2NSPA

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide i
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
342
Chain Sequence
b'ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 126
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nspA00
2NTQA 1DBOA 1QJVA 4URRA 1DBGA 3B4NA 4W8TA 1WMRA 3VSUA 4XLCA 4XNFA 2O17A 4U49A 4OJOA 3SUCA 1HG8A 1VBLA 1O8DA 4MR0A 2Z8GA 4XN3A 4Z05A 1O8HA 1PE9A 2NTPA 5C1EA 3GQ8A 4XN0A 4YZAA 4EW9A 1O8GA 2X3HA 4OJPA 4XLHA 1X0CA 2NSTA 4XLFA 4HWVA 4XLAA 1PLUA 1RWRA 2PYGA 4XR6A 2X6WA 1GQ8A 2VBMA 4NK6A 2NTBA 2PECA 4OJLA 4Z03A 1IB4A 1K5CA 4YZQA 1OOCA 2UVEA 1IA5A 1IDJA 1OFLA 4OJ6A 1XG2A 4XM3A 4MXNA 4XOPA 2BSPA 1PXZA 1AIRA 4W8SA 3UW0A 2UVFA 4Z06A 1BN8A 2O1DA 4XORA 2X85A 2QXZA 4XQFA 1NHCA 2INVA 3VSTA 1O8MA 4XKWA 4XL9A 3LMWA 3GQ9A 2QY1A 4YELA 2VBKA 2VBEA 4XMYA 4OJ5A 1JRGA 4YEJA 4PMHA 4W8QA 3B90A 2VJJA 4OZYA 1IDKA 4YZXA 2NSPA 3GQ7A 4YZ0A 4W8RA 1KCCA 4OZZA 1H80A 1KTWA 3VSVA 1CZFA 2NT9A 4C2LA 2NZMA 4I84A 3ZSCA 2ODLA 4XONA 2O04A 2PYHA 2X6XA 1O8IA 1OGMX 1OGOX 1O8EA 4XOTA 1EE6A 5C1CA 3KRGA 3T9GA 4U4BA 3B8YA 2O0VA 4XKVA 1O8JA 3GRHA 1RMGA 1BHEA 3ZPPA 5AMVA 4NK8A 1O8KA 1O8LA 2X6YA 2NT6A 3FY3A 3JURA 1O88A 3EQNA 3GQAA 2VJIA 2EWEA 1OFMA 4XLEA 2INUA 3EQOA 2IQ7A 4AVZA 2O0WA 1JTAA 1RU4A 2QX3A 1QCXA 1O8FA 1KCDA 3VMWA 3VMVA 3WWGA
chains in the Genus database with same CATH superfamily
1QRBA 2NTQA 1DBOA 1QJVA 4URRA 1DBGA 2BM4A 3B4NA 1WMRA 4W8TA 3SQVA 3DU1X 4XLCA 4XNFA 2O17A 4U49A 3VSUA 1WXRA 2XC1A 4OJOA 3SUCA 1HG8A 1VBLA 1O8DA 4JRAC 4YDTA 1K8FA 2Z8GA 1CLWA 1TYWA 2QYUA 4MR0A 1O8HA 1PE9A 2NTPA 1HF2A 1LLZA 4Z05A 5C1EA 3SZEA 3GQ8A 2F3LA 4XN0A 4YZAA 4EW9A 1O8GA 2X3HA 4OJPA 4XLHA 1X0CA 2NSTA 4XLFA 4HWVA 4XLAA 1PLUA 1RWRA 3TH0A 1EZGA 2PYGA 4XR6A 1QQ1A 2BM5A 2B0RA 1GQ8A 2VFMA 2X6WA 2VBMA 4V02C 4NK6A 2NTBA 2PECA 4OJLA 4Z03A 2BM7A 1IB4A 2VFPA 1K5CA 4YZQA 1LLWA 1OOCA 2UVEA 1IA5A 1K4ZA 1IDJA 1OFLA 2J8IA 4OJ6A 3AK5A 1XG2A 2BM6A 4XM3A 4MXNA 4XOPA 2BSPA 2W7ZA 2XTXA 2XTYA 3SYJA 1QA1A 3N6ZA 1L1IA 1TYUA 2BX6A 1PXZA 1AIRA 4W8SA 3P4GA 1DABA 3UW0A 2UVFA 4Z06A 1BN8A 2O1DA 4XORA 4YC5A 2X85A 2VFQA 2QXZA 4OPWA 4XQFA 4YFOA 1NHCA 2INVA 3VSTA 3BH7B 1O8MA 4XKWA 4XL9A 3LMWA 1OFEA 3GQ9A 2QY1A 2QZAA 4YELA 2J8KA 2VBKA 2VBEA 4XMYA 3JX8A 4OJ5A 1JRGA 4YEJA 2O6WA 3N90A 4PMHA 4W8QA 3B90A 2XT2A 2VJJA 4OM9A 4OZYA 1IDKA 4YZXA 2NSPA 3GQ7A 4YZ0A 4W8RA 1KCCA 4OZZA 1H80A 1KTWA 2V5IA 3LYCA 3RIQA 3VSVA 3LJYA 1CZFA 1QRCA 2NT9A 4C2LA 2NZMA 3H09A 4I84A 2G0YA 3ZSCA 2ODLA 4XONA 2VFOA 2O04A 2PYHA 2X6XA 1O8IA 1OGMX 1LM1A 1OGOX 5DNSA 1O8EA 3PSZA 4XN3A 4XOTA 1EE6A 3PSSA 4KH3A 5C1CA 3KRGA 3T9GA 4U4BA 3PETA 3NAWA 1TYXA 2VFNA 3B8YA 2O0VA 4XKVA 1O8JA 3GRHA 3SY2A 1RMGA 1BHEA 3ZPPA 2IOUG 5AMVA 4NK8A 1O8KA 1O8LA 1QA3A 2X6YA 3BH6B 2NT6A 3FY3A 1TSPA 4YEIA 3JURA 5JMCB 1O88A 3EQNA 3GQAA 3ML3A 2VJIA 2EWEA 1OFMA 1QA2A 1EA0A 4XLEA 2INUA 3EQOA 2IQ7A 4AVZA 2O0WA 1OFDA 1JTAA 1KQ5A 1RU4A 1TYVA 1QCXA 2QX3A 5JLVC 1O8FA 4YCQA 2XT4A 1KCDA 3VMWA 2XTWA 2YUHA 3NB2A 3VMVA 3WWGA
chains in the Genus database with same CATH topology
2NTQA 1DBOA 1QJVA 4URRA 1DBGA 3B4NA 4W8TA 1WMRA 3VSUA 4XLCA 4XNFA 2O17A 4U49A 4OJOA 3SUCA 1HG8A 1VBLA 1O8DA 4MR0A 2Z8GA 4XN3A 4Z05A 1O8HA 1PE9A 2NTPA 5C1EA 3GQ8A 4XN0A 4YZAA 4EW9A 1O8GA 2X3HA 4OJPA 4XLHA 1X0CA 2NSTA 4XLFA 4HWVA 4XLAA 1PLUA 1RWRA 2PYGA 4XR6A 2X6WA 1GQ8A 2VBMA 4NK6A 2NTBA 2PECA 4OJLA 4Z03A 1IB4A 1K5CA 4YZQA 1OOCA 2UVEA 1IA5A 1IDJA 1OFLA 4OJ6A 1XG2A 4XM3A 4MXNA 4XOPA 2BSPA 1PXZA 1AIRA 4W8SA 3UW0A 2UVFA 4Z06A 1BN8A 2O1DA 4XORA 2X85A 2QXZA 4XQFA 1NHCA 2INVA 3VSTA 1O8MA 4XKWA 4XL9A 3LMWA 3GQ9A 2QY1A 4YELA 2VBKA 2VBEA 4XMYA 4OJ5A 1JRGA 4YEJA 4PMHA 4W8QA 3B90A 2VJJA 4OZYA 1IDKA 4YZXA 2NSPA 3GQ7A 4YZ0A 4W8RA 1KCCA 4OZZA 1H80A 1KTWA 3VSVA 1CZFA 2NT9A 4C2LA 2NZMA 4I84A 3ZSCA 2ODLA 4XONA 2O04A 2PYHA 2X6XA 1O8IA 1OGMX 1OGOX 1O8EA 4XOTA 1EE6A 5C1CA 3KRGA 3T9GA 4U4BA 3B8YA 2O0VA 4XKVA 1O8JA 3GRHA 1RMGA 1BHEA 3ZPPA 5AMVA 4NK8A 1O8KA 1O8LA 2X6YA 2NT6A 3FY3A 3JURA 1O88A 3EQNA 3GQAA 2VJIA 2EWEA 1OFMA 4XLEA 2INUA 3EQOA 2IQ7A 4AVZA 2O0WA 1JTAA 1RU4A 2QX3A 1QCXA 1O8FA 1KCDA 3VMWA 3VMVA 3WWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTQ A;  1DBO A;  1QJV A;  4URR A;  1DBG A;  3B4N A;  4W8T A;  1WMR A;  3VSU A;  4XLC A;  4XNF A;  2O17 A;  4U49 A;  4OJO A;  3SUC A;  1HG8 A;  1VBL A;  1O8D A;  4MR0 A;  2Z8G A;  4XN3 A;  4Z05 A;  1O8H A;  1PE9 A;  2NTP A;  5C1E A;  3GQ8 A;  4XN0 A;  4YZA A;  4EW9 A;  1O8G A;  2X3H A;  4OJP A;  4XLH A;  1X0C A;  2NST A;  4XLF A;  4HWV A;  4XLA A;  1PLU A;  1RWR A;  2PYG A;  4XR6 A;  2X6W A;  1GQ8 A;  2VBM A;  4NK6 A;  2NTB A;  2PEC A;  4OJL A;  4Z03 A;  1IB4 A;  1K5C A;  4YZQ A;  1OOC A;  2UVE A;  1IA5 A;  1IDJ A;  1OFL A;  4OJ6 A;  1XG2 A;  4XM3 A;  4MXN A;  4XOP A;  2BSP A;  1PXZ A;  1AIR A;  4W8S A;  3UW0 A;  2UVF A;  4Z06 A;  1BN8 A;  2O1D A;  4XOR A;  2X85 A;  2QXZ A;  4XQF A;  1NHC A;  2INV A;  3VST A;  1O8M A;  4XKW A;  4XL9 A;  3LMW A;  3GQ9 A;  2QY1 A;  4YEL A;  2VBK A;  2VBE A;  4XMY A;  4OJ5 A;  1JRG A;  4YEJ A;  4PMH A;  4W8Q A;  3B90 A;  2VJJ A;  4OZY A;  1IDK A;  4YZX A;  2NSP A;  3GQ7 A;  4YZ0 A;  4W8R A;  1KCC A;  4OZZ A;  1H80 A;  1KTW A;  3VSV A;  1CZF A;  2NT9 A;  4C2L A;  2NZM A;  4I84 A;  3ZSC A;  2ODL A;  4XON A;  2O04 A;  2PYH A;  2X6X A;  1O8I A;  1OGM X;  1OGO X;  1O8E A;  4XOT A;  1EE6 A;  5C1C A;  3KRG A;  3T9G A;  4U4B A;  3B8Y A;  2O0V A;  4XKV A;  1O8J A;  3GRH A;  1RMG A;  1BHE A;  3ZPP A;  5AMV A;  4NK8 A;  1O8K A;  1O8L A;  2X6Y A;  2NT6 A;  3FY3 A;  3JUR A;  1O88 A;  3EQN A;  3GQA A;  2VJI A;  2EWE A;  1OFM A;  4XLE A;  2INU A;  3EQO A;  2IQ7 A;  4AVZ A;  2O0W A;  1JTA A;  1RU4 A;  2QX3 A;  1QCX A;  1O8F A;  1KCD A;  3VMW A;  3VMV A;  3WWG A; 
#chains in the Genus database with same CATH topology
 1QRB A;  2NTQ A;  1DBO A;  1QJV A;  4URR A;  1DBG A;  2BM4 A;  3B4N A;  1WMR A;  4W8T A;  3SQV A;  3DU1 X;  4XLC A;  4XNF A;  2O17 A;  4U49 A;  3VSU A;  1WXR A;  2XC1 A;  4OJO A;  3SUC A;  1HG8 A;  1VBL A;  1O8D A;  4JRA C;  4YDT A;  1K8F A;  2Z8G A;  1CLW A;  1TYW A;  2QYU A;  4MR0 A;  1O8H A;  1PE9 A;  2NTP A;  1HF2 A;  1LLZ A;  4Z05 A;  5C1E A;  3SZE A;  3GQ8 A;  2F3L A;  4XN0 A;  4YZA A;  4EW9 A;  1O8G A;  2X3H A;  4OJP A;  4XLH A;  1X0C A;  2NST A;  4XLF A;  4HWV A;  4XLA A;  1PLU A;  1RWR A;  3TH0 A;  1EZG A;  2PYG A;  4XR6 A;  1QQ1 A;  2BM5 A;  2B0R A;  1GQ8 A;  2VFM A;  2X6W A;  2VBM A;  4V02 C;  4NK6 A;  2NTB A;  2PEC A;  4OJL A;  4Z03 A;  2BM7 A;  1IB4 A;  2VFP A;  1K5C A;  4YZQ A;  1LLW A;  1OOC A;  2UVE A;  1IA5 A;  1K4Z A;  1IDJ A;  1OFL A;  2J8I A;  4OJ6 A;  3AK5 A;  1XG2 A;  2BM6 A;  4XM3 A;  4MXN A;  4XOP A;  2BSP A;  2W7Z A;  2XTX A;  2XTY A;  3SYJ A;  1QA1 A;  3N6Z A;  1L1I A;  1TYU A;  2BX6 A;  1PXZ A;  1AIR A;  4W8S A;  3P4G A;  1DAB A;  3UW0 A;  2UVF A;  4Z06 A;  1BN8 A;  2O1D A;  4XOR A;  4YC5 A;  2X85 A;  2VFQ A;  2QXZ A;  4OPW A;  4XQF A;  4YFO A;  1NHC A;  2INV A;  3VST A;  3BH7 B;  1O8M A;  4XKW A;  4XL9 A;  3LMW A;  1OFE A;  3GQ9 A;  2QY1 A;  2QZA A;  4YEL A;  2J8K A;  2VBK A;  2VBE A;  4XMY A;  3JX8 A;  4OJ5 A;  1JRG A;  4YEJ A;  2O6W A;  3N90 A;  4PMH A;  4W8Q A;  3B90 A;  2XT2 A;  2VJJ A;  4OM9 A;  4OZY A;  1IDK A;  4YZX A;  2NSP A;  3GQ7 A;  4YZ0 A;  4W8R A;  1KCC A;  4OZZ A;  1H80 A;  1KTW A;  2V5I A;  3LYC A;  3RIQ A;  3VSV A;  3LJY A;  1CZF A;  1QRC A;  2NT9 A;  4C2L A;  2NZM A;  3H09 A;  4I84 A;  2G0Y A;  3ZSC A;  2ODL A;  4XON A;  2VFO A;  2O04 A;  2PYH A;  2X6X A;  1O8I A;  1OGM X;  1LM1 A;  1OGO X;  5DNS A;  1O8E A;  3PSZ A;  4XN3 A;  4XOT A;  1EE6 A;  3PSS A;  4KH3 A;  5C1C A;  3KRG A;  3T9G A;  4U4B A;  3PET A;  3NAW A;  1TYX A;  2VFN A;  3B8Y A;  2O0V A;  4XKV A;  1O8J A;  3GRH A;  3SY2 A;  1RMG A;  1BHE A;  3ZPP A;  2IOU G;  5AMV A;  4NK8 A;  1O8K A;  1O8L A;  1QA3 A;  2X6Y A;  3BH6 B;  2NT6 A;  3FY3 A;  1TSP A;  4YEI A;  3JUR A;  5JMC B;  1O88 A;  3EQN A;  3GQA A;  3ML3 A;  2VJI A;  2EWE A;  1OFM A;  1QA2 A;  1EA0 A;  4XLE A;  2INU A;  3EQO A;  2IQ7 A;  4AVZ A;  2O0W A;  1OFD A;  1JTA A;  1KQ5 A;  1RU4 A;  1TYV A;  1QCX A;  2QX3 A;  5JLV C;  1O8F A;  4YCQ A;  2XT4 A;  1KCD A;  3VMW A;  2XTW A;  2YUH A;  3NB2 A;  3VMV A;  3WWG A; 
#chains in the Genus database with same CATH homology
 2NTQ A;  1DBO A;  1QJV A;  4URR A;  1DBG A;  3B4N A;  4W8T A;  1WMR A;  3VSU A;  4XLC A;  4XNF A;  2O17 A;  4U49 A;  4OJO A;  3SUC A;  1HG8 A;  1VBL A;  1O8D A;  4MR0 A;  2Z8G A;  4XN3 A;  4Z05 A;  1O8H A;  1PE9 A;  2NTP A;  5C1E A;  3GQ8 A;  4XN0 A;  4YZA A;  4EW9 A;  1O8G A;  2X3H A;  4OJP A;  4XLH A;  1X0C A;  2NST A;  4XLF A;  4HWV A;  4XLA A;  1PLU A;  1RWR A;  2PYG A;  4XR6 A;  2X6W A;  1GQ8 A;  2VBM A;  4NK6 A;  2NTB A;  2PEC A;  4OJL A;  4Z03 A;  1IB4 A;  1K5C A;  4YZQ A;  1OOC A;  2UVE A;  1IA5 A;  1IDJ A;  1OFL A;  4OJ6 A;  1XG2 A;  4XM3 A;  4MXN A;  4XOP A;  2BSP A;  1PXZ A;  1AIR A;  4W8S A;  3UW0 A;  2UVF A;  4Z06 A;  1BN8 A;  2O1D A;  4XOR A;  2X85 A;  2QXZ A;  4XQF A;  1NHC A;  2INV A;  3VST A;  1O8M A;  4XKW A;  4XL9 A;  3LMW A;  3GQ9 A;  2QY1 A;  4YEL A;  2VBK A;  2VBE A;  4XMY A;  4OJ5 A;  1JRG A;  4YEJ A;  4PMH A;  4W8Q A;  3B90 A;  2VJJ A;  4OZY A;  1IDK A;  4YZX A;  2NSP A;  3GQ7 A;  4YZ0 A;  4W8R A;  1KCC A;  4OZZ A;  1H80 A;  1KTW A;  3VSV A;  1CZF A;  2NT9 A;  4C2L A;  2NZM A;  4I84 A;  3ZSC A;  2ODL A;  4XON A;  2O04 A;  2PYH A;  2X6X A;  1O8I A;  1OGM X;  1OGO X;  1O8E A;  4XOT A;  1EE6 A;  5C1C A;  3KRG A;  3T9G A;  4U4B A;  3B8Y A;  2O0V A;  4XKV A;  1O8J A;  3GRH A;  1RMG A;  1BHE A;  3ZPP A;  5AMV A;  4NK8 A;  1O8K A;  1O8L A;  2X6Y A;  2NT6 A;  3FY3 A;  3JUR A;  1O88 A;  3EQN A;  3GQA A;  2VJI A;  2EWE A;  1OFM A;  4XLE A;  2INU A;  3EQO A;  2IQ7 A;  4AVZ A;  2O0W A;  1JTA A;  1RU4 A;  2QX3 A;  1QCX A;  1O8F A;  1KCD A;  3VMW A;  3VMV A;  3WWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...