3JAKA 4KQKA 1XROA 5CDYA 3Q87B 5J4YA 5KNCA 1JFFA 1BEEA 2JASA 2SBTA 1TRKA 3P2KA 4WLOA 4J76A 1MHPA 2GYVA 1T9GR 2MDTA 3A8TA 4QSHA 2CMHA 5E2BA 3WTCA 4HV4A 3FROA 3K9WA 3DMHA 5JSKA 1UR5A 3ORRA 4FC7A 3U3KA 4IJQA 3WB0A 5KKNB 3CC8A 5CFMA 2AQHA 2C4VA 1X8LA 4IHQA 5EKTA 3VGPA 1E3MA 2BI8A 3NHPA 4C7MA 3MM4A 2SICE 1L7OA 2HMVA 2OCKA 3RVPA 1Z5WA 3D9QX 4LQDA 4ND8A 4YI3A 4DIEA 4W5OA 1G8HA 3L7MA 2PL1A 3K0CA 4KI0A 1GPMA 5HA5A 4X64B 1V1RB 3VC2A 1SUBA 5IDWA 3IPXA 1Y8CA 4QDZA 2D1YA 4C0BA 4D9JA 3GCZA 1RVDA 4BFYA 3ONNA 2VBFA 3WP0A 4DWJA 2Z83A 1PK7A 3UFXA 1AO3A 1Q91A 2Q6TA 2FSPA 5EFZA 2FPGB 2Z1NA 3KJHA 3ROTA 1Q0TA 2NT4A 1NQWA 1OFUX 1P1CA 3FHOA 4TTIA 4ZVPA 5HFAA 3FFTA 3UMRA 3H6GA 4W5JA 2HJWA 2RAFA 1E4EB 1K5PA 1LSOA 1V6SA 1W2WB 2AF4C 3AOGA 1KAGA 3LBAA 3N2EA 4Q3NA 4V0LA 3H7AA 2C00A 1JHYA 5E4JA 2CNKA 2GYUA 2CJWB 2QSUA 3NW9A 1Z36A 2ASVA 1IQ0A 2CHQA 3AR9A 1ZNWA 1DCMA 1PZXA 2FZ5A 3K20A 1ZD5A 2R6AA 1T29A 3OG9A 3Q3VA 4QOHA 2B7LA 2XH8A 4EFKA 4OG2A 3WGIA 1MORA 1Z07A 2H2FA 1LSSA 3D6HA 4GOOD 3OEHA 3OC6A 1XU9A 4I08A 3O7MA 5D00A 1Z5GA 4NAHA 5FWAA 3U5TA 2Z43A 4URUR 4AICA 2I54A 1T4GA 1WW8A 2O2SA 2P41A 3AESB 1P0FA 4K26A 2XD4A 5DHSA 4C76A 4CM8B 1R5NA 4QC2A 4JSYA 5DYGA 5FH9A 5I7EA 2FR1A 2HNKA 2HNBA 4ZMRA 3GO4A 1B0UA 4QYIB 2G63A 3L41A 4HDCA 5D01A 4D3DA 4NXMB 4IXWA 5C8YF 4DA0A 1MO5A 1E0JA 4JK3A 3W6ZA 2YTZA 4LCBA 2O2YA 3M3DA 4HWOA 4KXYA 1HM5A 1YR8A 2ZS8A 5KCZA 3F97A 3ETCA 1EVIA 1FNMA 2HU8A 3VHXA 1PJQA 3B5IA 3SHQA 2OEPA 4WOBA 2P9YA 3K0FA 3UUEA 3VTKA 2EFGA 3PR3A 4KR6A 3PGLA 2CLHB 3PCXA 3A1TA 3WAGA 3OPNA 1OLUA 3WLKX 1E4OA 1KZ4A 4ESOA 4ZIRB 2M98A 3LQ4A 4QDJA 1QVVA 2JJ1D 5AVJA 1KU6A 2H0AA 4OU4A 4F2WA 3CUTA 3DL2A 4IJKA 3QLVC 4LBWA 2Y1CA 4Y9SA 3WRXA 1K6EA 3ZOKA 4GBMA 2GO1A 4HL6A 1VBNA 1YJBA 1UM9A 2M32A 1QG2A 3EC1A 5JPDA 5IAJA 2V7VA 3MQFA 6NULA 4RPLA 1FXUA 2PUJA 2FFHA 3BJEA 5DN6A 5ALEA 1SEVA 1UZMA 4S1TA 2JJ2D 4W5RA 2VXYA 2IOYA 2VF2A 5JZBA 1LI7A 4C7OA 5EIOA 3U4HA 1X3SA 3CR3C 4AUMA 1ECBA 1XXLA 5CA1B 1U11A 2C8JA 3USZA 2OV8A 4R1QA 4UAUA 1NNI1 1O87A 1W4BA 2IA5A 2IEZA 3M82A 1UEXC 4FEGA 2W0MA 4ZO4A 2PWZA 1X1BA 1XWWA 3BWXA 4H4DA 3SN6A 3PIRA 4UBKA 1P80A 4J1TA 5JDCA 2JIZA 3QOXA 3DKRA 4NFHA 1ADFA 1NMXA 2ZSHA 3A1WA 1L5WA 1OA0A 2OBYA 4JT4A 3VVLA 3ZXXA 3FF1A 3OQIB 1X13A 3LWZA 2LPMA 2WF7A 1B16A 1R3UA 1EBBA 1T1EA 1TUBA 4NJEB 3RKSA 1NDQA 1PP4A 1JQ3A 4J7XA 5A3VA 2A9OA 5EGNA 4EMBA 5CDTA 3STXA 2XAAA 3MOSA 4TN5A 3NVKI 1CZHA 3V9PA 5DBHX 2WKSA 3FCXA 4K9OA 1MRZA 4ISBA 3U3XA 3CX8A 1FTNA 2NO7A 1K8YB 1WSAA 2X0IA 1AVTA 3KOOA 4P2GA 1VLZA 2H1VA 1V35A 1CUCA 1Z37A 2WJHA 3ORYA 5BUCA 3E2PA 1H2RS 4WZBB 1ADGA 3OQNA 4FWIB 4WOJA 1Y63A 2RH9B 4AJ2A 4YCSA 4M1KA 4B31A 2C9YA 2WF5A 4PCVA 1O96B 4JSTA 1CT9A 4FOOA 1E2QA 3SDSA 2IE8A 1KKLA 3PRJA 1NN0A 1P1FA 1LPOA 1UPCA 3R7SA 1FLVA 1CDOA 1SUCA 4Q82A 1PDWA 3DFZA 3A26A 3TL6A 4D2IA 1JPNA 4DSAA 1G2OA 2CZQA 7ADHA 2F1HA 3EEBA 4LKRA 2P90A 1QFMA 1P9NA 4KMOA 5HF5A 2QR2A 1T8WA 1U28A 1D6MA 2WNIA 3O8NA 1AS0A 2QN3A 2QYHA 4YA6A 4U0KA 5J40A 5B3LA 1QO0D 1KFJB 1RXEA 4M0EA 3SF8A 2DUNA 1IQUA 2ACKA 2IYXA 3L8YA 4M89A 4NATA 1XXHA 1Z3IX 3RDPA 3VU8A 2O9JA 3DWFA 3GFQA 1BAPA 4U3JA 3O90A 4DT1A 5JC8A 2PPLA 4JL5A 1HF3A 5ALTA 2QZZA 2R1VB 3CKKA 3BFJA 3HVHA 4J4BA 4MJ3A 3RTEA 4BP8A 4CLOB 3L6RA 1R3DA 3BA6A 1B8UA 4FN4A 4DIKA 1RZ3A 1YQ9A 4JZYA 2ZJBA 1JQBA 1MAAA 2JHAA 3EIHA 3R9XB 2D13A 3FWYA 3R3VA 1ZONA 4M2LA 2C94A 2JLXA 1Z56C 2HHLA 2ZIFA 1SUPA 3IJPA 3JZMA 4ILEA 2I2FA 2VJQA 1YZTA 4JUIA 4PS0A 4GP6A 3O26A 4Q34A 3RJZA 4H7KA 4PGFA 2W6QA 2P11A 3LCVB 1PEKE 4YJFB 4OXYA 1BXRB 3HVUA 1CY4A 2BHSA 5T67A 1KSGA 2QP3A 2OSBA 1C3XA 4HKTA 1S01A 3VDRA 1EAMA 1F5NA 2ISSD 5IJZA 3MERA 2ZAOA 1P6QA 1T1RA 3DV0A 3C45A 3KJZA 2ISCA 4QREA 5IUJC 4GLOA 5JFGA 1A7UA 2WHYA 4D79A 3R3WA 1XV5A 1Y34E 4G4JA 1F4PA 3WGVA 3ETHA 2QRMA 3WDMA 4UKDA 2FMHA 2F3RA 3SYRA 3PUYA 1GITA 2P2GA 1H94A 1BWRA 4S1OA 2WHXA 2BR5A 3WBKA 2XD9A 5BT8A 1F51E 2DWCA 2XT9A 5K8JB 1O6BA 1GU1A 4XWYA 1T2EA 3P27A 1N8NA 4RM3A 2I1VB 4GZ3A 2EWVA 3VZQA 3JQAA 3PVCA 3EQ2A 1QPZA 3GRAA 4L2IA 1ULTA 2QRVB 3C7DB 3WIVA 2V7PA 1IY2A 1U3GA 3IMKA 3S2FA 3PD0A 2VA9A 5D84A 4PPGA 4A0SA 2FPMA 4ZU1X 1VL0A 4UJ3A 4YUAA 7MDHA 1QCZA 5IFKA 1U8CB 4V1CB 5J4VA 1W9HA 5TRTA 5MN4A 4MARA 1QXSA 3GAMA 1WB5A 3FFXA 1K92A 4FFNA 3I42A 3O1IC 4PG5A 2P9EA 3RM3A 1XO1A 2AC2A 1LI5A 1MW8X 3HJBA 5CLLA 2HV9A 3DYIA 2WHEA 4OB8A 5K8UA 5T3YA 4AS2A 2G80A 5CRIA 1K06A 3INYA 3PGJA 4HFNA 4M60A 4BP1A 1PG0A 2ZQ5A 3C4JA 3AI7A 4EUKA 5A2QA 1CY6A 4QGFA 5FAXA 4AM8A 4B43A 2OT3B 1CF2O 5ULLA 2ADOA 4FFLA 4MV7A 2XGSA 4M9ZA 2A33A 1QWSA 1YB1A 1U2RA 5JAQA 1DS6A 3FCUB 1KERA 1RHJA 5AKXA 2AZDA 4M0FA 3BRWA 4JR2A 1NUSA 3LK7A 1JB1A 4CHTA 2NW6A 4ZZIA 2WZDA 2VQEB 4KK4A 4NQZA 2R8EA 3IHLA 2WMDA 1UK7A 1NMSA 1QQAA 3OOJA 4LNHA 4RK7A 3IQZA 2Y0DA 4MVJD 4MIOA 1US8B 4QM6A 3MPUA 3P2OA 1QNFA 4YJ3B 3FHJA 3CLRC 5HMMA 3Q9SA 1A95A 1P1KA 2FWNA 4JX9A 2C82A 3MINB 2B6NA 4KFTA 1K86A 3E3MA 4PFQA 3NT4A 4JJGA 1YDWA 3HR7A 2ZYAA 4KKXB 1V37A 3H1TA 2VNKA 3LTEA 2DLCX 3IAHA 2H16A 3A28A 1V4NA 4TT3D 2WWYA 1AK2A 1QOQB 3PGVA 5CJPA 1NWHA 3F6EX 4EB6A 1XQWA 5HM8A 1HOXA 2ZVQX 1WHSA 3IILA 3TCNA 3D0RA 1UKVY 2YY7A 4RUKA 4DRXB 4HQKA 1GGKA 2ET6A 4FXPA 1UXJA 3QV1A 3D4OA 4CTKA 3UOAB 1KF0A 1DOAA 2PUVA 3PGKA 2ZIAA 3G8CA 2XNJA 2VI5A 4DG5A 2W8BA 3K30A 2O7QA 3CSSA 2CN1A 1TIPA 5AW4A 4LXQA 3BRSA 4WUTA 1O97D 3SU8A 1GTL1 4K03A 4IRUB 2OPHA 3CMMA 2OCGA 4YMSA 2L18A 3BL5A 4Y30A 1IYZA 3RC1A 5AVUA 3NZEA 1P17A 1A76A 1GARA 1XC7A 4FQ5A 3KU1A 2RC5A 2O20A 2X5JO 1JX6A 2BYTA 1YONA 4M49A 2H11A 3Q3IA 2ZBRA 1TT5A 1G4UR 4NESA 1CERA 1E7SA 2FWPA 2W2KB 2NSJA 1FUUA 1O95A 2WICA 4EQ6A 5ENDA 3J80A 3W9YA 1R5BA 1S2LA 4HQLA 4BZQA 3N1UA 4LHWA 4JP2A 3NHBA 3ZWPA 4ZDIA 1DXQA 5LDHA 3LUJA 1UMBA 1XCOA 3ZDDA 3GRFA 4IDCA 4UW9A 1ZLXA 4V24A 1EWTA 4F3RA 1H3NA 3OQHA 2C31A 4NZNA 1TE2A 3ZVLA 1HYEA 2A9PA 4JJFA 1QQTA 1X15A 2WINI 3BE4A 3W5IA 3PNOA 2Y92A 3SEQA 2DAPA 2FSSA 3FDJA 4BDSA 1H4SA 2NQ8A 1TQ2A 2OV2A 3DP7A 1VJ1A 4FMDB 2J30A 3MRTA 1RXCA 3OAAD 3UKOA 4MS3A 3BGIA 3ORFA 2ZSFA 3JAKB 4NTZA 4AD8A 2R60A 5IJXA 5CK5A 1J9ZA 1GP2A 2C97A 2CF5A 4K6HA 4NHOA 4NS4A 3KHKA 1YQQA 4O33A 5FADA 1OHHA 4UTRA 1WPRA 2ZB3A 3E58A 1SKQA 5AM3A 2P4UA 1ZAYA 1UJ4A 2J9RA 2OHHA 1GXSA 2XT0A 4FINA 4S35A 4OUDA 1LJ8A 4DS3A 1SIBE 3EOAI 3RVSA 4JYCA 3QU9A 2PQ0A 2PT7A 1GL3A 3OQPA 2J7PD 4HRXA 2AN3A 2BFMA 4BU1A 4ZAFA 1KC3A 2MINB 4IIGA 4YLYA 1GTJ1 1DEXA 1E58A 3CONA 3E18A 4N82A 3VDMA 2ZU6A 3P0EA 4CMGA 1U1EA 4HNAA 6REQB 4H9GA 3HUDA 4Y1FA 5FBLB 1QMGA 1N1DA 1CS4C 3CIOA 3FSGA 3V2HA 4C4ZA 1K75A 3F9RA 3BCSA 3RSOA 1SKUA 2Z4SA 5CD1A 1C4KA 3JS5A 3M9LA 2X14A 4AY5A 4QYWA 4MCIA 4R4JA 2B1IA 4OLBA 2RI1A 3WBJA 4PQRA 3DB2A 2RGDA 4KPGA 5EOVA 1G7CA 1QSGA 1TPYA 1JXMA 4F2DA 1T5LA 2AEFA 3MWGA 4M21A 1EFUA 2GZSA 3AVTA 2CSXA 4MVJI 3WO1A 1NVBA 3LCCA 4ZEOA 1E2JA 2FUEA 1A3CA 1F6WA 2ZIVB 4C3VA 1JZTA 2RGXA 1MA3A 3D1VA 3KJXA 2GD0A 1H2EA 3LD9A 2BFEB 1KI8A 2Z3WA 4FZRA 1WMAA 4L9RA 1QFYA 2OZVA 1EIWA 5A6SB 1RRPA 4J03A 3TQCA 2P4EA 1NV9A 3EZ2A 2IWRA 1FFHA 4PHCA 3W6OA 4IPTA 2C7QA 4NV0A 3MGBA 4IV0A 4EG1A 4JCCA 1R8XA 3KBBA 4MQEB 5LP1A 4JLVA 4RNCA 1DADA 1TAHA 4MAMA 1FSZA 4IKOA 2SKDA 4CTNA 9ATCA 3PX7A 2G7ZA 3MGCA 1XZJA 1E61A 3VU1A 4XGRA 1P60A 2CDRA 5JXGA 3O75A 5DXAA 3KEFA 1ADBA 4MKZA 1X77A 3NDRA 1D03A 2Z3VA 1X0VA 2QYOA 4G0OA 4TYPA 1M9NA 4DC9A 1QO9A 1F8UA 3VI4B 4DNFA 5AW7A 5GTDA 3B8HA 3EWIA 3CSDA 4NWIA 3RK1A 3T1NA 4YMVA 3RT9A 3DOEA 3CNEA 4AZVA 1Q0PA 2RGNC 3WWDA 1JU3A 2AOVA 8ADHA 5BSFA 1R8YA 3GLVA 2YHIA 5ILGA 4CCWA 3AYZB 5ARCA 4E70A 1I6MA 2G17A 3TTTA 4LJRA 2HOQA 1COZA 1KMQA 5WRFA 4QU5A 1NA5A 1X92A 1E5DA 1JMYA 4Y1RB 5C9ZA 4Y0AA 2QWXA 3FMFA 4MUMA 3RU2A 2IEDA 4Y9TA 2MJLA 3QPAA 1ZHFA 2WUDA 4EEXA 4FEYA 4L8VA 1NT2A 3T3PB 1SUSA 2WMYA 2WKRA 2P2CA 1NVVQ 1PJTA 5JS7A 1C9MA 2I76A 4MQFA 1N5DA 4JEMA 5LQRA 3HY4A 4NU6A 3A70A 3PL1A 4Q1AA 5AKGA 1J8YF 3GHYA 1JUDA 3IPCA 4O08A 1BJTA 4RD4A 4TLMB 2Y3IA 2IY9A 2VPQA 3FYTA 4I7EA 4MJLA 3AZQA 3R5SA 4G81A 4BO1A 2AC7A 4EYKA 3AVXA 1U7ZA 4KXWA 3AY0A 4Q3CA 4CMHA 5BO5A 1L8OA 2ZAYA 2VP9A 1FS4A 3H5IA 4RJIA 2QAGC 4V0QA 2I4NA 3AEZA 1JWBB 3WK7A 3WWCA 1FLNA 4UPEA 1L8XA 1K97A 3E9QA 5EJ8A 2IODA 2C78A 3IP7A 4WOKA 4Q9KA 3HCBA 4HGPA 2G9QA 3ESRA 1HTTA 4P4LA 2ODWA 4X1IB 1JTVA 1VJCA 2NZXA 2R6R1 2FUG1 4PZEA 3E8MA 1U8ZA 1J42A 3VR6H 4FIDA 1VYHA 2GBLC 2Q5FA 3JWEA 1NBMD 2EWMA 1UDCA 1X70A 1SJ9A 4A1OA 5AQ1A 1U9YA 2QENA 1XRJA 3DMFA 3KSMA 2YYSA 4HXFB 4EENA 1IJFA 3EQ9A 5LYJF 5KYYA 1H5UA 4TVBA 3KQVA 4LV6A 5L6LB 1LVGA 3TBFA 1PZNA 3BRWD 3PE3A 4D9CA 5AI8A 3VR3D 3T0GA 3G1WA 3PFHA 3CVYA 4BN0A 2CXRA 5SICE 3D4IA 2NUAA 5EJMA 5JAPA 1SVOA 1D0IA 5C37A 3HEAA 1XZEA 4BGEA 3HDQA 4M99A 1VMDA 2V0CA 2X13A 2ZYVX 3QVOA 2AYZA 3PI7A 4QUEA 4M88A 5JEDA 2RGCA 3RFCA 5DLDA 2OZLB 5LNK6 4WADA 4PWYA 1FW8A 3VGJA 1MV8A 4P92A 2QLMA 1SU8A 2C99A 1RYNA 4MGYR 3ZY4A 3O8BA 4K9SA 4FHGA 3SG0A 1ES9A 4H7JA 1OD6A 5F64A 4BFLA 1EFAA 3IKLA 4F4JA 4BC0A 3S7ZA 3PF9A 5JISA 1DWPA 1KJZA 1PWEA 4ZYTA 5FEUA 4D99A 1ZVJA 3OZSA 2VDVE 4IZIA 1N1GA 2ZIEA 1F20A 3FUXA 3IDZA 4H0CA 5BWOA 1RRVA 3OPXA 4GL4A 2B37A 2HMSA 2VTBB 1DG9A 1SC4A 3GPLA 3A1SA 2FETA 1IFXA 3LLUA 3KYBA 3D7SA 2XCOA 4Z99A 1RQPA 4CIDA 5I7HA 3IEVA 3T7IA 5E1DA 1VJGA 3AKEA 3KYDB 1SHUX 4KIUA 5HX7A 4YJDA 3SZGA 1PWZA 3NM4A 1DQRA 4EI7A 2H07A 2EX1A 2YUIA 3BHNA 1EX9A 3QG1A 1X80A 4A8JC 2Q3MA 1QV9A 3JATB 4FNMA 4OAPA 3WNZA 4DUYB 1CWUA 1AV7A 3GF4A 2WB2A 1NMQA 3C74A 4TPKA 3OCYA 4BIMA 1F2UB 2VJYA 1P0QA 1T9KA 1RR6A 3KUUA 4JFRA 4B6SA 1Q16A 1X7ZA 1QX3A 1N78A 1MIOA 5T8KC 5LQMA 2J7PA 4DVGA 1B8VA 4H7IA 2NXNA 4PO3X 1PDOA 1HETA 2HLPA 1ICIA 2F59A 5D8DA 2O06A 1QHNA 2FE1A 4OK3A 3WKCA 4D57A 1IULA 2KHZA 1K3TA 4F4FA 5KX5B 4RQBA 2VG8A 2ABWA 2D5CA 4OX9B 3G17A 1M8FA 1U0JA 3GLGA 3QBEA 4BKRA 1M34B 2M1ZA 3L8ZA 1SWVA 4RY9A 2EGHA 4KQEA 2EZTA 5CFLA 5FB3A 1T24A 2X22A 1BYIA 1N5LA 2H00A 1KY2A 4CFYA 4ER6A 2JKYA 3PCRB 1PUXA 1YL5A 3N6VA 5FULA 2WIBA 3BB4A 3EPRA 3H1PA 3I4LA 4ON9A 2IUYA 2DFKB 3P2YA 5ALMA 5JVDB 4EHLA 3RHFA 1C2YA 4ZI7B 3IKMB 4OYLA 3L1JA 5ICEA 2I8LA 3WRYC 1KI1A 1B6TA 3HHEA 3LVRE 5ALIA 5KC9A 3ZVRA 4ZQIA 9MHTA 1NSFA 1J2RA 5EE3A 3ND7A 1R1DA 1PQUA 2O0KA 3ZOZA 4NR0A 4RPHA 5LU8A 3U61B 1Q6YA 3DDHA 1PNTA 4JDPA 4K9RA 4AECA 3X1XA 4UAVA 4ZHSA 1PS8A 4REQA 1XMPA 4AP9A 4M0DA 2R1TB 4EJ6A 4EYQA 3ZK8A 3L1IA 3VJLA 4XGQA 5KZMB 3QELB 2SECE 3ILYA 3TAXA 3GNTA 1L5NA 1Y1LA 1DAPA 3OMWA 1Z2PX 3EBLA 1JWLA 2QBYA 3EEOA 3COYA 1UBCA 3GEGA 2DUMA 1GPH1 2XA9A 2PGIA 3OT5A 2PBFA 2QMYA 1F0PA 1PFWA 5G40A 4AWBA 3MS2A 3AOEC 2DM6A 3O03A 4B6GA 3I9MA 3N2KA 4PZAA 1GAWA 5AJHA 3NM6B 3GXBA 1L4YA 5JYDA 3GLHA 4D3XA 1BMFD 2EFCB 2PSEA 1PFGA 5HJ2A 4WFKA 5FL3A 5HZHA 2YNMC 2XSZA 2IUFA 3MVEA 1L9KA 1T1GA 3MWDA 1XKXA 2QLJA 3OUUA 3LC1O 2O4UX 2ZWAA 3GMDA 1V3TA 4K9KA 3VUFA 3GMTA 2XV1A 4WN3A 1F0NA 2J3KA 3LQ2A 4J0JA 4OBEA 2B4RO 4KDFA 3A4NA 4BQSA 4DWOA 4LPSA 2UZ3A 5F21A 2PKYX 2A9VA 1KOLA 4LZPA 5KQGA 2WT9A 2AQ8A 2CXHA 3NTVA 1P7VA 5DBGA 2JK1A 2RHMA 1KK0A 1VJDA 3L46A 4FONA 1N92A 5E2IA 4L7VA 3QFFA 4Z7QB 1NBEA 1EVQA 2Y0BA 1AT1A 3PP8A 2DTXA 1QHSA 1JVNA 3HM9A 2BJWA 1RVV1 1RE0A 5F7XA 2UUAB 2QTZA 5EJGA 2PZJA 3B53X 3O2SB 1NVDA 3EPLA 4QGSA 2XQJA 4C4YA 4KWIA 2AZMA 3NWJA 5BNIA 4J91A 4YMLA 1E2EA 2W42A 3ZJVA 4EA8A 2JGRA 3ZWAA 4DXHA 3PZBA 2F67A 3LOQA 1L5LA 4A6EA 4EL0A 4HWSA 1QG4A 2VJBA 3H04A 5MGBA 1G5HA 3ANLA 2BISA 3G3EA 4JLBA 4NJMA 1H05A 5HTOA 1RTKA 3TVDA 1CUWA 1PJSA 1TVEA 1J0EA 2YWXA 3HYCA 4PY2A 4JLSA 4BLPA 4IMRA 2FFAA 4GOJA 1J8QA 1Z4JA 4IIJB 5CW2A 4AU1A 5K6RA 4GQBA 4ALJA 4CKWB 2W93A 3MWYW 3Q10A 3ECCA 4H15A 4TM8A 4F5EA 3OMLA 2P7IA 3C43A 2ZRNA 2BVNA 3LKZA 1DFHA 1E4EA 1XD8A 5TS2A 1ZKMA 3SQNA 1NONA 5KQLA 3LUDA 1DC5A 4NV1A 1CR0A 3IOEA 4B3FX 1ZGCA 3E1SA 4QUHA 1I1HA 1A69A 3F3MA 2C9MA 3RV4A 1KGDA 1ATIA 2B36A 4M1SA 1CULC 4IQ4A 3GGPA 4YJHA 3VSBA 4ZFNA 4O2RA 3DZBA 4MV1A 2Y05A 3UWSA 3QTLA 1NE2A 2VAVA 1YVUA 2P2SA 3NR2A 5HM6A 3Q12A 4KVGA 1QV6A 3BKXA 3QVVA 2KE5A 1CZRA 3IKJA 5DHRA 1D04A 1UC5B 2WFMA 4MI6A 1R6DA 2ZJ1A 2N9UA 1LDNA 3HB0A 3P9XA 4L95C 3W4JA 3KPUA 1RACA 1T1JA 2BGIA 1BX1A 1K5HA 2HBQA 1JALA 4BO0A 5EINA 4QJ3A 3M1AA 1ZR2A 4FR5A 3C1TA 4ZPJA 4M86A 4QHYA 4UEWA 3ROEA 3MF4A 4DCTA 5IJ0A 4ARBA 2W2OA 1CUHA 1DIAA 5IKOA 1U7PA 2BKUA 3TSYA 2IKQA 4OP3A 3GX1A 5EMMA 3UATA 3P0RA 3S7TA 2ZU0C 4LF8B 1IM8A 3VYVA 3K05A 1JHQA 2BF4A 2UZ4A 3SAJA 3A6EA 3A3YA 3SR3A 3RUEA 1VPLA 1YAHA 2HSDA 3G0DA 4QL3A 1SXJD 2J0UB 4Y9UA 4ENTA 3G2IA 4C78A 3E9MA 1TF5A 1T3GA 4MI1A 2H7CA 5EUBA 1PIWA 5TSDA 3RC9A 3WK6A 1NGSA 1IB6A 5G0WA 4BFWA 3UHPA 4D9KA 3IESA 4JJ4A 5DEIA 4DLPA 1U9IA 5E0KB 1MR3F 2BSXA 1KI9A 5IKMA 3T5CA 1THTA 4KDCA 4EFLA 2EHDA 4IIFA 1A2KC 4GP9A 1CQXA 1NQTA 3IHKA 4E33A 1A7JA 1FFWA 3MTAA 3OO0A 3V00A 5E1BA 2P7HA 4US2R 2I5PO 2GF0A 2ZB4A 3BJZA 1Y37A 4RULA 1EXVA 3BBPA 5ECWA 5L3SA 2DWPA 4YI5A 4GMXA 1ZRSA 4RM2A 1SXQA 5GIOE 2TS1A 1VPEA 5I4BA 3S28A 3PWTA 1OZAA 1U2SA 5EZSA 2VPWA 3WNQA 3SSAA 5A4JA 5I6DA 4HS9A 3DEIA 1GZ6A 4Y6PA 3W1VA 1EFDN 2W2TA 3T95A 3X1WA 4MW2A 2E4ZA 1O2DA 2HW8A 1N0VC 3FIUA 4HN2A 2WVHA 4OK5A 3PXXA 1GVHA 1JQ5A 4V38A 1QIHA 3I9FA 5C5EA 4EPVA 3UZUA 1WUHS 1NDHA 2ZI4A 1PW7A 2HU7A 3K16A 5B57C 1J21A 4CEJB 2VJMA 4JJ7A 4U5QA 2JFVA 1J06A 2ZWPA 4DY4A 2Y76A 1UZNA 2XCUA 3I23A 4F3CA 3B7WA 4LHYA 2DP4E 2PR7A 2HHAA 1YT5A 2RGYA 1P5ZB 3HR8A 1QYXA 4KQXA 5AJZA 2VDOB 3TUJC 1BZYA 2G77B 3A1VA 2XZOA 4NZYA 1OHHD 4GVPA 1E59A 4ZTUB 4TSFA 3N6XA 5LP6C 2PRZA 3AUAA 1GL6A 5JH7B 4EPWA 4A23A 3FOBA 3HCNA 4G1BA 1TM1E 2DY1A 1V5WA 1O6GA 2DG2A 3CINA 4ZOAA 2G8LA 2JW5A 2XF8A 1UMCA 3HL4A 3T15A 1SBIA 1IOZA 2DWOA 5LB2A 3SEZA 2HRDA 3I76A 1ZJWA 3O4RA 1ZA1A 3UG7A 3C2QA 4XQ9A 5BXYA 2QK4A 1E6UA 3QYPA 4CEHB 2DPGA 5FBRB 3PX3A 4HRAA 5COBA 3VC3A 4B87A 5JSQA 4DV7B 2ECPA 1DC8A 3KKZA 4BYMA 1C1XB 1CHDA 2HPZA 2WIDA 3WMRA 2YV4A 1FMFA 3RROA 2IYRA 3AM3A 5ELLA 1L4NA 2DUWA 1KBOA 3VNQA 1MU0A 1Y81A 3ZDXB 1K0FA 3PF8A 1ZD2P 3QE0A 1OXXK 4HO1X 3I8OA 4LSGA 1SMKA 3AILA 5AJYA 3ZWBA 1ARZA 1H65A 5BNTA 2IGBA 2EFYA 3QLJA 3GVIA 5EJ2A 3MSXA 1D0VA 3WJ2A 5I8WA 5K4GA 3U4MA 3ZTTA 3ROQA 1NJ8A 1DHTA 5CAEB 3CRZA 4X85A 1DJOA 3N0RA 4LDNA 3SHTA 1C1YA 1QF9A 3ML1A 1J99A 2ATVA 3PG5A 3G8BA 2GETA 2I03A 4HD8A 4ZXFA 2JLRA 3LPMA 1T6NA 2BMDA 3ONWA 2C8LA 3STWA 1JJVA 1N4DA 1AKEA 2ST1A 3DDSA 3LCUA 3PPXA 2XGGA 3FB4A 3IE0A 3RVJA 2V7WA 5KYNA 1N1EA 2UZIR 3O8RA 3OQJA 1ORRA 4EKIA 1Y1TA 1AGYA 2HWXA 5K0EA 4CFZA 1QH1B 3OX4A 4JL8A 4D4GA 2I2BA 4EG7A 3K71B 2C5AA 5BN3B 1ACJA 1XA3A 4WOCA 5DN9A 1Q0UA 1ZRMA 1P61B 2IYQA 5K8TA 1P5RA 1D1PA 3GJ8A 3QE4A 2DCUA 2OKGA 3HXPA 5B7PA 1N77A 4UREA 3SF0A 3CWQA 5BW8A 1I7DA 1KP9A 2PH5A 3LYLA 2R8XA 3NBXX 1N33B 5LDGA 4X62B 1ORWA 3LLMA 5EJ6A 1A5AB 1MC1A 4H60A 1EBFA 4NDAA 1SU7A 1GNVA 2F55A 1TQ8A 1X7WB 4UTZA 3EPKA 3ZD6A 2FY8A 5DLQC 5ALLA 3TM5A 2IJGX 3B52X 3QV2A 4TXJA 4FKBA 1RMQA 521PA 3SSNA 1YS7A 3WGMA 2G70A 1PLLA 2FP4A 1LW7A 3AQ4A 2AR0A 2ZRPA 1X94A 5F12A 1CVIA 3SEAA 1AS3A 1YIAA 5K3AA 2VTEA 2CVQA 5CVJA 1W36B 3TI9A 1FJ2A 1E2IA 3MXTA 4JYAB 4ME6A 3UJBA 5BUSA 1MAHA 3H5OA 2XUIA 4DW8A 3NHWA 1N0UA 1BX3A 1Q1QA 2YZKA 1TU3A 3F8WA 3Q0TA 4JUBA 2VJPA 4AJOA 4YR9A 4JOCA 3ZU6A 2OM2A 4ZD6A 4ESEA 5IJAA 2DBYA 2QI9C 5AJTA 2GYWA 2H4HA 4YRSA 1FNSA 4E14A 1XMVA 3PWZA 2XNDD 2TMDA 1WMBA 2VTDA 1FRFS 1LXCA 2IPAB 2HIGA 3GLFE 2HGZA 4AROA 3UGQA 1N9GB 1M2VB 3IQFA 3BMOA 5DWDA 2XQKA 4WHMA 2I2WA 2NSHA 4EHAA 2FZGA 2I3BA 3NP9A 5KJ6A 1JEQA 1WCXA 3PX2A 3CN9A 4IWNA 3QPVA 1JHMA 2IGTA 3WKEA 4WBXC 1GTMA 1IUPA 4WK4B 1V5GA 3DFKA 1O1YA 3RADC 2I1LA 5C5CA 4NNPA 4P3YA 4DNPA 1RCUA 3GC6A 3B36A 1SUEA 1GKKA 2DY0A 2OZEA 3CUYA 3H42B 2PFGA 1DVRA 4JEHA 4KO8A 4OXXA 4PCLA 2GBGA 3GFBA 4Q24A 3JQAD 4R8SA 4W1PA 4HNUA 2DLDA 3WA7A 3ER9A 1FBTA 1ANKA 5DE3A 3VNVA 3H13A 3QKRB 4RJLA 4U02A 2FZWA 1H85A 2ZRQA 3CF4G 3NBUA 3OP1A 4QT0A 1I5EA 2RHJA 3QSGA 3ROFA 1AKVA 1NE7A 4PBTA 1JAYA 1UAGA 4HCJA 3T4UA 4Q93A 4EAAA 2AD5A 2W2NA 2W58A 2PH7A 3IMEA 4RK1A 7REQA 2W11A 3WK5A 3Q11A 1E9AA 4PAMA 3QXGA 4TUYA 4B81A 4CODB 4AT1A 3B1KA 3M6MD 1MNQA 2YICA 4GECA 4L7QA 2W48A 1OLSB 4CMIB 1E32A 4QM7A 1LDEA 3IT1A 4YJKA 4PAWA 1K5DA 3ZJUA 2C92A 1KJJA 5KCMA 3TIIA 1QH1A 1XR3A 2C3UA 4N0QA 2H63A 4EX6A 4NJMB 1Q3HA 5AOAA 3DBLA 1AHHA 1Q7RA 2Z9BA 4B73A 4O29A 5E0OA 2G0TA 3B3GA 1XG5A 3WVNA 5CD9A 3Q9UA 3HB1A 4EFDA 6Q21A 3RC8A 3IDQA 2ID8A 1TMOA 4OGGA 2N46A 4X7MA 4EW2A 2BHNA 4LN1A 3EPJA 2XGJA 4H6WA 3S3TA 4RQUA 4WZBE 5K0NA 3RS2A 1CC1S 3EXEA 1LPMA 3F2IA 3NC0C 1DL5A 4RORA 4YREA 3KSBC 2YNMD 3WFJA 3AU8A 3MMNA 3O8LA 1EUCB 1IXYA 3VISA 2QNBA 4IICA 4NF2A 4C89A 2NUAB 1VGQA 1FDWA 3TMKA 2W70A 3PFIA 5LWQA 3C5VA 3EXFB 4ZKDA 2GR9A 2IL1A 2NSDA 4YONB 4D74A 1MGPA 3B6ZA 1HOTA 2C1XA 3JAMA 2WMNB 4WJLA 3HCRA 1L8QA 4LGVA 5HCUA 2UZ1B 3ZC3A 2VZ9A 3R0VA 3U3DA 2GFQA 1K6IA 2DHDA 2MU1A 3GAAA 3HA3A 4DA9A 2EATA 3F3YA 1K8RA 1YS6A 3UW3A 4HMQA 4BNJA 4KR3A 1AM4D 4ZHQF 1ZK4A 2IW3A 3NWPA 1XPRA 3B6JA 2PWAA 1T25A 4G8DA 5ALPA 3RS7A 3AINA 4XX1A 5BV7A 1OCEA 2FRVA 1VKRA 1EFRD 5BN5B 3ZQUA 3C3CA 2EV9A 1I9CA 2B4KA 2XB9A 4F92B 1NJGA 5FQNA 1T6ZA 5JQGA 5KJ1A 2ZXUA 4MV3A 1RXIA 4N5LA 2PSSA 4BV3A 2GMWA 1N3BA 1YNSA 3N5KA 4DLUA 4BTEA 2WQ6A 3B3JA 1PUIA 3R20A 1JTEA 3KVVA 4W99A 1QR6A 3EXHC 1IMJA 2WUVA 2VTKA 4QYIA 3A2MA 2BFBB 1HZZA 3VR4A 2Q7XA 4B3XA 1YJCA 3H4IA 4L22A 2XOEA 5BOSA 5KYKA 3U56A 1O0CA 4B3GA 1XDDA 4N5IX 1HTWA 2CYBA 4EHNA 1QTIA 3I3SR 3ZW8A 2COKA 2UZ1A 3SQOA 5DWVA 2IU0A 4AIRA 1LU9A 1H4QA 2RJOA 1O5OA 4BVKA 1R5OA 2NVOA 3ZWVA 4A8TA 1BE8A 3OIUA 4O59O 4CQLB 3VR0A 1RDFA 4Z4EA 2HJHA 1UPBA 4UE2A 3SHOA 4OHBA 3UCEA 3UGTA 4CI9A 4EGQA 1PJAA 2DCMA 1RBQA 2YJNA 1UF9A 4O0LA 3VU9B 3ZWKA 4DILA 3K94A 4DL9A 5FFFA 5FPTA 4F9TA 2GKSA 2J3QA 4XD7A 1EA7A 1YCHA 2FWJA 1J8VA 5IK2D 1TLLA 1ZEJA 3CKYA 3DA8A 3SBOA 1B8NA 2HQRA 2Q3FA 2YMQA 3JQ7A 1JNYA 2OLEA 5EKXA 2QJFA 1CK4A 1Z0SA 5IVIA 3L1HA 4LCEA 1S02A 5JRZA 4TV9A 1RE1A 3ICCA 2NMVA 3TQTA 1M34A 1GFSA 4LRUA 4KTTE 2FW9A 1ECJA 2WVJA 2FOIA 3SP1A 2QE7D 2BZGA 1V7QA 2A57A 2ZRAA 4D8XA 4WA8A 1B6RA 3NAGA 2C88A 3IBFA 5FTKA 2HYIC 5AT1A 3DYVA 2VBGA 4HZUB 1F3OA 2P5UA 1IK6A 2ZPTX 1E0SA 4JKOA 5AVVA 3DONA 2ZIXB 5HRCA 1L5QA 2AI2A 2H4FA 4MTLA 5BNFA 5AW8A 1MD9A 3Q2IA 3IUYA 2ZDHA 4RXUA 3HVRA 3I1FA 3TW8B 2YWEA 1D8TA 2RGRA 2XQGA 3E9YA 1RWVA 1N2SA 5I7RA 1KO7A 1Y4AE 4R8VA 3KZOA 1QHFA 4GSYA 3FFAA 1NYRA 3FH0A 2A86A 1EVJA 5IBPA 1LVUA 3B9PA 5HJ5A 1PJ8A 1YS1X 2WI8A 5CHEA 3EQ7A 1H9BA 3FG9A 4KQCA 3LPLA 3V42A 2R6FA 4HVLA 5EIBC 1KHHA 1TZKA 3TSCA 3ABSB 2IXDA 3UHFA 4MCHA 5GVRA 3HCAA 4L4YA 4M76B 2GQ0A 1U7UA 2AKYA 3I04A 4QBGB 2LNDA 2DOKA 3IQDB 4N3BA 3ENWA 5FV7A 2H5IA 1QGUB 1Z15A 1BDBA 2CF6A 2IF2A 2OG2A 3DMPA 4ZVTA 5LD2C 2ZJAA 2XUJA 5JXJA 4X1IA 1O57A 3MMPA 4L73A 4RD6A 4B82A 1C9KA 1G6HA 5IBQA 2BEJA 5DW0A 3B51X 3TTYA 1HDYA 1ILEA 2DBQA 2BT4A 4NH4A 4IWYA 1D2RA 1T8UA 1V9CA 2Z5LA 4KVZA 1KEWA 5J5CA 5TT0A 4AS3A 3UJAA 2KYRA 2GUGA 5FXMA 3R23A 4B3MB 4Z4IA 1Q1ZA 1B15A 1LCIA 2JH9A 5K5EA 3K9FC 5F1YA 1N3LA 4EJ0A 1G4HA 2AFIE 4FZVA 3WLAA 1Z08A 5C7OO 3EGCA 4G25A 4HAZA 3TLBA 2ZREA 5KSPA 1P44A 3GNQA 5LDDC 3Q8MA 3HR4A 3R2JA 4S04A 2P8JA 3EIOA 2WSSD 1SFRA 2DHQA 4R3UC 4J16A 4LIPD 2VR1A 4OA8A 5IVPA 3DFMA 2OHOA 2KW5A 3I3OA 3N75A 2HO5A 1EMDA 1G63A 4RAQA 4WH0A 5J2TF 3T9BA 4C7KA 3KXLA 4FPXA 3T1YB 5M04A 4B2LA 3LF1A 1DO8A 4MVWA 1XFAA 1Q0HA 1U3WA 2RI6A 2XA2A 2BUBA 2GLXA 1KR2A 5GWXA 5H3LA 4HT3B 1A72A 2W4IA 2WAMA 3T0FA 2R1UA 3JSAA 4W1QA 2NYVA 4PPFA 5C8XA 3ORSA 4GVXA 1X9GA 3OPYA 1PKXA 4D8UA 5CT5A 1YJXA 1GEEA 2TYSB 4GRDA 1J9EA 4GPD1 1U28C 2FSVC 2E7ZA 4L75A 2QVXX 2W6IA 5HSGA 2PZKA 4G37A 3RUAA 3P8ZA 4KBGA 3A2LA 3QX7A 2ZT6A 1GG5A 3JD4A 4KRXA 2QRKA 3R3UA 5C81A 2VC2B 4CT4B 1VKOA 2H7VA 2YH2A 4GKAA 3M6XA 1KFEB 1UOOA 3RK0A 1FYVA 1AX9A 1S8FA 3A9WA 1AXEA 1WXIA 2G28A 2WC1A 4JGIA 3SHVA 3VNRA 4CMIA 4EHIA 1YNOA 1ZGAA 1T3TA 3OCJA 4QEZA 2GO7A 3RIHA 2P0YA 4I4TF 3WHKA 5A3JA 2OCPA 1WRBA 2ZTMA 3LW7A 5CFZA 5CIYA 1ZH4A 1VJ0A 2CVOA 2P75A 1NHWA 2WG0A 3IE1A 1O89A 2QYSA 5AWFC 5KTPA 1KOGA 1ENYA 1YACA 5TMPA 2Z57A 4WQMA 4I19A 3C7KA 2CLSA 2X86A 2I6GA 4Q4HA 5E6SB 4E4YA 1NG1A 4HUQB 1RP7A 4KQ1A 2W8BB 1RXWA 3AF3A 4WZZA 1D0SA 1Z5UA 2XNCA 1A4RA 3UW1A 1JYFA 1K6JA 3T5BA 4B2PA 621PA 1YFJA 2O1WA 5HJEA 1EB8A 1PO7A 4D3ZA 2J3DA 4J3NA 4F6RB 4FN5A 5E8JA 1NI4A 3F90A 1IHXA 4MVJF 2O8CB 2M2IA 1YUNA 3K70D 4LRQA 1Y3AA 3I5YA 4CTOA 2XRZA 4L8GA 3DUWA 4TROA 3AP3A 1MV5A 4HVTA 4LJ6A 2NOAA 5AI6A 1KDRA 3OTHA 3PFNA 2DHCA 2GHTA 2FU5C 2D4AA 3JQGA 1TC1A 4ZALA 4G1VA 3DVQX 1FL9A 4JP8A 1EFTA 3I92A 2DLNA 2XVZA 4A16A 3ESDA 2LZ0A 4YP7A 4JB3A 1WS6A 1RKQA 3ISVA 3IR7A 1HFWA 4LJKA 4MYTA 4XGNA 3GJRA 5EFOA 4W5NA 1SVKA 1XLTC 1E2UA 1IUNA 3PYLA 4YAEA 2HL6A 5DMXA 4AYWA 2MSEB 3D7NA 3RNLA 2I3AA 5JJCA 3CB2A 3KYIB 4ND6A 4HK4A 3MCAA 3THSA 4MMYB 4BLVA 1J24A 3NGLA 2CVFA 2FG5A 5K09A 2PA3A 2FEWB 4RY8A 4RKFA 3UY4A 3EGIA 3FGZA 3OTQA 1M2HA 2ECQA 3ANXA 2AMVA 1FSFA 4YRDA 2EL7A 3DLBA 4LF6B 2QUZA 5EP2A 1OX4A 3DSRA 1T2NA 2BKVA 2XDQA 3KZNA 2I6SA 4REOA 5G0UA 4EPYA 4CM7A 1E3EA 3OIWA 5CT9A 3HUTA 4GF5A 1GA1A 2WWFA 4GMKA 2X9VA 3BL8A 3S1SA 2D1QA 4EM6A 5KREA 1EX6A 1NN3A 2JIQA 3QX8A 3B1YA 4HNSA 2B94A 3ZHSA 2PM8A 2C2BA 1R5JA 1M72A 3QLTA 5AFSA 3DW1X 4JA0A 1YE3A 3IDSA 2QXTA 3K4QA 4X9XA 1GAQA 4ZJPA 4NXNB 1U81A 4G5QA 2V4ZA 1Z4IA 5F2KA 3R76A 3U31A 4EUFA 3MRXA 2OL4A 1B8PA 3H0EA 1UXOA 4KW7A 1ZJYA 2MYNA 4Z9AA 3IOYA 5EKSA 2PYDA 3C3BA 2X41A 1YO6A 4FUTA 1T8TA 5BSGA 2GCGA 4O2AA 3TQHA 2DH6A 2YWBA 3KUKA 4ACBA 5L95A 3H2ZA 4QNNA 2PL3A 3U6BA 1VG0B 1YA6A 4LNUB 1R0YA 1WDTA 1QBKC 2MR6A 1PS0A 4I1IA 3W4KA 5HKAA 3AL3A 3F1KA 5EXPA 1YBVA 2G67A 1M0SA 1ZI8A 3A37A 3KKLA 3MAAC 4U2BA 2J4DA 4U2GA 5EPUA 1T0JB 3W5DA 5CLFA 5IUNC 4QDXA 4Z0NA 4LMBA 2I6TA 1KEZA 3S1AB 2K7FA 1EFLA 3R7AA 2UYOA 5D3MA 4YAIA 3TNDA 3A1FA 4EOGA 4AQDA 4BNKA 4Y2XA 3CVJA 3AW9A 4P4GA 3F0TA 2HX1A 2EJTA 1MO6A 2D5BA 3LHIA 2X19A 4M0MA 4ZGBA 5CNMA 2FOXA 1B00A 1SQ6A 5CXSA 2PMFA 2QQ5A 2R00A 1KA9H 4OHRA 4YRTA 4BKQA 5FBWB 1AUVA 1AUPA 4QXOA 3V4SA 4NC9A 1AB5A 4H6VA 4LDPA 2JFUA 1ZD3A 3MS7A 1ZM3A 3ZHTA 1CZNA 4TTJA 3GLHE 3G2KA 3ZBTA 3IAAA 1ISRA 3ZPXA 3WRXC 3ZV6A 3QLVA 3AHDA 3TLJA 2WTXA 4RFSA 3NATA 4BNIA 3ROKA 1I1QB 4WERA 4X84A 4G0PA 3W05A 4CKBB 3GLTA 4WUVA 2C95A 1KAOA 4E51A 3O6VA 3JWPA 1QC5A 3BIWA 2J6HA 5A7FA 3LS2A 2F3TA 4ZJUA 2CBXA 4KEAA 4POAA 3H9QA 5CLJA 3T34A 4L9AA 2FZ4A 4KXMA 2PGXA 4HF7A 3VPBA 3VHRA 3WLSA 3ED5A 1ZU5A 1IEVA 1R64A 3A05A 1Y5IA 1EK5A 1KP2A 1NASA 2YASA 3DAOA 5IDVA 2A0WA 4F71A 3CLRD 1X7YB 1PEDA 3EUEA 3UPDA 4GWLA 4UNIA 2O8DA 1V3QE 3LVFO 3TQSA 3VJKA 1TJNA 1NNUA 1P2SA 1X14A 1YR7A 3E7WA 1E8MA 5D3KA 4U9HS 5KBYA 3MWKA 1YI8A 4KSYA 4RZIA 5KVVA 3JCZA 1YE5A 4KO3S 4ZV7A 3AKYA 4NMHA 4HFRA 1Z8HA 4L6CA 5ICSA 2JI7A 2EGUA 2DETA 2P91A 4ITUA 2H51A 1RS0A 4IDEA 1R50A 1XRPA 3R7FA 1I7NA 4RD3A 1XBTA 4Q1EA 4AW9A 2XWJI 1TX4B 4GBED 3WOVA 4IJ6A 5KNBD 3NUZA 5A4IS 2FE4A 1GG8A 1OXUA 2C2MA 2ZYSA 3SI7A 3ZV4A 4BNXA 3DZKA 3CF2A 1E5XA 1DG3A 1QANA 1KIFA 3GVXA 3IB3A 4MH0R 2WA2A 1ZM2A 1AD2A 2E5LB 1T8SA 3MCUA 1PLKA 2A8YA 4GM0A 2NU8B 1P2VA 2IV2X 5AVWA 4PXSA 2VZ8A 2PEZA 3BXHA 2IYLD 4Z3DA 3X1JA 3C3MA 1NT4A 4MKFA 1T0HB 4LDAA 4YYEA 2VPPA 2UZAA 1DKUA 3D5TA 4DPLA 3JWJA 2ZJ0A 1RWPA 3JWIA 2A7XA 1O9BA 2DPMA 2VAWA 1RYMA 4BLUA 4CMAA 2FFJA 2A9RA 3HO1A 4UU7A 2PIAA 4OLHA 3GMIA 3U7QA 1MXHA 1EJ6A 3STYA 3A4IA 4HBGA 1JKJA 4TX1A 3LXMA 1W30A 2XUPA 3A6HA 3I2HA 4FYJA 3C4VA 4IDNA 4IEEA 4MIYA 1U9CA 4C7OB 5DCWA 3C1UA 2OCAA 1EM8B 2J6BA 3LGXA 1DBPA 3O92A 2NZUG 3LQKA 1KFCB 2AG5A 2ZAGA 3DTNA 5LXTB 1T9HA 1QCDA 121PA 1AQLA 2JFHA 5GONF 5JLJA 2FDRA 2Q1UA 3JQ9A 2GBPA 3IP5A 3NBQA 2Y8EA 3FNQA 4LZAA 1PT6A 2KMLA 1PT8A 2WM8A 3M6IA 4UDOA 3SLRA 3HKDA 4ID3A 4Y18A 1B26A 2Q2OA 2XMPA 4HGQA 2YQZA 4W8GA 2B0CA 3FN4A 3A4YA 5HK9A 4BFUA 1YSCA 4Q1DA 1NF8A 4OUKX 1EPUA 5LZ8A 4N5DA 4C4TA 4JP3A 3B89A 4CDMA 3SE0A 1LF0A 3UMFA 1ID8A 2PMBA 5ALKA 1TYDE 2WIJA 1M34E 3RPEA 3UWMA 5TPZD 3O1LA 2HU5A 3X1MA 2O1EA 1VB5A 1JEAA 1HDEA 1UPUA 3QUTA 4G8CA 1L4BA 1E7QA 4D4LA 2FG7C 2X0DA 1E1CA 2B8TA 1UCFA 1RQLA 2GEVA 4TMVA 2CXPA 3JZIA 1QFSA 4RU1A 4C87A 7ABPA 4RV4A 1V95A 4GOXA 3QPBA 1EA5A 1XCMA 2B3TA 5HE9A 4KQ6A 3A3NA 3KTAB 3VSAA 2PFKA 4FFDA 3K5WA 1RWXA 3DTVD 3K0AB 4JXJA 2QMZA 4L4ZA 5I9BA 4EI9A 3F7NA 3R5XA 2D8AA 2AFVA 4ZANA 1BXGB 2VK1A 4EF5A 4WBNB 1ND6A 3NG1A 2Z5VA 1COWD 1JLLA 4UU1A 1DWQA 4NCKA 5F76A 4N4AA 1M73E 2AL7A 1DINA 2FR0A 2IYTA 4DM3A 1P8AA 3C3KA 4LSMA 2FH5B 1R4MB 3BTSA 4Y6SA 2IHVA 4MW7A 1K7XB 1RHMA 4DIUA 3VR6A 2C58A 4OYYA 5IBRA 1WQ1R 2FPRA 3BWMA 2XNSA 4NVRA 4BN5A 3TSWA 3AU9A 4HYYA 3H8WA 4HWPA 2YQ5A 4UD2A 3ZH9B 3EEFA 1DV1A 3CLSD 4GE3A 4AMZA 2EBWA 8ABPA 3VH4A 1T0IA 1QS0A 4IUBS 5IAEA 1RLIA 1L6RA 1LLFA 3N05A 4EZIA 2BMVA 5AKLA 5H80A 1J00A 4F85A 4MWSA 3GARA 4YMTA 1Z4NA 3KDPA 3PFKA 5KWIA 1DBRA 4BLQA 1XYVA 3VX4A 3D5QA 4RVFA 1QLHA 3OQIA 3IDFA 1VFNA 4FBLA 4X8MA 1FTYA 1RJEA 2PXXA 1BOFA 3RTDA 3ZWDA 2AOTA 2RKBA 3ACCA 3MT0A 1QGED 1W35A 4ICIA 2X1LA 3R9IA 3V7UA 5KOHB 1N34B 3AL0C 3AR7A 2BKAA 2H6EA 3M81A 2CXSA 3KQMA 4Q9JA 3S29A 4DDWA 3OJWA 2FG6C 1RXVA 4GOND 4AZWA 4BB9A 2WTBA 4LJ9A 1THGA 3CEHA 4DQUA 2DQZA 3OZXA 3N2NA 2WWXA 5A5DA 3DHEA 3K5HA 3B9BA 3EVEA 5IRCD 1JSRA 1YCFA 2PZFA 3R75A 4LOJA 1W87A 4HDSB 4JU8A 4I4IA 4I2NA 4F45A 4RH1A 2HBYA 1SBNE 1U2TA 1VHLA 1UWVA 2PV0A 2P6UA 4FKMA 2ZYUX 5DPMA 1CUAA 4YLEA 1WHTA 1O3YA 4HQRA 4I6EA 4BKUA 2YYAA 2RK6A 1ZSVA 2W6ZA 1SH7A 2ZSJA 1VZ3A 1LK0A 2N0SA 3M4XA 1QK4A 1DCFA 2O2HA 1QGAA 4MS1A 4Y67A 4ZEVA 5JHGB 4EA7A 4URHA 1D6SA 4O2BA 2ZQZA 3Q1LA 3P52A 3PNPA 4Q3DA 3V9AA 5A1JA 1XAGA 3DAYA 3REFA 3WLLA 4NBNA 2H4ZA 3VKGA 1KI6A 4REQB 2WJJA 3RU3A 2O1XA 2SCUB 2VIIA 5CB6A 2B8EA 3O1HB 3MHTA 3K72B 3GWZA 1MT3A 1Y5MA 2QRPA 2Y67A 5CNJA 2E18A 1TK3A 1OZHA 1RJ9A 4HH3C 4JOSA 3GLIA 1VCOA 2I7TA 1Y3HA 4NYJR 2P3SA 4JX8A 2J5QA 3GK3A 4C6SA 4NK4A 1USGA 3DD5A 3VPDA 5BN1A 4JI0B 3BILA 1FXSA 4H18A 4A7PA 1SBHA 3OP4A 1MJGM 3IUBA 2HLNA 4E1BA 1YRLA 1E8DA 2DC1A 1QE0A 2ZLBA 5LQUA 2F8LA 3SZLA 4KIJA 4AP5A 3OZDA 4JS0A 4IMJB 5C4GB 2JCXA 4QOSA 4TYYA 1DQZA 2XNHA 4X0EA 5J59A 4EF4A 5C7IO 1KYYA 5LZ7A 3P26A 2B78A 2I6QA 4QLBA 1RHKA 1T13A 3HCFA 3IVCA 4HDNB 5HKKD 3MT8A 1IRIA 1SXIA 2IXAA 3CCFA 3JD1A 4NHEA 1VIYA 4E7PA 2PUCA 3AVOA 5JU6A 4FOSA 5HEKA 4J7AA 1BN6A 4FE4A 5GJWC 3FLMA 1O94A 3E81A 3KO8A 2EDCA 2XDAA 3BZWA 2CJXA 4YO7A 2IRWA 1JAIA 1Y4DE 3ZHOA 2FRDC 5I9SA 2Z6VA 3HP1A 4GI7A 3PC2A 3PT9A 2FEAA 3A9UA 1KZGB 1F2DA 2CUNA 1A8QA 5B6PA 1BE0A 1PYGA 2J8ZA 3FZQA 1EDDA 3KKQA 4YJ2A 2AKEA 5FRDA 3D1LA 4PN3A 3S44A 2BGTA 4BNGA 1XTKA 1QR2A 4HSEA 4NJOA 1U4OA 5A4DA 2QLBA 5KU1A 3DLIA 2PNJA 3QW2A 4MA5A 1NN1A 4Y1EA 2WVGA 3P5BA 3KETA 3MBIA 1G20E 3BSWA 4EB8A 1QNLA 1ODJA 3FTFA 3QMWA 1BKYA 1JT9A 4I4TA 4H7FA 1REQB 4CLHA 1AKUA 3FSRA 1INLA 4ZCTA 3GXOA 3REGA 3D6MA 3H11A 4GPBA 1IJEA 3HUFA 4G0ZA 5E8RA 3DP9A 1OU4A 3E5HA 3TAHA 3W04A 4N5HX 3HGQA 1NXOA 1PWXA 3IVMA 1C1XA 3D8HA 3ZEIA 1L9XA 3F8TA 4GHWA 4E31A 4M8NE 5KTTA 2YZMA 1H0RA 3HVJA 3W34A 1A1SA 1IUOA 4GU5A 5H4GA 1QU2A 4LWZA 1O77A 4MQEA 1XLVA 3VOBA 3HY3A 3SZ3A 3F46A 3C3YA 4OH7A 1R10A 1WSWA 2J5RA 4GUAA 1GGJA 2FMUA 1AGRA 1POWA 4XB6B 4J29A 1VRWA 2NAFA 3QVXA 1T6YA 4I5EA 2JF0A 2QLTA 2NYRA 4RIEA 2VZLA 3GLHB 4BLRA 3QEAZ 4W6QA 4YGYA 3TSZA 4QTUB 3NOXA 2JAPA 4OSOA 3K73O 4C22A 2HA5A 3SIPA 2W6JA 1B1AA 1LJLA 2JGKA 3CLUD 3BUSA 3GAZA 4AX4A 3C8UA 3M9XA 2CL0X 4L4RA 4OGFA 1TQHA 3PHCA 1T15A 5AP9A 4WGFA 3I09A 3UYKA 3BREA 5FORA 4GXTA 4HC4A 3I72A 1PR4A 1G20A 1U90A 1P74A 2KLBA 4RF2A 5HIMA 1WPGA 1B0ZA 1TDJA 1ZD8A 2JHCA 3F71A 4HR7A 3BMQA 3DYBA 3A9TA 4I5GA 2PKQP 3LFTA 2F3PA 4GS5A 1YA4A 3II6X 5FYQA 7YASA 2QG4A 4ZK6A 4YPOA 2G09A 5CA0A 1XTIA 4EMSA 1D2EA 3MC1A 4EPTA 2HQBA 1E2NA 2OD9A 1ATZA 1C4XA 1QH8A 4KYUA 3KM0A 5EYPA 1CVRA 1KSHA 1QG6A 1KJYA 5T4HA 4JI3B 3DPIA 3BJMA 3ODGA 5HOEA 4UXHA 1A2QA 3LY5A 2ZBFA 1BFDA 1KYZA 2CD9A 3SM3A 5JCOC 2BEKA 2YWGA 4Q18A 2ZUTA 2IYNA 3AIKA 3EY9A 3I1YA 3PFFA 4N12A 3SC2A 4E5MA 1F8GA 1O94D 3MTBA 2VN8A 3DZFA 2X8BA 3E22B 4NENB 1GPWB 4A1FA 2HDOA 2W00A 3MD9A 4HQOA 4PIPA 1U4SA 5HKKA 1R12A 1TU4A 4Z9BA 2IYUA 4GWKA 1ORDA 1Q6ZA 3TIXB 1PQWA 4IIJA 3N2GA 1ONNA 1UKCA 1ZL0A 1E9EA 1R0SA 4V2UA 1XTZA 1ZNXA 2IY7A 4OEHA 3SHWA 1F7UA 3LC2O 1W96A 3PLRA 3VI3B 5KPJA 1QE5A 4KFSA 2XLBA 4FGLA 4RK5A 3WMFA 3SKYA 4OVKA 4UPDA 5LVAA 4ZYUA 1OIWA 2ZR7A 3R44A 4D0GA 4NQRA 2QKYA 5DCUA 4L57A 4JT9A 3CX3A 3PUWA 4P1ZA 4TZ6A 1UFOA 4JJAA 4H3KB 3VC1A 3ZUPA 3LXRA 1K2WA 4DB2A 1UK9A 2I2AA 2PR2A 3OFSA 4FT2A 3RREA 2ZJ3A 1M54A 4R1TA 3IELA 3LSTA 1KVTA 1ELOA 2A58A 3L4BC 2R7NA 3DVLA 2BMEA 1A77A 4YMIA 3TL3A 4MR7A 4ARZA 1XWFA 1NN5A 2X8AA 1UFQA 3FWKA 2ZIXA 4TOIA 2X8WA 1YZFA 3D3JA 4YX9A 1MX3A 1JDPA 1UJCA 3HM2A 4I9GA 4DGQA 2BHTA 4QDTA 4PX3A 2PT6A 3PXAA 5FTNA 4MQ5A 4B3DA 3ZIAD 2EF1A 4FE3A 1NSTA 2XWQA 3EG9B 4JBGA 2YVLA 5EQFA 1N75A 4YHBA 3B20A 4PNEA 2BSQA 2EW8A 3OM8A 1RRMA 2YJ3A 3QJ5A 3GLUA 1Z28A 1OI7A 2F1RA 1Z2AA 2BONA 2D3TA 4MICA 4U6NA 4G0MA 3PQEA 1K08A 3A9SA 3EVFA 4TQGA 3ZK9A 1NV8A 3KQOA 1TZCA 1IIRA 5AJVB 1II8A 5JYBA 4G0XA 1LDMA 2GEFA 2G7MC 3S55A 5BMVF 1W88A 2EBUA 2JGEA 4B6FA 1HL7A 3DNMA 3GUUA 3U4QA 2YFQA 2W6OA 2D3WA 4LUCA 2G0NA 3I5XA 3URMA 4YRFA 1GZ4A 4YXFA 1BC5A 1PQ4A 3FPSA 3GB9A 3KUCA 5ALOA 2OC9A 1UBLS 3EGVA 5K0BA 5AIBA 1UM8A 1Y6GA 3DW3X 1AQYA 1Z4QA 2HTEA 3E5MA 3F6YA 4EG3A 4XEHA 1KPHA 4YFYA 1MB4A 2VYVA 3JARA 4N7RA 1H0SA 5FUBA 5IU6A 4NONA 5F3RA 3QKUA 5CFPA 3FTEA 2GXAA 2JFFA 4OQ4A 4E5KA 3Q40A 4F60A 5H16A 4MXDA 1ENZA 4P0PB 3TRKA 4DC1A 3B9QA 3FYUC 2Z95A 1RHRA 4I50B 2YJGA 4OM7A 3OQVA 4RIGA 1U98A 4XE5A 3EIEA 2C5EA 1U6IA 4QOGA 4C03A 3JQ8B 3NI2A 4ABTA 2EX0A 4LJ4A 1XZQA 3N7TA 3RTCA 1H93A 5BRAA 3FOEC 4M9QA 5KNDD 1YR3A 4AWXA 1BYUA 2YWFA 4JQSA 4R1NA 4XFJA 2VP6A 4B7CA 1IZ7A 2IDMA 5K45A 2GXUA 3TQOA 5CVCA 2PU5A 1PUJA 1VA4A 2FPLA 2X0NA 2ZS9A 1MCZA 1DX4A 3PNSA 4IX9A 3BEOA 3LW8A 2IYOA 1GN8A 4WKGA 1Q1GA 3QHAA 4MQFB 3BGVA 2I3GA 4XIJA 4TVSA 3FJYA 1GTVA 2XKAA 2NSYA 4RF5A 1JMKC 1NLMA 4AJ4A 5ED4A 1YXMA 3GN1A 3OZAA 3AX6A 4FR0A 1NQ5A 4R2JA 1BRTA 1FFAA 4PWZA 4MYCA 3W3AA 3QVJA 1IOWA 5JEEA 5M7EA 5BR1A 2XXJA 2HCRA 3PWSA 2IELA 5LP6A 2XOXA 3L3BA 1O6CA 1NUPA 3G5LA 3PXEA 2JATA 3QXHA 5B36A 3RE1A 4F2PA 3EXIA 4QWWA 4X44A 1X8JA 5HFJA 5BYKA 3I2IA 1KZHA 1NNEA 4FFBB 4WMLA 2N3ZA 4RFVA 1PVVA 1LJUA 4XUDA 5EWLB 4H7EA 4KPEC 2C8KA 1T43A 3FOWA 5F7JA 1QO0A 1HLGA 5C51B 1Q12A 2QHXA 2I80A 3WIDA 1F6BA 4IWXA 2PUGA 3K32A 1W0JD 1Z73A 4DY6A 1GFIA 2O2CA 5TR9A 2TMGA 3G8YA 1IE3A 3OA2A 5K3EA 2JGLA 3PUJA 4OXKA 2QSYA 4O1HA 4YUVA 1Z38A 2O6HA 5D86A 4R5HA 4HQNA 2O50A 4F8EA 3U4GA 1ULBA 5CVUA 1D2GA 1VJRA 3LGAA 2XZTA 2ZROA 2HMAA 4C3ZA 3AR8A 2FEKA 5HE8A 1IWOA 4INAA 4EPRA 3UHOA 4OSEA 4UUQA 4Q0MA 5A05A 1IG3A 1QCCA 5F1OA 2VH1A 3GGDA 4KZPA 4JXXA 4MQUA 2ONJA 5KTKA 3A1NA 4MAAA 2GJ4A 3IALA 3V1YA 4Q1VA 1EK6A 3A3OA 1W5BA 4NI5A 5DW3A 1L7MA 4K3VA 4NOJA 4QTTB 3V32A 1L7VC 1QVWA 4YDRA 2NM0A 4FFBA 2OKCA 1Y9AA 5LXTF 4PLHA 4IF4A 4WCFC 1O08A 5F52A 3AF4A 5LMZA 3LBIA 4JU9A 2ZR0A 5AOBA 2B9EA 2X5NA 3KLMX 3KBOA 4KXNA 1T3LA 2PU7A 3JQ9C 3R6GA 1E0DA 5JG7A 4DR4B 4ZCRA 4IQGA 1L5SA 3PXGA 2VNHA 1C7ZA 2WPNA 4EJSB 1ZCBA 1N2CA 4WL0A 3S2ZA 4MA0A 3SKVA 5AHKA 5KINB 3GRPA 3LY7A 4G4SO 3L7JA 1WMFA 1XJ0A 5E6RA 4RTJA 3EAGA 1G59A 5FPHA 1XPUA 4P3XA 4NPCA 1C7QA 2J32A 3TEFA 2ZI3A 1JYSA 1V16B 3DT6A 4C9BA 2JZCA 4LYJA 3CNNA 1XVVA 5ITSA 1G3UA 3QWFA 4OP1A 1U2PA 4IYJA 1FFXB 1FP4B 1P0MA 5T6MA 5JD5A 4MDHA 2O8EB 1CB7A 1M0WA 13PKA 4WZBA 4YACA 4NCHA 3V8VA 3TLCA 1G20B 1JSXA 5DSTA 2JGJA 4C01A 5CMLA 4G26A 4M7RA 1RI4A 4XWKA 1IXKA 3KU4A 5HKOA 1EINA 3L0PA 1O96A 1PFQA 1WCYA 2VJCA 3VHXB 2IU3A 4ZO8A 1R27A 4H3VA 3OD5A 2CV0A 3L5KA 1ZUNA 1QG0A 2C0QA 1A82A 4R0VA 4QX6A 4CU5A 3H6KA 4Y2SA 3FYUA 4Y2VA 5DNEA 2IHZA 3NLLA 4RMIA 2Q9CA 3BRCA 3BPSA 4XI9A 4R7GA 5AOVA 1SCDA 2NO4A 4IO1A 5FTJA 4JI4B 3I9JA 2D5AA 2OBMA 3CX4A 2D0DA 2CNBA 2WU3A 3B12A 2NUPA 4CM8A 1ZWKA 2ZPUA 2QXUA 3E05A 4GI3A 2XTNA 2C4KA 4Z9XA 3LRPA 3LA6A 1E62A 1GKUB 2NZVG 4AZ3A 2BTOA 4D4IA 4YCMA 1AGXA 3MFQA 4IDGA 2ZIGA 3E9DA 4W82A 2A2ZA 3TLMA 3TKLA 5ECGC 1QH0A 5SZHB 4NIMA 2NV0A 4CM1A 3NEAA 1DEOA 4LQ4A 3W7BA 1XQXA 4AVYA 4Q9AA 2CDAA 1EUDB 3GT7A 4DBLE 3RFXA 1JVBA 1NP3A 1YQTA 3MJVA 1DKLA 5TX7A 1KI2A 3OEHD 3RI3A 1RYHA 3WL7A 2NYAA 2ZR8A 5IBCA 1UIMA 4GO1A 1N6NA 4RXMA 5HCNA 2NQ2C 2QN2A 3ZHVA 4BMOB 5IZCC 1E3LA 2O3SA 5DRTA 4OJKA 1TW2A 4JHXA 1GPKA 3OU6A 3WXMA 4DPMA 4B5KA 1T5OA 1Y1RA 2DFVA 1SRRA 4N0PA 4P53A 5MF6A 4F96A 3UJHA 2CYAA 1BKDR 1T9AA 1UAYA 1YQEA 3KQYA 4Z7NB 3N6RA 3WK8A 1H6CA 2FQXA 1G18A 3RVLA 3JQ8A 2II6A 1W6RA 3TNFA 2RJNA 3DL4A 4GP7A 2BFFB 3W78A 1OVMA 5FTWA 4LISA 2FUNB 3OX2A 4M3NA 3Q5GA 5FCDA 1I01A 2NVWA 2YQ4A 2QW8A 3BICA 2CHEA 1B0AA 4HWTA 4QPPA 4ZVOA 1SBYA 3UAXA 2X4LA 1E77A 5G3ZA 4UZEA 3OFJA 4CV2A 1OAOA 1DAFA 1EUDA 4WLFA 4UMVA 4AK9A 1OH7A 2B21A 4G65A 1KBZA 4DCPA 1WP9A 3OJLA 2JS7A 2K7ZA 1S5PA 1EGMB 3JTEA 5L7YA 4Q4JB 4QUGA 2QTTA 1T4CB 2YJ6A 4TKMA 4URVR 1V8OA 3CFYA 2CLLB 3EEYA 4H27A 4HB3A 1Y48E 2GPJA 4WZ6A 2O5CA 3M1LA 2ZRMA 1OT3A 4YDSA 3AZOA 1WMSA 1FTGA 1YHZA 3IUSA 3KHSA 3D4BA 2Z6UA 3RAGA 2D2EA 1FQOA 1T0PA 1XZAA 2LVBA 1GV1A 4NCIA 2H2GA 1KQNA 3SC3A 1II9A 4CQMD 3GRZA 5L9AA 2OXEA 4I8XA 1F9EA 5GONB 3IEMA 3GZ4A 2ONKA 4WW0A 4AX8A 3PRKE 2R7AA 4QXAA 3NBYC 1D09A 5IJ9A 3U9TA 4ZREA 3EZ7A 3G1UA 4J4HA 5LIPA 2WFLB 5EWMA 1J2EA 1K68A 1ZRNA 3ETDA 4NBLA 5C80A 1Q83A 3NTOA 4GDFA 3HKBB 1NDUA 3WSTA 3ZDEA 2MHCA 4L4UA 1EUQA 2VHTA 2JEZA 2CCKA 1E3JA 2UYGA 4PHTA 3QF4B 2P6PA 3ETJA 2GM4A 3ZHUA 3Q3EA 1KMCA 4EW1A 1E3QA 2FWMX 3WBBA 1G66A 3E35A 2P3QA 3O74A 3OZWA 3O3OB 3T7KA 1XKQA 5JSFA 1BH6A 1GDDA 3AKZA 1B41A 3ABRB 4BJ1A 3X44A 4C0LA 1PL0A 4GRIA 5C35A 2WYHA 4C06A 5IHXA 3FPAA 3TLZA 1K8XB 4YRLA 4H08A 2B25A 1G9TA 1Q2XA 2IE0A 5BRNA 3WLTA 3WLOA 3ZWCA 4AULA 1PR3A 2GCNA 3MJTA 5J2UF 3K0EA 2W8ZA 2A59A 3P96A 3AY6A 2Y0CA 3DCNA 3A27A 3VYWA 3LI2A 3FZEA 4GMGA 3ZGXA 5FOUA 3TD9A 3FUVA 4BNYA 1HQKA 2AJBA 3VNBA 1CEYA 3TF5A 1Y1SA 2E49A 1VRVA 2JGDB 1UKBA 2V7EA 3FVQA 1KEKA 2PGOA 5H02A 1QK3A 4HB4A 5CCBA 2V6IA 2F64A 5BWNA 1J2JA 5SV2A 3BH7A 4JJ6A 1KDYA 5LP6F 1CB0A 1WUJS 1ZM7A 5B2ZA 3DWEX 4LRXA 5F9HA 1JR4A 4K8OA 2JZOA 4KGVA 3KT8A 4DM4A 1R6AA 3M34A 2OUIA 5EUMA 1M2OB 2BLLA 4GBJA 3RF6A 2GBIA 3BFXA 2K6GA 2PYIA 3Q6MA 4DXDA 5JYEA 4TRRA 4Y1GA 2YN4A 3T54A 1ECFA 4M53A 2O14A 1M0TA 1FFXA 1FP4A 1VYVA 3NOOA 3OLXA 5GZ6A 4D41A 3DHYA 3CPSA 3PDWA 2IH2A 4EHKA 3P4UA 3M89A 4Z54A 3C6QA 4LRWA 2QU7A 2YBDA 4RKRA 2PJDA 3PJRA 4KLAA 2CXNA 2JJYA 4J3JA 4P08A 4ZU3A 1VE7A 3KJEA 2P3LA 3PIIA 4QU8A 3CZAA 1KYIA 4UU8A 4XIYA 3Q6NA 4KOEC 2NU7B 4KZKA 4ENRA 1SBTA 3ZZNA 3WJ7A 3ZU5A 1SHKA 4QWMA 1FC0A 1I30A 1E2MA 4EJSA 1I7QB 2P6MA 5H0IA 5EZYB 3FKJA 4ZI7F 3KDSE 3RC7A 4DJFC 5REQB 3N8KA 4BO9A 5IXSA 1ZW1A 3BT7A 2FFRA 1EHCA 1GQYA 1SIWA 5DTEA 1F7VA 1E7MA 5TS3A 2A0FA 4FSXA 4RIHA 3BCUA 4AY4A 3QXJA 4MLPA 5C1OA 3K70B 2GRAA 1O95C 1P45A 2W98A 2NPFA 5KNLA 1X1AA 3KOYA 2PK3A 4LF5B 4KXQA 1YVDA 3HKDB 1K63A 3RARA 2C20A 1PNRA 3L6OO 4JNCA 5EUQB 2IHUA 2P0AA 5HF6A 4EB3A 2CNDA 2VNJA 1LPAB 2A35A 2ZCVA 1PNOA 3DHVA 4LYEA 1I7LA 4PZDA 4RVSA 5AKZA 1N2ZA 1RZRA 3C6YA 1W76A 1ZXLA 2Q1YA 2J3EA 2I91A 4ZTZB 2XNDA 1Z8DA 4IH9A 4BKOA 3IUEA 3D1JA 4BX8A 3H16A 3OY2A 2QUJA 2PGAA 2YHIB 4LZOA 1YZNA 4XQEA 4ZVSA 3HDTA 5L6MB 1G8JA 1L3BA 1XEXB 3FI9A 5CB4B 5KEIA 2H1OA 1ZVMA 3WAKA 1XCPA 5JXWA 1Z74A 4BFCA 1VKZA 4KRYA 2SCUA 4J16C 4QQ8A 3W2FA 5IH7A 2HQ1A 2X7JA 3G88A 3NIFB 3ERCA 1XDZA 4HEA6 5F51A 3W3AD 3L01A 2INGX 5MDHA 1F8XA 1MB2A 3B2QA 3DH0A 3PNLA 3Q85A 4BO6A 1V2GA 5ILQA 3N0VA 4YECA 3RUCA 5C46F 3MWEA 5IC4A 1NR1A 1OFGA 1IVSA 2YW9A 3O93A 1DTSA 2RE8A 1NKTA 2WWGA 3C5EA 2N75A 4I99A 1W75A 5JD3A 3BSFA 3BDVA 4TMYA 2F4VB 4G4SP 4O5AA 1LVHA 3GRUA 2EQBA 2XRYA 4M7OA 4WX2B 3T12A 4ZEMA 2R97A 1JFTA 4JXZA 1OMOA 5I8PA 4L07A 5FAKA 5JBQA 3DM9B 4R9VA 1JEDA 2IFTA 3UGKA 4W9NA 3D3WB 5HIJA 2FX2A 2NYUA 2VDJA 3N8GA 4MJXA 4X71A 1P7PA 2PG3A 3LZ6A 2RGNA 3F4KA 1X1QA 3H1GA 1XHFA 3GVPA 2VWPA 3PTAA 4P80A 5CVDA 3CE9A 1RWQA 4F1WA 5BMOA 2C83A 4C4RA 3TXXA 5BQXA 4QYSA 3W2HA 4DDVA 4JLKA 4LX8A 5DISB 2C7RA 5IK2A 1SXJB 4KN8A 3Q7EA 4CNBA 4WTOA 5ES4B 5IULC 4YY3B 2WQZA 3PU6A 1O0BA 3DTTA 4BMCA 3TOSA 1WZIA 3LX4A 3MMZA 3DMYA 1FDTA 4YT2A 1L4MA 3F6RA 5ALDA 3PPWA 4JXKA 4E03A 4QLOA 4AMYA 2REXB 2VNAA 3GEBA 4LXYA 3EH2A 5JARA 4LHEA 4OQLA 1MW9X 4ARAA 3EA5A 4BZXA 1J8FA 1XCGB 4RTMA 3NTRA 3ZE2B 4ESHA 4OMFG 1OI4A 3OSZA 1CF9A 3GR6A 4D1YA 2QZPA 4V3CA 1NW3A 3QU4A 2DHEA 1POXA 3LL7A 1XZBA 3A9RA 4ND4A 4ZOLA 3MD0A 1HFEL 4IXMA 2E4WA 1HX7A 2X3YA 3NYRA 2B1RA 1FMCA 4RL4A 1SZCA 2B82A 4JLWA 1NZDA 3T1QA 4YCJA 3V8NA 1SCNE 2LCFA 5E7IA 5EVCA 4F9GA 4LCJA 1KPGA 4BWVA 4XQ0A 2FW6A 2VH5R 2P69A 1PBNA 1UXGA 1Q95A 1Q7CA 5BXQC 3LRTA 2ZRGA 2ZJZA 4YK7A 4HXGA 3PDJA 5AVTA 3P71T 2C98A 2BM1A 3H2YA 2IU6A 2JLQA 1C5KA 3WE7A 2YL2A 2W6PA 2CJYA 2BCEA 4DMFA 3IAUA 4R1SA 5BQPA 1NJSA 3J81A 5CIWA 1ECLA 1ZOOA 2JGDA 2IIBA 1ZK2A 4YRRA 3ANNA 2XTAA 4HVAA 1U2DC 4UM7A 3FWHA 1Q1AA 2J9XB 5A4FS 4UDXX 1EG7A 3BXEA 4UBOA 5D51S 2JDID 3L7OA 3OUTA 1G8FA 2IPMA 4P98A 5F4ZA 4AG3A 4D0NA 4FYPA 3QI7A 1CZKA 4KYIB 4V39A 1ZN9A 5DHAA 1GPNA 4TQAA 1ZH0A 3PNKA 1KMHB 1N6OA 3ZDYB 1NQXA 4F4CA 2CHUA 3B82A 4HX2A 4I55B 2UUOA 3FW1A 1DWOA 1T2VA 1OBCA 2P9TA 3IIKA 1UQTA 4A0QA 1EFCA 2WZBA 1NVVR 3AV0B 4TGLA 4L8YA 5EWLA 4Q7LA 2ODAA 3MJHA 5T4FA 3ZWWA 5LZ4A 3FGNA 4UUMA 3EIWA 3I2FA 4EYEA 3MB5A 4EDHA 4AJHA 1NVGA 4RTKA 5G0TA 1G9SA 1JFFB 1DLJA 1Y33E 4X00A 3RHSA 4B44A 1UDBA 4J6EA 4HVCA 4NBTA 3LYHA 4X7RA 1DXHA 1RAIA 4L76A 3VR5A 1FYWA 3S27A 3H18A 3VTZA 1Q7EA 2B61A 1GGNA 1VSVA 3JQEA 1C0EA 1EHYA 2G1PA 3D59A 4OMCA 2O5EA 4O3MA 2DKFA 2ERYA 4UQPA 3FKSD 2F8SA 3WK4A 4PC1A 2MSLA 2PZAA 2VYFA 4NBWA 5IUKC 4D44A 4PN7A 4OLFA 3IHWA 1R9JA 4X7BA 1V6AA 2QVGA 2IK8A 3IAEA 3QKSA 4Z6KA 4W6ZA 5ALVA 3NXSA 1J9GA 1N2IA 2JA1A 2VF7A 2YJ4A 3EXAA 3HKCA 3BXFA 5B1EA 4N49A 1F14A 1R6VA 2HMYB 2HN9A 4CMEA 4PXYA 2B4AA 2GJ9A 4HQFA 4P81A 3U9LA 2WG2A 1U3FA 1ECGA 1OLOA 4WLUA 5ERYA 3HNPA 4DM7A 5JASA 2CLMB 3TR5A 5IN4A 1LX7A 2RH4A 5EMNA 2JI6A 1N3IA 1QYVA 4IDOA 3SVZA 2HH9A 4QDOA 1GTSA 1USIA 2ZYIA 3PUXA 1ZISA 3QFSA 5KTMA 4MUXA 2NXWA 2VXOA 1H69A 2O7VA 1R0RE 1L6IA 1CE8A 3DLPX 3OFVA 4LHZA 4MW5A 4RLSA 4GM4A 4DLVA 3RIXA 1UT6A 1OYWA 5EIFA 2VRCA 4LFBB 1VZ2A 2ZJ2A 4C3UA 4YRNA 5AKIA 5KYUA 4CIYA 3AJDA 1Z8FA 4QAJA 4DC0A 1U2ZA 5EJIA 3D7RA 2QR3A 2X1VA 3PUKA 4RA9B 5AK5A 5DNYB 1BHQ1 1X7YA 1YVRA 1Z17A 1Z88A 5KDLA 5GINE 3NKLA 4YJ2B 3ZDAA 4QGHA 1WXGA 5ICFA 2A0UA 3NKVA 4WFQA 3AH8A 4AJEA 2CYCA 4JVSB 4P8RA 2B30A 1UJ5A 2I87A 3LT5A 4PQGA 4ZEXA 3THWB 4IZ6A 3SIRA 1GDTA 3IOMA 1QP7A 3QPDA 4ZZ0A 5B3JA 4R2IA 4HNHA 3OCXA 3ESYA 3CUSA 3I4CA 3Q6IA 3PDIB 4WE3A 1I4TD 1FXWA 3KR2A 3RRJA 3UAGA 4F2GA 3OZIA 1IBMB 4FYMA 2FHSA 3VVBA 3LRXA 1J2UA 4M55A 2PANA 4OKIA 4QJ5A 4ZOCA 1GSHA 1LEHA 1KO1A 2NV2B 4I55A 1QRRA 2ICAA 1SCUB 4NFSA 1C0IA 3K2QA 5KYWB 3M0EA 2E5WA 4DJAA 4HX9A 5KYUB 4KC0A 4IQ8A 1BKSB 1YL6A 4LOAA 2R1TA 3F5MA 1RP1A 2IXTA 2QTMA 1FF9A 2Q9AA 3PC8A 3QLUC 2WOOA 3BD7A 4QPJC 2X3FA 4OGKA 4TZTA 5T3UA 5JHHB 1PGNA 4I50A 5JXIA 1SO8A 4B9EA 1KVRA 1NBMA 1SG6A 2GVZC 2WSMA 2OCXA 2XODA 4XZ3A 5EL0A 4E2XA 2HNAA 4KMMA 5D3MB 1FQKA 2I67A 3I04M 4PS1A 5J58A 4K0KB 3GW8A 1Y8ZA 4G36A 3E1KA 3H75A 4ZVQA 5KS2A 3UXMA 1HYQA 2VF5X 1P2GA 1XQYA 3QU7A 5A9TA 4B7XA 1A97A 4Y2JA 3ZKAA 3V8QA 3JQCA 4I14A 1PI3A 2H57A 2ZJOA 2X1MA 3ZHYA 2EP8A 3H8SA 4AF6A 2XB2A 2DBVO 3IFSA 3W8EA 1L1FA 2WJ3A 1XQ1A 4XGIA 3WHLA 4R54A 2VYNA 1UQUA 1JB9A 4HB2A 1XL1A 2YR0A 5CT8A 4EA9A 4YRKA 1VLVA 4TQUS 4M46A 3H5TA 2KM1A 2PDAA 4O4HF 1V7CA 2ZUSA 1JFRA 5AUNB 1QVZA 1VHDA 1VPVA 1V2HE 2E4VA 5KTNA 1NI3A 1CIPA 2IZZA 1QH8B 2QU8A 2RHOA 2ZSBA 1L8AA 4QUJA 5AKHA 1NMEA 2ORED 2R62A 1NR5A 2MYTA 1VB3A 4ZU6X 3GT0A 2AD1A 3C3AA 2ZULA 1G8KA 1YZ3A 1TT7A 5JS2A 1S8AA 4WRRA 2IUUA 3THXA 4KODA 4UTOA 3GP8A 3T5PA 2V8OA 1XD2B 2CDBA 3LDAA 3A6ZA 3H9BA 1L5YA 1WABA 5E4TA 2K87A 3MRSA 3EE6A 3OE7D 3QXXA 4BO7A 5KOHA 2O2EA 1KMIY 2HK9A 5BR4A 5IM4A 4OHVA 1GKIA 2X4DA 1CJUC 2R8PA 3MGKA 2O8FB 2P40A 1M2EA 2XCLA 1XDSA 3IP1A 3F2VA 2RFLA 3IA2A 5BSRA 5FQOA 5EEHA 4MQMA 1E5TA 3UOGA 5A3QA 5AVZA 3PDUA 3VVCA 5C0OE 4A27A 4RK0A 4O2BB 4D5GA 1IEWA 5KPDA 2A92A 2JFWA 2H2DA