2NSPA

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide i
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nspA00
4YZXA 4W8RA 4OJPA 4XN3A 3VSUA 4XLFA 4OJLA 2X6XA 4OJOA 1OFLA 4U4BA 2X6WA 3B90A 1O8EA 4MR0A 1IB4A 2PECA 3WWGA 5C1EA 2PYHA 1O8DA 4XKVA 1O8LA 1WMRA 1K5CA 3EQNA 2NSTA 2NZMA 1EE6A 3EQOA 3VMWA 3B8YA 4YELA 2NT9A 4OJ5A 3JURA 1PLUA 3GQ7A 2QX3A 3GQAA 2O0WA 3GQ9A 2VBMA 4MXNA 2NSPA 4XKWA 1XG2A 4XLHA 2X6YA 4HWVA 3FY3A 4URRA 1AIRA 4W8QA 3VSTA 2PYGA 1O8FA 4NK8A 3VMVA 1GQ8A 4AVZA 2O1DA 4XOPA 4PMHA 4XL9A 1O8JA 3UW0A 2O0VA 3LMWA 3VSVA 1DBGA 1VBLA 2NT6A 2IQ7A 2UVFA 4W8SA 2EWEA 2UVEA 4W8TA 4XLAA 4YZ0A 4XOTA 4XM3A 2INVA 1CZFA 1NHCA 4XR6A 1HG8A 2O04A 5C1CA 1PE9A 1BN8A 1OGMX 2VJJA 2X3HA 1BHEA 4Z05A 4OZZA 3SUCA 1RU4A 3KRGA 2Z8GA 1IDKA 4XLCA 1O8KA 1QCXA 4XN0A 4C2LA 4XQFA 3T9GA 2QXZA 1O8IA 4Z06A 4XNFA 4Z03A 1O8MA 2VJIA 1DBOA 3GRHA 3ZPPA 2X85A 2QY1A 2NTPA 4YZQA 1O8HA 1RWRA 1KCDA 1RMGA 1IDJA 2O17A 4XMYA 3B4NA 1OOCA 4YEJA 1OFMA 1IA5A 1JRGA 4XONA 1QJVA 4YZAA 4U49A 1JTAA 1PXZA 2NTBA 4OJ6A 1OGOX 2BSPA 4OZYA 4I84A 5AMVA 2VBKA 1X0CA 4EW9A 2INUA 2ODLA 4XLEA 3GQ8A 4NK6A 3ZSCA 1KCCA 1H80A 2NTQA 4XORA 1KTWA 1O8GA 2VBEA 1O88A
chains in the Genus database with same CATH superfamily
4YZXA 4W8RA 4OJPA 4XN3A 1LLZA 4XLFA 3VSUA 1TYWA 4OJLA 2X6XA 4OJOA 1OFLA 4U4BA 2X6WA 3LJYA 3B90A 1O8EA 4MR0A 3PSZA 1IB4A 2PECA 3WWGA 5C1EA 2PYHA 1O8DA 4YEIA 4XKVA 1O8LA 1WMRA 1K5CA 3EQNA 2NSTA 2NZMA 1EE6A 3EQOA 2BM4A 3PETA 1TYXA 3BH7B 3B8YA 4YFOA 4YELA 3VMWA 1EA0A 2VFPA 2NT9A 4OJ5A 3JURA 1CLWA 1PLUA 1EZGA 2J8IA 3GQ7A 3H09A 2QX3A 3GQAA 3N90A 2O0WA 3GQ9A 2VBMA 1HF2A 4MXNA 2NSPA 4V02C 1XG2A 4XKWA 1QA2A 4XLHA 2X6YA 3TH0A 2W7ZA 4HWVA 4YDTA 3P4GA 4YCQA 1OFDA 3FY3A 2XT4A 4URRA 1AIRA 3PSSA 4W8QA 1LLWA 2PYGA 1O8FA 2VFMA 4NK8A 1GQ8A 3SQVA 3VMVA 3VSTA 1TSPA 4AVZA 2O1DA 4XOPA 4PMHA 4XL9A 3ML3A 1O8JA 3UW0A 2O0VA 3LMWA 3VSVA 1DBGA 2IOUG 1VBLA 3RIQA 2NT6A 2IQ7A 1KQ5A 2B0RA 1WXRA 2BM5A 2UVFA 1QA1A 4W8SA 1TYUA 2XTYA 2BM6A 2EWEA 2QYUA 2UVEA 2O6WA 2V5IA 4W8TA 4XLAA 4YZ0A 4XOTA 4KH3A 4XM3A 5JMCB 2G0YA 2INVA 1CZFA 1NHCA 5DNSA 4XR6A 1HG8A 2O04A 4JRAC 2BM7A 5C1CA 1PE9A 1BN8A 1OGMX 2F3LA 3SY2A 2VJJA 2VFOA 2X3HA 4OM9A 1BHEA 4Z05A 4OZZA 3SUCA 3BH6B 1RU4A 3KRGA 2Z8GA 1K4ZA 1IDKA 4XLCA 2BX6A 1O8KA 1QCXA 1TYVA 4OPWA 4XN0A 4C2LA 4XQFA 3T9GA 3DU1X 2QXZA 1O8IA 4Z06A 4XNFA 4Z03A 3NAWA 1DABA 1O8MA 2J8KA 2VJIA 1DBOA 2VFNA 3GRHA 3ZPPA 2X85A 2QY1A 2NTPA 4YZQA 1O8HA 1RWRA 4YC5A 1KCDA 3LYCA 3SZEA 1RMGA 1IDJA 2O17A 2XT2A 4XMYA 5JLVC 3JX8A 1QRBA 3B4NA 3AK5A 1OOCA 4YEJA 2VFQA 1QRCA 1OFMA 2XTWA 1K8FA 1IA5A 1JRGA 4XONA 2QZAA 2XTXA 1QJVA 4YZAA 4U49A 2XC1A 1JTAA 3NB2A 1PXZA 1L1IA 2NTBA 4OJ6A 1OGOX 1QQ1A 2BSPA 3SYJA 4OZYA 4I84A 5AMVA 2VBKA 1X0CA 4EW9A 1OFEA 2INUA 2ODLA 1LM1A 4XLEA 2YUHA 3GQ8A 4NK6A 3ZSCA 3N6ZA 1KCCA 1H80A 2NTQA 4XORA 1QA3A 1KTWA 1O8GA 2VBEA 1O88A
chains in the Genus database with same CATH topology
4YZXA 4W8RA 4OJPA 4XN3A 3VSUA 4XLFA 4OJLA 2X6XA 4OJOA 1OFLA 4U4BA 2X6WA 3B90A 1O8EA 4MR0A 1IB4A 2PECA 3WWGA 5C1EA 2PYHA 1O8DA 4XKVA 1O8LA 1WMRA 1K5CA 3EQNA 2NSTA 2NZMA 1EE6A 3EQOA 3VMWA 3B8YA 4YELA 2NT9A 4OJ5A 3JURA 1PLUA 3GQ7A 2QX3A 3GQAA 2O0WA 3GQ9A 2VBMA 4MXNA 2NSPA 4XKWA 1XG2A 4XLHA 2X6YA 4HWVA 3FY3A 4URRA 1AIRA 4W8QA 3VSTA 2PYGA 1O8FA 4NK8A 3VMVA 1GQ8A 4AVZA 2O1DA 4XOPA 4PMHA 4XL9A 1O8JA 3UW0A 2O0VA 3LMWA 3VSVA 1DBGA 1VBLA 2NT6A 2IQ7A 2UVFA 4W8SA 2EWEA 2UVEA 4W8TA 4XLAA 4YZ0A 4XOTA 4XM3A 2INVA 1CZFA 1NHCA 4XR6A 1HG8A 2O04A 5C1CA 1PE9A 1BN8A 1OGMX 2VJJA 2X3HA 1BHEA 4Z05A 4OZZA 3SUCA 1RU4A 3KRGA 2Z8GA 1IDKA 4XLCA 1O8KA 1QCXA 4XN0A 4C2LA 4XQFA 3T9GA 2QXZA 1O8IA 4Z06A 4XNFA 4Z03A 1O8MA 2VJIA 1DBOA 3GRHA 3ZPPA 2X85A 2QY1A 2NTPA 4YZQA 1O8HA 1RWRA 1KCDA 1RMGA 1IDJA 2O17A 4XMYA 3B4NA 1OOCA 4YEJA 1OFMA 1IA5A 1JRGA 4XONA 1QJVA 4YZAA 4U49A 1JTAA 1PXZA 2NTBA 4OJ6A 1OGOX 2BSPA 4OZYA 4I84A 5AMVA 2VBKA 1X0CA 4EW9A 2INUA 2ODLA 4XLEA 3GQ8A 4NK6A 3ZSCA 1KCCA 1H80A 2NTQA 4XORA 1KTWA 1O8GA 2VBEA 1O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZX A;  4W8R A;  4OJP A;  4XN3 A;  3VSU A;  4XLF A;  4OJL A;  2X6X A;  4OJO A;  1OFL A;  4U4B A;  2X6W A;  3B90 A;  1O8E A;  4MR0 A;  1IB4 A;  2PEC A;  3WWG A;  5C1E A;  2PYH A;  1O8D A;  4XKV A;  1O8L A;  1WMR A;  1K5C A;  3EQN A;  2NST A;  2NZM A;  1EE6 A;  3EQO A;  3VMW A;  3B8Y A;  4YEL A;  2NT9 A;  4OJ5 A;  3JUR A;  1PLU A;  3GQ7 A;  2QX3 A;  3GQA A;  2O0W A;  3GQ9 A;  2VBM A;  4MXN A;  2NSP A;  4XKW A;  1XG2 A;  4XLH A;  2X6Y A;  4HWV A;  3FY3 A;  4URR A;  1AIR A;  4W8Q A;  3VST A;  2PYG A;  1O8F A;  4NK8 A;  3VMV A;  1GQ8 A;  4AVZ A;  2O1D A;  4XOP A;  4PMH A;  4XL9 A;  1O8J A;  3UW0 A;  2O0V A;  3LMW A;  3VSV A;  1DBG A;  1VBL A;  2NT6 A;  2IQ7 A;  2UVF A;  4W8S A;  2EWE A;  2UVE A;  4W8T A;  4XLA A;  4YZ0 A;  4XOT A;  4XM3 A;  2INV A;  1CZF A;  1NHC A;  4XR6 A;  1HG8 A;  2O04 A;  5C1C A;  1PE9 A;  1BN8 A;  1OGM X;  2VJJ A;  2X3H A;  1BHE A;  4Z05 A;  4OZZ A;  3SUC A;  1RU4 A;  3KRG A;  2Z8G A;  1IDK A;  4XLC A;  1O8K A;  1QCX A;  4XN0 A;  4C2L A;  4XQF A;  3T9G A;  2QXZ A;  1O8I A;  4Z06 A;  4XNF A;  4Z03 A;  1O8M A;  2VJI A;  1DBO A;  3GRH A;  3ZPP A;  2X85 A;  2QY1 A;  2NTP A;  4YZQ A;  1O8H A;  1RWR A;  1KCD A;  1RMG A;  1IDJ A;  2O17 A;  4XMY A;  3B4N A;  1OOC A;  4YEJ A;  1OFM A;  1IA5 A;  1JRG A;  4XON A;  1QJV A;  4YZA A;  4U49 A;  1JTA A;  1PXZ A;  2NTB A;  4OJ6 A;  1OGO X;  2BSP A;  4OZY A;  4I84 A;  5AMV A;  2VBK A;  1X0C A;  4EW9 A;  2INU A;  2ODL A;  4XLE A;  3GQ8 A;  4NK6 A;  3ZSC A;  1KCC A;  1H80 A;  2NTQ A;  4XOR A;  1KTW A;  1O8G A;  2VBE A;  1O88 A; 
#chains in the Genus database with same CATH topology
 4YZX A;  4W8R A;  4OJP A;  4XN3 A;  1LLZ A;  4XLF A;  3VSU A;  1TYW A;  4OJL A;  2X6X A;  4OJO A;  1OFL A;  4U4B A;  2X6W A;  3LJY A;  3B90 A;  1O8E A;  4MR0 A;  3PSZ A;  1IB4 A;  2PEC A;  3WWG A;  5C1E A;  2PYH A;  1O8D A;  4YEI A;  4XKV A;  1O8L A;  1WMR A;  1K5C A;  3EQN A;  2NST A;  2NZM A;  1EE6 A;  3EQO A;  2BM4 A;  3PET A;  1TYX A;  3BH7 B;  3B8Y A;  4YFO A;  4YEL A;  3VMW A;  1EA0 A;  2VFP A;  2NT9 A;  4OJ5 A;  3JUR A;  1CLW A;  1PLU A;  1EZG A;  2J8I A;  3GQ7 A;  3H09 A;  2QX3 A;  3GQA A;  3N90 A;  2O0W A;  3GQ9 A;  2VBM A;  1HF2 A;  4MXN A;  2NSP A;  4V02 C;  1XG2 A;  4XKW A;  1QA2 A;  4XLH A;  2X6Y A;  3TH0 A;  2W7Z A;  4HWV A;  4YDT A;  3P4G A;  4YCQ A;  1OFD A;  3FY3 A;  2XT4 A;  4URR A;  1AIR A;  3PSS A;  4W8Q A;  1LLW A;  2PYG A;  1O8F A;  2VFM A;  4NK8 A;  1GQ8 A;  3SQV A;  3VMV A;  3VST A;  1TSP A;  4AVZ A;  2O1D A;  4XOP A;  4PMH A;  4XL9 A;  3ML3 A;  1O8J A;  3UW0 A;  2O0V A;  3LMW A;  3VSV A;  1DBG A;  2IOU G;  1VBL A;  3RIQ A;  2NT6 A;  2IQ7 A;  1KQ5 A;  2B0R A;  1WXR A;  2BM5 A;  2UVF A;  1QA1 A;  4W8S A;  1TYU A;  2XTY A;  2BM6 A;  2EWE A;  2QYU A;  2UVE A;  2O6W A;  2V5I A;  4W8T A;  4XLA A;  4YZ0 A;  4XOT A;  4KH3 A;  4XM3 A;  5JMC B;  2G0Y A;  2INV A;  1CZF A;  1NHC A;  5DNS A;  4XR6 A;  1HG8 A;  2O04 A;  4JRA C;  2BM7 A;  5C1C A;  1PE9 A;  1BN8 A;  1OGM X;  2F3L A;  3SY2 A;  2VJJ A;  2VFO A;  2X3H A;  4OM9 A;  1BHE A;  4Z05 A;  4OZZ A;  3SUC A;  3BH6 B;  1RU4 A;  3KRG A;  2Z8G A;  1K4Z A;  1IDK A;  4XLC A;  2BX6 A;  1O8K A;  1QCX A;  1TYV A;  4OPW A;  4XN0 A;  4C2L A;  4XQF A;  3T9G A;  3DU1 X;  2QXZ A;  1O8I A;  4Z06 A;  4XNF A;  4Z03 A;  3NAW A;  1DAB A;  1O8M A;  2J8K A;  2VJI A;  1DBO A;  2VFN A;  3GRH A;  3ZPP A;  2X85 A;  2QY1 A;  2NTP A;  4YZQ A;  1O8H A;  1RWR A;  4YC5 A;  1KCD A;  3LYC A;  3SZE A;  1RMG A;  1IDJ A;  2O17 A;  2XT2 A;  4XMY A;  5JLV C;  3JX8 A;  1QRB A;  3B4N A;  3AK5 A;  1OOC A;  4YEJ A;  2VFQ A;  1QRC A;  1OFM A;  2XTW A;  1K8F A;  1IA5 A;  1JRG A;  4XON A;  2QZA A;  2XTX A;  1QJV A;  4YZA A;  4U49 A;  2XC1 A;  1JTA A;  3NB2 A;  1PXZ A;  1L1I A;  2NTB A;  4OJ6 A;  1OGO X;  1QQ1 A;  2BSP A;  3SYJ A;  4OZY A;  4I84 A;  5AMV A;  2VBK A;  1X0C A;  4EW9 A;  1OFE A;  2INU A;  2ODL A;  1LM1 A;  4XLE A;  2YUH A;  3GQ8 A;  4NK6 A;  3ZSC A;  3N6Z A;  1KCC A;  1H80 A;  2NTQ A;  4XOR A;  1QA3 A;  1KTW A;  1O8G A;  2VBE A;  1O88 A; 
#chains in the Genus database with same CATH homology
 4YZX A;  4W8R A;  4OJP A;  4XN3 A;  3VSU A;  4XLF A;  4OJL A;  2X6X A;  4OJO A;  1OFL A;  4U4B A;  2X6W A;  3B90 A;  1O8E A;  4MR0 A;  1IB4 A;  2PEC A;  3WWG A;  5C1E A;  2PYH A;  1O8D A;  4XKV A;  1O8L A;  1WMR A;  1K5C A;  3EQN A;  2NST A;  2NZM A;  1EE6 A;  3EQO A;  3VMW A;  3B8Y A;  4YEL A;  2NT9 A;  4OJ5 A;  3JUR A;  1PLU A;  3GQ7 A;  2QX3 A;  3GQA A;  2O0W A;  3GQ9 A;  2VBM A;  4MXN A;  2NSP A;  4XKW A;  1XG2 A;  4XLH A;  2X6Y A;  4HWV A;  3FY3 A;  4URR A;  1AIR A;  4W8Q A;  3VST A;  2PYG A;  1O8F A;  4NK8 A;  3VMV A;  1GQ8 A;  4AVZ A;  2O1D A;  4XOP A;  4PMH A;  4XL9 A;  1O8J A;  3UW0 A;  2O0V A;  3LMW A;  3VSV A;  1DBG A;  1VBL A;  2NT6 A;  2IQ7 A;  2UVF A;  4W8S A;  2EWE A;  2UVE A;  4W8T A;  4XLA A;  4YZ0 A;  4XOT A;  4XM3 A;  2INV A;  1CZF A;  1NHC A;  4XR6 A;  1HG8 A;  2O04 A;  5C1C A;  1PE9 A;  1BN8 A;  1OGM X;  2VJJ A;  2X3H A;  1BHE A;  4Z05 A;  4OZZ A;  3SUC A;  1RU4 A;  3KRG A;  2Z8G A;  1IDK A;  4XLC A;  1O8K A;  1QCX A;  4XN0 A;  4C2L A;  4XQF A;  3T9G A;  2QXZ A;  1O8I A;  4Z06 A;  4XNF A;  4Z03 A;  1O8M A;  2VJI A;  1DBO A;  3GRH A;  3ZPP A;  2X85 A;  2QY1 A;  2NTP A;  4YZQ A;  1O8H A;  1RWR A;  1KCD A;  1RMG A;  1IDJ A;  2O17 A;  4XMY A;  3B4N A;  1OOC A;  4YEJ A;  1OFM A;  1IA5 A;  1JRG A;  4XON A;  1QJV A;  4YZA A;  4U49 A;  1JTA A;  1PXZ A;  2NTB A;  4OJ6 A;  1OGO X;  2BSP A;  4OZY A;  4I84 A;  5AMV A;  2VBK A;  1X0C A;  4EW9 A;  2INU A;  2ODL A;  4XLE A;  3GQ8 A;  4NK6 A;  3ZSC A;  1KCC A;  1H80 A;  2NTQ A;  4XOR A;  1KTW A;  1O8G A;  2VBE A;  1O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...