2NSPA

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide i
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Pectinesterase A
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nspA00
2UVFA 3B8YA 1KCCA 3FY3A 4Z05A 4OZYA 4XORA 2X6XA 2PYGA 4XOTA 4XL9A 1JRGA 1QCXA 1BHEA 2VJJA 4XN0A 4C2LA 1OGOX 1HG8A 4EW9A 1O8MA 2O1DA 3VMVA 1K5CA 1O8IA 4MR0A 2QX3A 4XLCA 1RMGA 4XLFA 3B4NA 1IDJA 2BSPA 4XKWA 1OFMA 2QY1A 2X6YA 4AVZA 4YEJA 1X0CA 3B90A 1O8JA 3VSTA 2O04A 3GQ9A 2X3HA 1DBGA 4OJLA 4OJOA 3VSVA 2VBKA 4W8TA 4XLEA 3ZPPA 2QXZA 2PECA 3VMWA 4Z06A 1O8EA 4HWVA 3SUCA 1GQ8A 1KTWA 2NZMA 4URRA 3LMWA 2EWEA 1IB4A 2UVEA 1VBLA 1NHCA 3ZSCA 2NTQA 1OGMX 1AIRA 1PE9A 5AMVA 1DBOA 2O0VA 4OJPA 4OJ5A 1O8DA 2NT6A 2INUA 5C1CA 3GRHA 1OOCA 2Z8GA 1IDKA 1O8FA 4XLAA 1O8GA 3GQ7A 4XOPA 3GQAA 2IQ7A 1XG2A 1RU4A 2NTBA 5C1EA 4XNFA 1O8LA 3GQ8A 1O88A 3KRGA 4W8RA 4YZQA 1IA5A 4OZZA 2ODLA 1O8HA 3EQNA 1WMRA 4YZXA 4YZAA 1KCDA 4XM3A 2NTPA 3UW0A 2O0WA 4W8SA 1JTAA 3EQOA 1H80A 3VSUA 2INVA 2O17A 4XQFA 1PXZA 2VJIA 1CZFA 3T9GA 2PYHA 4U4BA 1EE6A 2NSTA 4Z03A 4W8QA 2VBMA 4I84A 2X85A 4NK8A 1RWRA 1PLUA 1OFLA 4MXNA 1QJVA 4XONA 2NT9A 4PMHA 3WWGA 1BN8A 4XKVA 4XLHA 4YZ0A 4YELA 4XMYA 3JURA 4NK6A 2VBEA 4U49A 2X6WA 2NSPA 4OJ6A 4XN3A 4XR6A 1O8KA
chains in the Genus database with same CATH superfamily
2UVFA 3B8YA 1LLZA 1KCCA 2QZAA 3FY3A 4YC5A 1QQ1A 4Z05A 4OZYA 4V02C 5JLVC 4XORA 1TYWA 2PYGA 2X6XA 2VFNA 3P4GA 4KH3A 4XOTA 4XL9A 5DNSA 1JRGA 3PETA 1QCXA 1BHEA 2VJJA 2IOUG 3LYCA 4XN0A 3BH7B 4C2LA 1OGOX 1HG8A 4EW9A 1O8MA 4YEIA 2O1DA 3SY2A 3VMVA 1TYUA 2QYUA 1K5CA 1O8IA 2G0YA 4MR0A 1L1IA 2J8KA 2QX3A 4XLCA 1RMGA 4XLFA 3B4NA 1IDJA 2BSPA 4XKWA 1OFMA 2QY1A 2X6YA 4AVZA 4YEJA 1X0CA 1QRCA 1O8JA 3B90A 3VSTA 2O04A 3GQ9A 2X3HA 1DBGA 3BH6B 4OJLA 4OJOA 2VBKA 4W8TA 1EZGA 1LLWA 4XLEA 2QXZA 2PECA 4YFOA 1KQ5A 3VMWA 3VSVA 4Z06A 1O8EA 4HWVA 3SUCA 1GQ8A 2F3LA 1KTWA 2NZMA 4URRA 3LMWA 3DU1X 2EWEA 1IB4A 2UVEA 1VBLA 1NHCA 2VFQA 3ZSCA 1TYVA 2NTQA 1OFDA 1OGMX 1AIRA 3N6ZA 1PE9A 5AMVA 1DBOA 2O0VA 4OJPA 4OJ5A 1O8DA 2NT6A 2INUA 4YCQA 5C1CA 3GRHA 1OOCA 5JMCB 2Z8GA 1IDKA 1O8FA 2B0RA 4JRAC 4XLAA 1O8GA 3GQ7A 3NAWA 1K8FA 2VFOA 4XOPA 3LJYA 3GQAA 2IQ7A 1XG2A 1RU4A 2NTBA 1TSPA 4OPWA 5C1EA 1QA1A 4XNFA 2XTWA 1O8LA 1DABA 3GQ8A 3JX8A 1O88A 3KRGA 4W8RA 4YZQA 3RIQA 3PSSA 1IA5A 4OZZA 2BX6A 3NB2A 2ODLA 1O8HA 3ML3A 2XC1A 1WMRA 3EQNA 2BM6A 4YZAA 4YZXA 1KCDA 2XT4A 4XM3A 2NTPA 3UW0A 2W7ZA 2O0WA 4W8SA 1JTAA 2BM7A 3EQOA 1H80A 2J8IA 2O6WA 2VFPA 2XTYA 4OM9A 2INVA 2O17A 2YUHA 3VSUA 1OFEA 4XQFA 1PXZA 2VJIA 2BM5A 1CZFA 1QA2A 3T9GA 1QA3A 2PYHA 2V5IA 4U4BA 1LM1A 1EE6A 2NSTA 4Z03A 2VFMA 4W8QA 1QRBA 2VBMA 3SZEA 4I84A 1TYXA 2X85A 2XTXA 1RWRA 1PLUA 1OFLA 4MXNA 4NK8A 3ZPPA 4YDTA 1QJVA 3SQVA 4XONA 3AK5A 2NT9A 4PMHA 3TH0A 1BN8A 3PSZA 3WWGA 4XKVA 4XLHA 1WXRA 4YZ0A 2XT2A 2BM4A 3SYJA 4YELA 4XMYA 3JURA 3N90A 4NK6A 1HF2A 2VBEA 1K4ZA 1CLWA 2X6WA 4U49A 2NSPA 4OJ6A 4XN3A 3H09A 4XR6A 1EA0A 1O8KA
chains in the Genus database with same CATH topology
2UVFA 3B8YA 1KCCA 3FY3A 4Z05A 4OZYA 4XORA 2X6XA 2PYGA 4XOTA 4XL9A 1JRGA 1QCXA 1BHEA 2VJJA 4XN0A 4C2LA 1OGOX 1HG8A 4EW9A 1O8MA 2O1DA 3VMVA 1K5CA 1O8IA 4MR0A 2QX3A 4XLCA 1RMGA 4XLFA 3B4NA 1IDJA 2BSPA 4XKWA 1OFMA 2QY1A 2X6YA 4AVZA 4YEJA 1X0CA 3B90A 1O8JA 3VSTA 2O04A 3GQ9A 2X3HA 1DBGA 4OJLA 4OJOA 3VSVA 2VBKA 4W8TA 4XLEA 3ZPPA 2QXZA 2PECA 3VMWA 4Z06A 1O8EA 4HWVA 3SUCA 1GQ8A 1KTWA 2NZMA 4URRA 3LMWA 2EWEA 1IB4A 2UVEA 1VBLA 1NHCA 3ZSCA 2NTQA 1OGMX 1AIRA 1PE9A 5AMVA 1DBOA 2O0VA 4OJPA 4OJ5A 1O8DA 2NT6A 2INUA 5C1CA 3GRHA 1OOCA 2Z8GA 1IDKA 1O8FA 4XLAA 1O8GA 3GQ7A 4XOPA 3GQAA 2IQ7A 1XG2A 1RU4A 2NTBA 5C1EA 4XNFA 1O8LA 3GQ8A 1O88A 3KRGA 4W8RA 4YZQA 1IA5A 4OZZA 2ODLA 1O8HA 3EQNA 1WMRA 4YZXA 4YZAA 1KCDA 4XM3A 2NTPA 3UW0A 2O0WA 4W8SA 1JTAA 3EQOA 1H80A 3VSUA 2INVA 2O17A 4XQFA 1PXZA 2VJIA 1CZFA 3T9GA 2PYHA 4U4BA 1EE6A 2NSTA 4Z03A 4W8QA 2VBMA 4I84A 2X85A 4NK8A 1RWRA 1PLUA 1OFLA 4MXNA 1QJVA 4XONA 2NT9A 4PMHA 3WWGA 1BN8A 4XKVA 4XLHA 4YZ0A 4YELA 4XMYA 3JURA 4NK6A 2VBEA 4U49A 2X6WA 2NSPA 4OJ6A 4XN3A 4XR6A 1O8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVF A;  3B8Y A;  1KCC A;  3FY3 A;  4Z05 A;  4OZY A;  4XOR A;  2X6X A;  2PYG A;  4XOT A;  4XL9 A;  1JRG A;  1QCX A;  1BHE A;  2VJJ A;  4XN0 A;  4C2L A;  1OGO X;  1HG8 A;  4EW9 A;  1O8M A;  2O1D A;  3VMV A;  1K5C A;  1O8I A;  4MR0 A;  2QX3 A;  4XLC A;  1RMG A;  4XLF A;  3B4N A;  1IDJ A;  2BSP A;  4XKW A;  1OFM A;  2QY1 A;  2X6Y A;  4AVZ A;  4YEJ A;  1X0C A;  3B90 A;  1O8J A;  3VST A;  2O04 A;  3GQ9 A;  2X3H A;  1DBG A;  4OJL A;  4OJO A;  3VSV A;  2VBK A;  4W8T A;  4XLE A;  3ZPP A;  2QXZ A;  2PEC A;  3VMW A;  4Z06 A;  1O8E A;  4HWV A;  3SUC A;  1GQ8 A;  1KTW A;  2NZM A;  4URR A;  3LMW A;  2EWE A;  1IB4 A;  2UVE A;  1VBL A;  1NHC A;  3ZSC A;  2NTQ A;  1OGM X;  1AIR A;  1PE9 A;  5AMV A;  1DBO A;  2O0V A;  4OJP A;  4OJ5 A;  1O8D A;  2NT6 A;  2INU A;  5C1C A;  3GRH A;  1OOC A;  2Z8G A;  1IDK A;  1O8F A;  4XLA A;  1O8G A;  3GQ7 A;  4XOP A;  3GQA A;  2IQ7 A;  1XG2 A;  1RU4 A;  2NTB A;  5C1E A;  4XNF A;  1O8L A;  3GQ8 A;  1O88 A;  3KRG A;  4W8R A;  4YZQ A;  1IA5 A;  4OZZ A;  2ODL A;  1O8H A;  3EQN A;  1WMR A;  4YZX A;  4YZA A;  1KCD A;  4XM3 A;  2NTP A;  3UW0 A;  2O0W A;  4W8S A;  1JTA A;  3EQO A;  1H80 A;  3VSU A;  2INV A;  2O17 A;  4XQF A;  1PXZ A;  2VJI A;  1CZF A;  3T9G A;  2PYH A;  4U4B A;  1EE6 A;  2NST A;  4Z03 A;  4W8Q A;  2VBM A;  4I84 A;  2X85 A;  4NK8 A;  1RWR A;  1PLU A;  1OFL A;  4MXN A;  1QJV A;  4XON A;  2NT9 A;  4PMH A;  3WWG A;  1BN8 A;  4XKV A;  4XLH A;  4YZ0 A;  4YEL A;  4XMY A;  3JUR A;  4NK6 A;  2VBE A;  4U49 A;  2X6W A;  2NSP A;  4OJ6 A;  4XN3 A;  4XR6 A;  1O8K A; 
#chains in the Genus database with same CATH topology
 2UVF A;  3B8Y A;  1LLZ A;  1KCC A;  2QZA A;  3FY3 A;  4YC5 A;  1QQ1 A;  4Z05 A;  4OZY A;  4V02 C;  5JLV C;  4XOR A;  1TYW A;  2PYG A;  2X6X A;  2VFN A;  3P4G A;  4KH3 A;  4XOT A;  4XL9 A;  5DNS A;  1JRG A;  3PET A;  1QCX A;  1BHE A;  2VJJ A;  2IOU G;  3LYC A;  4XN0 A;  3BH7 B;  4C2L A;  1OGO X;  1HG8 A;  4EW9 A;  1O8M A;  4YEI A;  2O1D A;  3SY2 A;  3VMV A;  1TYU A;  2QYU A;  1K5C A;  1O8I A;  2G0Y A;  4MR0 A;  1L1I A;  2J8K A;  2QX3 A;  4XLC A;  1RMG A;  4XLF A;  3B4N A;  1IDJ A;  2BSP A;  4XKW A;  1OFM A;  2QY1 A;  2X6Y A;  4AVZ A;  4YEJ A;  1X0C A;  1QRC A;  1O8J A;  3B90 A;  3VST A;  2O04 A;  3GQ9 A;  2X3H A;  1DBG A;  3BH6 B;  4OJL A;  4OJO A;  2VBK A;  4W8T A;  1EZG A;  1LLW A;  4XLE A;  2QXZ A;  2PEC A;  4YFO A;  1KQ5 A;  3VMW A;  3VSV A;  4Z06 A;  1O8E A;  4HWV A;  3SUC A;  1GQ8 A;  2F3L A;  1KTW A;  2NZM A;  4URR A;  3LMW A;  3DU1 X;  2EWE A;  1IB4 A;  2UVE A;  1VBL A;  1NHC A;  2VFQ A;  3ZSC A;  1TYV A;  2NTQ A;  1OFD A;  1OGM X;  1AIR A;  3N6Z A;  1PE9 A;  5AMV A;  1DBO A;  2O0V A;  4OJP A;  4OJ5 A;  1O8D A;  2NT6 A;  2INU A;  4YCQ A;  5C1C A;  3GRH A;  1OOC A;  5JMC B;  2Z8G A;  1IDK A;  1O8F A;  2B0R A;  4JRA C;  4XLA A;  1O8G A;  3GQ7 A;  3NAW A;  1K8F A;  2VFO A;  4XOP A;  3LJY A;  3GQA A;  2IQ7 A;  1XG2 A;  1RU4 A;  2NTB A;  1TSP A;  4OPW A;  5C1E A;  1QA1 A;  4XNF A;  2XTW A;  1O8L A;  1DAB A;  3GQ8 A;  3JX8 A;  1O88 A;  3KRG A;  4W8R A;  4YZQ A;  3RIQ A;  3PSS A;  1IA5 A;  4OZZ A;  2BX6 A;  3NB2 A;  2ODL A;  1O8H A;  3ML3 A;  2XC1 A;  1WMR A;  3EQN A;  2BM6 A;  4YZA A;  4YZX A;  1KCD A;  2XT4 A;  4XM3 A;  2NTP A;  3UW0 A;  2W7Z A;  2O0W A;  4W8S A;  1JTA A;  2BM7 A;  3EQO A;  1H80 A;  2J8I A;  2O6W A;  2VFP A;  2XTY A;  4OM9 A;  2INV A;  2O17 A;  2YUH A;  3VSU A;  1OFE A;  4XQF A;  1PXZ A;  2VJI A;  2BM5 A;  1CZF A;  1QA2 A;  3T9G A;  1QA3 A;  2PYH A;  2V5I A;  4U4B A;  1LM1 A;  1EE6 A;  2NST A;  4Z03 A;  2VFM A;  4W8Q A;  1QRB A;  2VBM A;  3SZE A;  4I84 A;  1TYX A;  2X85 A;  2XTX A;  1RWR A;  1PLU A;  1OFL A;  4MXN A;  4NK8 A;  3ZPP A;  4YDT A;  1QJV A;  3SQV A;  4XON A;  3AK5 A;  2NT9 A;  4PMH A;  3TH0 A;  1BN8 A;  3PSZ A;  3WWG A;  4XKV A;  4XLH A;  1WXR A;  4YZ0 A;  2XT2 A;  2BM4 A;  3SYJ A;  4YEL A;  4XMY A;  3JUR A;  3N90 A;  4NK6 A;  1HF2 A;  2VBE A;  1K4Z A;  1CLW A;  2X6W A;  4U49 A;  2NSP A;  4OJ6 A;  4XN3 A;  3H09 A;  4XR6 A;  1EA0 A;  1O8K A; 
#chains in the Genus database with same CATH homology
 2UVF A;  3B8Y A;  1KCC A;  3FY3 A;  4Z05 A;  4OZY A;  4XOR A;  2X6X A;  2PYG A;  4XOT A;  4XL9 A;  1JRG A;  1QCX A;  1BHE A;  2VJJ A;  4XN0 A;  4C2L A;  1OGO X;  1HG8 A;  4EW9 A;  1O8M A;  2O1D A;  3VMV A;  1K5C A;  1O8I A;  4MR0 A;  2QX3 A;  4XLC A;  1RMG A;  4XLF A;  3B4N A;  1IDJ A;  2BSP A;  4XKW A;  1OFM A;  2QY1 A;  2X6Y A;  4AVZ A;  4YEJ A;  1X0C A;  3B90 A;  1O8J A;  3VST A;  2O04 A;  3GQ9 A;  2X3H A;  1DBG A;  4OJL A;  4OJO A;  3VSV A;  2VBK A;  4W8T A;  4XLE A;  3ZPP A;  2QXZ A;  2PEC A;  3VMW A;  4Z06 A;  1O8E A;  4HWV A;  3SUC A;  1GQ8 A;  1KTW A;  2NZM A;  4URR A;  3LMW A;  2EWE A;  1IB4 A;  2UVE A;  1VBL A;  1NHC A;  3ZSC A;  2NTQ A;  1OGM X;  1AIR A;  1PE9 A;  5AMV A;  1DBO A;  2O0V A;  4OJP A;  4OJ5 A;  1O8D A;  2NT6 A;  2INU A;  5C1C A;  3GRH A;  1OOC A;  2Z8G A;  1IDK A;  1O8F A;  4XLA A;  1O8G A;  3GQ7 A;  4XOP A;  3GQA A;  2IQ7 A;  1XG2 A;  1RU4 A;  2NTB A;  5C1E A;  4XNF A;  1O8L A;  3GQ8 A;  1O88 A;  3KRG A;  4W8R A;  4YZQ A;  1IA5 A;  4OZZ A;  2ODL A;  1O8H A;  3EQN A;  1WMR A;  4YZX A;  4YZA A;  1KCD A;  4XM3 A;  2NTP A;  3UW0 A;  2O0W A;  4W8S A;  1JTA A;  3EQO A;  1H80 A;  3VSU A;  2INV A;  2O17 A;  4XQF A;  1PXZ A;  2VJI A;  1CZF A;  3T9G A;  2PYH A;  4U4B A;  1EE6 A;  2NST A;  4Z03 A;  4W8Q A;  2VBM A;  4I84 A;  2X85 A;  4NK8 A;  1RWR A;  1PLU A;  1OFL A;  4MXN A;  1QJV A;  4XON A;  2NT9 A;  4PMH A;  3WWG A;  1BN8 A;  4XKV A;  4XLH A;  4YZ0 A;  4YEL A;  4XMY A;  3JUR A;  4NK6 A;  2VBE A;  4U49 A;  2X6W A;  2NSP A;  4OJ6 A;  4XN3 A;  4XR6 A;  1O8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...