2NT3A

Receiver domain from myxococcus xanthus social motility protein frzs (y102a mutant)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
b'SKKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRKLKAHADEAVAKPVDADQLVERAGALIGFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator homolog
publication title An atypical receiver domain controls the dynamic polar localization of the Myxococcus xanthus social motility protein FrzS.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Signaling protein
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nt3A00
3HS3A 3URMA 3QEMA 1P2FA 3HM9A 3N53A 2FMHA 3JY6A 1SXGA 2GX6A 1QO0A 3I09A 2MYNA 3JPYA 2PUBA 2E4VA 3H1GA 4RU1A 3HVRA 3O2JA 4EYQA 3EQ2A 4PZ0A 5ED4A 3QX8A 5DKFA 2B4AA 2FQYA 3KS9A 2MSWA 4HYEA 2LPMA 4MS3B 2X7XA 4RZSA 2FVYA 4H60A 3UKJA 4UHJA 3S99A 4PICA 4W5RA 2H3HA 3BILA 3OMWA 5FWYB 5CHYA 1K68A 1FFSA 3Q7SA 4F11A 3KLNA 3QLUA 3DLBA 4TN5A 1RZRD 3H1FA 1MVOA 3RQIA 3N0RA 1RNLA 2FN9A 1ABEA 3EGCA 1DRKA 1E6MA 3RVSA 8ABPA 1BDIA 1RXEA 5IX8A 3NBMA 3FGZA 4S04A 4QPJC 2R48A 3H75A 4D6YA 5DLEA 5TPWB 4MR8A 4QICA 1EHCA 3OQOA 2LP4Y 3MQ4A 5EWJA 1JDPA 5KQGA 1AB5A 3H5WA 1J56A 2FEWB 2NUBA 4TLMB 5E3JA 5GQSA 2A9PA 3O2QB 3CLKA 4KFCA 4LRQA 3LKVA 4MYRA 5T3YA 1DBQA 5JS2A 3MA0A 1A04A 2WJWA 2NZVG 3EODA 4RXTA 1APBA 3DGEC 2E4ZA 1ZN2A 3OLWA 4NQRA 4RK4A 2VYCA 5FWXA 2CWDA 5I4CA 5TPZA 1LJLA 2M1ZA 1Z16A 2FMIA 1NXPA 1PUXA 1ISRA 2L18A 2FN8A 3CZ5A 4G0MA 2LBPA 4L85A 3UUGA 3HXMA 1BDHA 1QNLA 3Q15C 3O75A 3Q9SA 4KRFA 3C3WA 1BA2A 1P6UA 2JRLA 3JPWA 1ZH2A 4L4UA 4KREA 2IPAB 3BRQA 3LUFA 1Z2EA 1JDNA 3CFYA 2PUCA 3MF4A 1I3CA 3O1IC 4G0QA 4G0YA 4JB0A 3QK7A 3RVJA 4KVFA 3C3KA 3LTEA 2CHFA 4MAAA 4Z99A 5CNJA 4JASB 4WZZA 4KV7A 1E6KA 4W5OA 1R8JA 4MQEB 2PUFA 5EWMA 4OTZA 2E4UA 4EYOA 2L19A 2QU7A 5TQ2A 4LE1A 4KQCA 4Y9TA 5CNKA 2QXYA 1OXKB 3HCWA 2H0AA 2QVCA 3QLUC 2PMCA 1DC7A 3R0JA 4Z9BA 2PE5A 1F4VA 1TLFA 3GWGA 4ZMSA 1Z25A 3LMKA 5BRAA 4MR7B 3OLZA 2V0NA 3C97A 1JYFA 1JL3A 7ABPA 3HSYA 4KQ9A 4XFKA 1ZY2A 3I5AA 4D74A 3M6MD 1FFGA 1YK0A 2QSJA 3A3KA 3LUCA 4Q6BA 5KWSA 4YCSA 1TVMA 4W5NA 5FBKA 4OATA 4YP9A 1IIBA 2FMFA 2PL9A 4KK4A 2WB4A 4YWHA 1QO0D 1NATA 2P9HA 3N75A 3P9YA 3M9WA 5KC8A 6CHYA 1E6LA 3SAJA 5EWLA 4RKRA 1VLZA 4N76A 1CYEA 4N0PA 4JAVC 3QX9A 2MYUA 3F6CA 4MS4A 1JX6A 5CNIA 1DRJA 1A2OA 3GRCA 2YHBA 3QLVC 1P8AA 1A0OA 1EAYA 1ZDMA 3FFWA 3KLOA 3NNSA 1AB6A 4Z9AA 2MYTA 1JYEA 3OMXA 2B1JA 4MR9A 3M9XA 3QEMB 5TQ0A 1CEYA 3MM4A 3CG0A 1XHFA 2HQBA 2WMYA 2I6FA 3F6PA 4HNQA 1JFVA 3CG4A 2QV0A 4LZLA 1JLKA 4RDCA 2FQWA 3O2SB 4IILA 2FEKA 1YS6A 2N9UA 4RK0A 1QMPA 5GOTA 2FXIA 1UDRA 3QELB 1QP4A 4JB2A 4OG2A 1XWWA 4KPYA 2IYNA 4LDAA 4EYGA 2FSPA 1YMVA 2JBAB 2MSLA 5HKOA 3H6HA 4EYKA 3HZHA 4RK5A 5PNTA 4ETMA 4YO7A 4ML3A 2HQRA 5F64A 5BR1A 2QZJA 5C5CA 2IPNA 4MS3A 5IBQA 3ILYA 2F8TA 1EWTA 6ABPA 2E4XA 1TJYA 3N6VA 2E4YA 4H3KB 4XARA 5IC5A 2W42A 3FFTA 5IUJC 2PLNA 4G0XA 1MB3A 4RY0A 4ZYLA 4HNRA 3C3MA 2AYXA 4LE0A 2RDMA 4W5TA 4G0ZA 4MRMB 3H6GA 5TPZD 4MPTA 5JNTA 3H5VA 4MR8B 1D1QA 3CTPA 3HUTA 4KMRA 3IP6A 5D2CA 2TMYA 3CHYA 1YIOA 2RJNA 3FFXA 4O1HA 1QQBA 1Z12A 1S8NA 3G1WA 5HQJA 5BQ3A 2QW1A 1F51E 1Z15A 4YLEA 4EVSA 3E61A 2IPLA 3TO5A 5DGCA 3ILHA 2XDYA 5TPWA 1GCAA 2JCGA 1DCFA 1JH9A 2R4QA 5KQLA 3VNAA 1OXBB 1JHZA 3I45A 3KSMA 1GUBA 2GI4A 3N0XA 2FTKE 2PL1A 4OLAA 2VK2A 3SM9A 3QLVA 3LUKA 4TMYA 1YS7A 4WWHA 3N8IA 5DCLA 4YV7A 1DBPA 4N03A 3FDFA 4EGSA 3SNKA 1MIHA 1KGSA 3CU5A 1USIA 3OM0A 3RVKA 4IRXA 4P98A 1Z26A 1D5WA 3L49A 1H9CA 1USGA 1SD5A 3D02A 2QVGA 3DZDA 4RS3A 3T95A 3MIZA 4KK3A 2Q5CA 2PUAA 3OLXA 2WY2D 3K4HA 3DGFC 3QLTA 1PEAA 4WXEA 1B00A 1M2EA 1NXWA 3EJWA 4TLLB 1PHRA 4E7OA 3RVPA 1GUDA 2NZUG 1RPJA 2CHEA 4MS1B 1DZ3A 1ISSA 4Z4IA 3N0WA 1SXIA 5JNWA 4IMIB 4FB4A 1D4ZA 3LUJA 3ROFA 3HDGA 4F8JA 1JFTA 4XLTA 2R25B 1PNTA 4O1IA 3QEKA 4MQFB 4JOQA 5B3JA 3O21A 5JS1A 4MQEA 1RXIA 2JVJA 4N0QA 1WETA 2NT3A 3H5IA 5JNSA 5CNMA 2PUDA 1TMYA 4RY8A 3RVQA 1KMIY 1YK1A 1NXXA 1ZESA 2JB9A 4Z4FA 4NCBA 1NTRA 3IP7A 3RVMA 2OQRA 1U8TA 1U04A 2IOYA 2O20A 3MYYA 1LBHA 1VRVA 2WJAA 3H5OA 1BAPA 4IMJB 4PYRA 4QYWA 4NICA 4RWEA 5IEBA 3IPCA 2CD7A 2JK1A 1SRRA 2PUEA 4MR7A 4M88A 3GL9A 1CHNA 3OQMA 2FQXA 3CS3A 1P6QA 4YS6A 4B09A 3NHZA 1D2AA 1XHEA 3HUUA 3KKEA 5HSGA 1JWLA 2VUHB 5HM6A 1ZAYA 2IKSA 3BREA 4Z4CA 2IPMA 4PE5B 5IUNC 5EWLB 3GYBA 4LDZA 4EY3A 3G85A 5KI6A 5IEJA 2FW0A 4Z4HA 3I42A 3A0UA 4ZJPA 3H5TA 1KRWA 3DLHA 3JS5A 3O1JC 4MS4B 2YHAA 3RVLA 4NCAA 4G0OA 3ROTA 1U2QA 1JF8A 1L5YA 4QYMA 3OM1A 4RK7A 2PJUA 5IUKC 5ABPA 4OLBA 1DJMA 3DBIA 1Z17A 4Q7EA 3HK2A 5JNVA 3TB6A 3VNBA 1L5ZA 2M98A 1HEYA 2ZWMA 4O5AA 5KQPA 1W25A 3T6KA 4G86A 3KTOA 2LIVA 3GBVA 3JVDA 1DCMA 4RSMA 2E4WA 1K66A 2WWVD 1Z13A 4JA2A 2A9QA 4OBBA 3T38A 2PUGA 4MGEA 4ZMRA 4P1ZA 4E7PA 5TE9A 1W9HA 3BBLA 4UHKA 1YMUA 1FSPA 2KYRA 5B3JC 9ABPA 2JVKA 1ZHHA 3QELA 4Z4EA 2GKGA 1BDJA 4LE2A 2ID7A 5JNUA 5KC9A 3EULA 3JVIA 3CKMA 3RVOA 1JBEA 3B2NA 2OENG 1Z18A 1YVUA 3LFTA 1DG9A 4WXMA 4EVRA 1FQWA 5FWYA 2JBAA 2R47A 1YTUA 1SXHA 3MMNA 1T34A 5TQJA 3LUGA 3A0RB 4RY9A 4ZPJA 3SQNA 4XXHA 2HQOA 3NNDA 1ZVVA 5EWJB 1NXVA 5KQMA 3OO1A 1LBIA 4YGXB 4W5QA 3O1HB 1ZH4A 3RVNA 4ETNA 1EWVA 4DADA 3TMYA 3EQZA 4YR7A 3CNBA 3KYIB 2GBPA 3IP9A 2L17A 4PEVA 2IDMA 4D6XA 3Q7RA 4MRMA 4XASA 3OO0A 2FLKA 5DTEA 3W9SA 5C5EA 1TM2A 1URPA 3KJXA 3GT7A 5T7BA 2QR3A 3KHTA 1DBWA 4IF4A 4ETIA 5IULC 4FE4A 4CBVA 2J48A 3GBPA 3EAFA 5FWXB 3HO1A 4JP1A 1E2BA 1NY5A 2MSKA 1ZGGA 2WRZA 1NXOA 3SY8A 1RZRA 3LUAA 3E3MA 3IP5A 1M5TA 3LUDA 3HDVA 1D1PA 4Z4GA 1ZITA 3H1EA 4XAQA 4GNRA 1FFWA 1MB0A 3C6QA 3D8UA 4KZKA 2VUIB 3CZCA 1GCGA 2FLWA 5EWMB 3KYJB 4DN6A 3F7NA 1GLGA 3IPAA 3OLVA 2ZAYA 3UK0A 4N41A 3GA5A 4YRZA 1NXTA 3KG2A 5TQ2B 3RH0A 3A10A 1M2FA 4EVQA 2DRIA 4F06A 1DCKA 1USKA 2PAFA 4F3TA 3RVRA 1DP4A 1QKKA 4Z0NA 4G97A 4Q6WA 2AYZA 1KRXA 1VKRA 3LKBA 4KNYA 4EUKA 3F73A 1NXSA 3NHMA 2LUOA 3FMVA 3Q7TA 4MS1A 2L2QA 1LJUA 4IGAA 4RK6A 1Z2DA 4N47A 2PKXA 3NNNA 4H3HB 2NT4A 2HJ9A 3HV2A 4G0PA 1DC8A 1PEYA 1M5UA 1MAVA 2MYPA 1QPZA 1C0EA 1EWKA 3IDOA 4MQFA 4WT7A 3HJFA 1QP7A 1ABFA 3T8YA 1LK0A 4S05A 3LUHA 4HNSA 1QP0A 2F8SA 4DQDA 1BVHA 1U0SY 2P4UA 2RGYA 2A9OA 4GPAA 4MLDA 3LOPA 3BRSA 4RKQA 3HEBA 3EDCA 5JNRA 2A9RA 1QQAA 2FKAA 2HSGA 4NV3A 1JFSA 5FBHA 1EFAA 1PNRA 4F12A 3KCNA 3OQNA 3H5LA 4MLCA 3L6UA 1U2PA 2ID9A 4RXUA 3TD9A 3JTEA 2RJOA 4MR9B 5TQ0B 1Y1LA 2BGGA 3CRNA 3TX6A 2FEPA 4RXMA 2JVIA 3OLYA 3SG0A 2GWRA 3O74A 2HPHA 4LX8A 1VPWA 1C4WA 2FMKA 4RK1A 5BRJA 1ZGZA 4RV5A 4FE7A 3Q41A 3GV0A 3K9CA 4WUTA
chains in the Genus database with same CATH superfamily
1CRLA 3A04A 1JNYA 2R5NA 2XNDD 4EL0A 3RIXA 1EPUA 3JRNA 2PBZA 1H1LB 1VJ0A 1XEFA 2P68A 3O8NA 1R4MA 4WD3A 5D6OA 3RWBA 4BZWA 4NC9A 1S2OA 2KLHA 3IMCA 3I09A 4B3TB 3RNLA 2Q3DA 5JALA 3QWBA 4URYR 1T2UA 1GJRA 1ESZA 4Y0AA 1U3CA 3L7DA 2HC9A 4DV6B 1ZM4A 1F2UA 2YVLA 1Q1EA 2C5LA 3RI3A 3T1HB 3BMXA 5ALYA 2FQYA 4JVMA 3JYLA 1RM4A 4NJEA 4EY5A 4O29A 2P40A 4G5GA 1RYDA 2EJBA 2PBFA 3RC9A 3WGMA 3LDFA 2JG3A 5AUQA 1KQNA 2H3HA 3BILA 1CJSA 3L7YA 2OHVA 3ZE1B 4BFCA 2ZWIA 2F62A 3GGSA 3SZOA 1ENYA 4GHWA 5JMWA 2VYND 3H1FA 2M9MA 4WW0A 3WGOA 1NYLA 2JKZA 3L6EA 3NM5A 4AKSA 3V3TA 1XK6A 1X1AA 1KTVA 2FUG6 2OGUA 4M1YA 4OYHA 3DVAB 2PR2A 3BZBA 1JJBA 4I55A 5FAXA 5JCOA 3RSFA 3KJGA 1U0LA 1GFIA 5K3CA 3RVSA 2ST1A 5HOEA 2AE2A 3IDQA 4Q7KA 3P9XA 1VYTA 2YTZA 2DF8A 4YXFA 4IG9A 3K94A 1D5CA 4CMJA 1HDIA 4BP9A 3VYUB 4Z3OA 4FW8A 2FWIA 4X90A 1T35A 2ZK7A 4K1XA 3PK0A 3PVSA 4EGCB 4DMHA 5LYJB 2ZYDA 5HDBB 4KU4A 3UF0A 1SKAA 2PJZA 4O08A 4QA9A 2N1MA 1NVAA 1JHDA 2AXPA 2XX3A 4CMAA 3G8YA 2NPIA 3D2CA 4OHPA 2GQ0A 3HGQA 3T94A 5FBVB 3AP1A 1C3LA 2XYPA 1M34B 2H7XA 2Y0EA 4JOSA 3WGNA 3LTNC 3PC4A 3ILXA 4IHJF 5F9FA 5FWXA 3B1JA 2QTHA 2A3RA 3BEOA 3UYLA 4DREA 1BFUA 3F49S 4HQOA 2GLUA 3EXFB 1PUXA 3ZJTA 1ISRA 2MR6A 1N5MA 5H3HA 3N8KA 2NYVA 1R5OA 2DLDA 4YJ3B 2FZ5A 3Q15C 5CBPB 2IIQA 2ZUDA 4UKDA 3LWDA 4WFJA 3ABRB 2F8LA 4ZJYA 3O0TA 2O0MA 3THWB 4JEHA 1U80A 3IUPA 4PTYA 4DV1B 3BGWA 4KIFA 3PHBE 4B7CA 3HDQA 2PT9A 4KBFA 2VWPA 4O2RA 5DEOA 2VXBA 1YQQA 2E2WA 1M72A 3BXFA 3QQ5A 4J76A 5DWDA 3T9FA 4JDUA 4RGBA 1XMPA 2G0NA 2GFHA 4DA8A 5I48A 4GZLA 1EQ2A 3CN7A 4ZA2A 1VDZA 3LJKA 4EJSC 2NG1A 1R8JA 3KJHA 4B9AA 1ESDA 1PUJA 3E03A 2QI9F 3SJBA 1QS0A 4L5JA 4PO9A 3UOAB 3WADA 4QDTA 3IOYA 2PX6A 5G4KB 4RTLA 3ZWOA 1D9XA 3QU7A 2DFNA 3KELA 3I5YA 1IG0A 1W0KA 2P6UA 2XYHA 2I33A 3PCXA 3IQHX 3PUKA 4IZOA 4P7KA 3EIXA 2WF7A 2AVNA 4D43A 4DDHA 2VPZA 3K8ZA 4DQKA 4RY2A 3QXHA 3V55A 1U3WA 4C4AA 4D1YA 4HNGA 1PBNA 2I7DA 4LYJA 3A28A 1ZEMA 4JB3A 3WB0A 1C0LA 1ZD9A 3F1KA 3V8BA 3L7LA 3AEUA 5ALLA 5H80A 2IZOA 5LOVB 2QSJA 3HLYA 2RH5A 5IWCA 3WKAA 5LQDA 2CJFA 1KH2A 2O8EB 1CDDA 3C1UA 5FNVB 3QE2A 2XY4A 3OF3A 3K2QA 3GNTA 5BW6B 1Q1AA 3D5EA 2FMFA 2VKTA 3H2IA 4M9ZA 1UM9A 2FSVA 1VI2A 4NCNA 1K7CA 2ONZA 5AK3A 4EENA 1O08A 4ND6A 3RKUA 3YASA 2PGNA 1AC5A 5KC8A 1BWRA 4R7GA 3O5AA 5TGDA 1O5IA 1ZGAA 2ORVA 4K8OA 1V5FA 3KKPA 1MB2A 2IFTA 1N2XA 4IAOA 3BMQB 1BMFD 4F9FA 2WSSD 1OWPA 2VYQA 4BHTA 5JASA 3WGLA 1JEYA 1V1RB 4Q9AA 4TGLA 5I7FA 1JR6A 1HPLA 4AB1A 2ILTA 2BFFB 1U81A 3DCYA 3GGGA 4WFQA 4CIYA 1JYEA 3FMFA 4B84A 1LY1A 4ALJA 5B12A 4DEXA 4EY8A 4EW6A 2G6BA 2NYRA 1MFPA 1OFUX 2O8CB 3DKIA 3INNA 4NNPA 4BX0A 2QLBA 3RS4A 2Y76A 2QYOA 4ZYZA 4DJ5X 3A4YA 1XROA 1FJGB 2B36A 2HPVA 3A2LA 1T4CB 2GPWA 4JB2A 5LXTF 1L5MA 4RJKA 3TIXB 4PC1A 3M7IA 1KEKA 4B40A 3GP3A 2ONJA 2ZM5A 1JLHA 5K4GA 4NZPA 2H4WA 4CFYA 2QTMA 2GARA 2VJMB 2IYYA 1F2TA 3GRYA 1X9IA 1R50A 2XMQA 1ZRHA 5KHLB 3MPUA 5GJWC 2WDPA 3UWMA 4A0RA 1RWQA 5IVIA 1G66A 1KI6B 2YHSA 1P0CA 1JU9A 4LYYA 3D0QA 4Y9RA 1R6TA 4KIUA 3ONWA 1EWTA 3CISA 5E7IA 1MVNA 2Y1GA 2Z2JA 1CUWA 3N7UA 4ITUA 3R7NA 1ZISA 4WJLA 1OXVA 1H0HA 3TE7A 3KD3A 3GVIA 3QLEA 3FRIA 4BKRA 3HPQA 2ANCA 3PWSA 4YO8A 4OX9B 4IKEA 3HCEA 3N59A 4PX3A 3HA3A 5DLQC 3FZNA 1XIVA 4NP6A 5JZMA 1VGRA 3IOMA 3SYRA 5JECA 3ZGZA 1RZ3A 4P83A 3IIEA 4RQBA 1OJ7A 1U8UA 3QUTA 4ZFNA 4ZJUA 2HJRA 2CSXA 5K3OA 1Q7EA 2YV2A 4D3DA 1OYVA 1CNFA 4R7ZA 4YT8A 2WZQA 1QGOA 4WBNA 3NGXA 5EJ7A 4E5DA 1M6WA 3F8WA 2ZR7A 4DLUA 5KSPA 2GERA 1E1QA 3ZX4A 4YV2A 1V95A 5DGCA 1P72A 4JL8A 2OKGA 4PYOA 3U3OA 3AI2A 3DBOB 3V4SA 2IXGA 2QT9A 4FGZA 2AMYA 3SLRA 2I4IA 1EVQA 2OBYA 3ZZNA 3BSSA 5LVAA 2EIXA 3HDHA 3EPLA 2B98A 1TAQA 2PRSA 3IOBA 3ANNA 3NV9A 3PT5A 3AL2A 3WL5A 1S5PA 1YS7A 1AF4A 5KNBH 4CFZA 4YV7A 2Q45A 2V5UA 1REQB 3WDMA 1OIVA 3KSUA 3R8CA 3O7MA 4A0QA 1FP2A 5C7OO 1YF3A 1Z06A 4N5MA 1VMDA 1KBQA 2W6CX 3G0DA 1ZI8A 3ML1A 2VJNA 4NU6A 3FPBA 3LIIA 4TQGA 2C2WA 4FN4A 3DC7A 2Q5CA 2G70A 4KXUA 3UKOA 4CKBA 1DJPA 1CDEA 1SHZA 2WY2D 4B6EA 3GLGB 3DGFC 4RHXA 4BQSA 1Y9DA 3VOTA 4GT1A 3SEFA 5HNKA 1YT5A 3QFFA 1G6Q1 1RAEA 1VCNA 5HCUA 5BPFA 2JJ1D 1HQDA 2WILA 1T2AA 4EHLA 1VMIA 1ACLA 5I7UA 5K3AA 2J30A 4KHPB 7AT1A 2P9YA 3SIRA 4LFAB 4NDAA 2DT5A 2IE8A 4N0DA 4NMLA 4ARIA 3P9CA 3DEFA 4AP5A 1WW3A 4BLTA 3OOEA 1YUMA 4MA4A 4C5CA 3GRFA 4MQFB 1SIOA 3N2ZB 3AONB 3ZU4A 2QL9A 4D4KA 2Q27A 2AL7A 1E2NA 1VE6A 3FGNA 3P4UA 4P4SA 1FNSA 1PS0A 1QHHA 3IAS1 3OEWA 5C7LO 4OQNA 2Z95A 3OPYB 4GD3Q 1E1RD 2G80A 4GGMX 2EJUA 4KQKA 1TEHA 4ZT3A 1UZUA 1NNLA 3RLFA 3W4JA 2JLSA 2EDAA 2IOHA 5J2UF 3BJMA 4A1OA 3KZ1E 4F46A 1A5SB 2FEAA 4TUYB 1C2YA 1XVLA 2ZYAA 3G23A 4OQYA 3MOSA 2XZPA 4GYWA 4B3RB 3FPCA 3O91A 1OGIA 3JW8A 1UWLA 3S1AB 2FZCA 3QVJA 1JMVA 3EVNA 3N87A 5JAQA 1NW4A 4A03A 3OZRA 1GRCA 1Y0BA 2P4EA 2CLKB 1HE2A 4H4EA 1ND5A 4TSFA 3ZLJA 1B0AA 2CLLB 4PE5B 4MW7A 1MENA 3UHFA 4CNQA 3DHWC 3BGDA 2V3CC 4XUCA 3AI1A 1FX1A 3R6LA 7ADHA 3ER8A 1Q0QA 1UM8A 1LDNA 1VA4A 3SFVA 1SKQA 2K7FA 3PQ4A 1DQRA 1RJWA 2WD7A 2WF8A 3H5TA 3OHSX 5AW5A 4E2FA 1M1XB 1U7TA 2YHAA 5JNLA 4GRDA 3I73A 1YBHA 1GUZA 3F5QA 2XQIA 4QYMA 2QTTA 4GOOD 3SP1A 2YOFA 1EGAA 3LRTA 4IXNA 5B64A 3AB7A 2E1RA 4J16C 5ABPA 1PFKA 1JQ3A 2JIPA 3KYCA 4GZ5A 1V6SA 2AJ8A 1ZICA 2R1UA 4JJGA 4OQEA 2QVBA 2VBFA 1ZXLA 2R86A 3AB3A 2ZROA 1H65A 1CDZA 4MVXA 5HRCA 1QH8A 1TEVA 3LT2A 5K0CA 1P2BA 1FIUA 4E5PA 1E2QA 2FPWA 3FROA 1Z0UA 4LBZA 4UPVA 1BQ3A 1VKNA 4KLCA 1F8XA 5DM4A 2DTEA 2GN2A 1UWKA 3MQFA 1D0IA 3MUEA 4NNOA 3O4IA 4YNBA 5M04A 1EB9A 2ZYGA 4TTPA 3U4CA 5JV5A 2J8ZA 1TU4A 4XR4A 4E7PA 3UW3A 5KYUA 3MUNA 4UM8B 4OH1A 5GTDA 4FJ1A 1UT6A 2AR7A 2P77A 3I58A 2FPXA 2J6IA 3C5EA 4ZP1A 5AM2A 1SKYE 3HU1A 4RUKA 1ZHHA 3RS9A 2FSGA 1CZNA 3JQFA 1Z4MA 1C30B 2A6PA 2HDNB 1E60A 1HT3A 3B7PA 3EULA 3R9XB 3CKMA 3CNOA 1JBEA 4RABA 3RF7A 4DEVA 2ZSIA 3B20A 3HCCA 3H5RA 1OVGA 1ELOA 4BMDA 5CGZA 2D1QA 3EWAA 3G8DA 1KZ4A 2QGFA 2SBTA 2FEOA 2VYVA 3AUSA 3KC2A 4YALA 5ALEA 3UT0A 4EABA 3PE3A 4EG4A 3WDKA 1UXHA 5EWJB 3SE0A 4CF4A 3AVYA 3CWCA 2ES4A 1XRPA 2ZCUA 1CJBA 3UC9A 3MBIA 1RAGA 2NM0A 4E5NA 1CUYA 3JAKB 1R0ZA 4Q18A 1TE2A 3DTVB 4W9RA 3ZHBA 2F1IA 5A4MS 2IS1A 3ZV3A 1QOQB 3I01M 1H8HD 3PBKA 2DPXA 4NEHB 5EMJA 3THOA 4EDFA 4HFMA 2VS1A 3QIVA 5C5EA 4ZO8A 2YCBA 3NHSA 1C1HA 3VSDA 1D03A 1GTZA 3ISJA 5BYKA 5JC8A 3BTSA 2YWFA 4FE4A 4H16A 4IVQA 3K71B 5BOSA 4YRSA 3V9AA 2ZAMA 5C32A 1YZNA 4GYYA 1GAQA 1C14A 3UFBA 4YCAA 4FKZA 3VUFA 1J0XO 1NFRA 3RYHB 5LP6F 4E1AA 1PVVA 1IEXA 2O2YA 4CQLB 4EAQA 4NBSA 4LZPA 5P8WA 3OOYA 2QYHA 4QQRA 4P92A 3VDRA 3JAWA 2Q7OE 4C5BA 1D1PA 3CF6R 2QOEA 2ZRHA 1UPXA 1SHLA 2CVFA 1FS5A 1PJ3A 4MUBA 4GX5A 4B83A 1X3SA 4KZKA 4QUGA 1JYSA 5EE0A 1AMOA 3FB1A 2CW5A 3DE7X 2C1ZA 4WHMA 3B9PA 3N2NA 3STHA 3ZTYA 1T8PA 1VE1A 1IDN1 4H08A 1TVEA 1PFWA 4X8MA 2EZ8A 2VK4A 1XPRA 2MSDB 3NDRA 2WIJA 5DJ5A 3VGJA 1BCRA 2WVAA 2C0QA 3B1YA 3I0NA 3QTLA 1OREA 4L3WA 3ZQJA 4D9MA 4RTOA 3PQCA 3EB9A 3I4CA 4U4AA 1A9XA 1HZZA 4LV5B 2EP7A 1WKCA 3OFJA 1JPNA 4ZICA 3LYLA 4FFSA 4G97A 3NYWA 3TNJA 3KWMA 4ZGBA 3N2EA 2VJKA 1DSSG 2IE0A 1QFSA 4MUMA 3KXIA 1MXFA 4HDNB 4IGAA 4XVQA 2Z9DA 3PIIA 2VJPA 4GKVA 3V1LA 1X8KA 4KHZA 1KY2A 2NVOA 4RL4A 1KOGA 3BBPA 1MO2A 3AC0A 3G5TA 3NVMB 4QO8A 3WC4A 1U8YA 1COZA 2O8NA 1XZKA 4HNHA 5I7RA 4YK7A 2HU5A 3NDBB 2HW8A 3VBEA 1CY0A 4AKIA 5L4LA 2WE7A 4ROSA 2H31A 1FVHA 1XTRA 3L0DA 1E0AA 3GUHA 2A9OA 4UDNA 1J7JA 1EK2A 2JI7A 4DARA 4KR3A 5D84A 4BNLA 1FRZA 2H16A 5JNRA 1T5IA 5F5NA 3IIKA 2XUKA 5TJHA 3HZZA 2XT0A 2VTVA 3AF1A 3HWRA 1VB3A 1G7RA 1GZDA 4IFTA 2OCXA 3WAKA 4M8LA 5JFOA 3OJCA 3M33A 1YZLA 3QLJA 4D5EA 3PCRB 4CGYA 1A3CA 4RD4A 5E95A 3SCZA 3SX4A 3OZIA 4FYJA 3OEHA 4KTTE 2BELA 1G8KA 1YO6A 4AG3A 4ONEA 3B9RA 4CCWA 4X6YA 3EMDA 4AJJA 1QFZA 2ZR8A 3GNLA 4EUNA 2Y1XA 4TYPA 3ZY2A 1GG9A 2RI1A 2FUEA 2IU3A 2GSWA 2X2OA 1MC5A 3Q88A 1Z5GA 1FEZA 3GVCA 2NQ2C 4KDEA 3L2OB 1LD3A 1GOTA 2JLXA 1B8OA 3JQRA 5HKLA 1MQAA 1NX9A 1XG5A 1KARA 2OYSA 2PNJA 1ZCAA 4A23A 4JXJA 5B1YA 2G77B 4CIBA 2ACEA 2R8PA 4IIJF 3ZYZA 3JPYA 3JCZA 5EHGA 4BB5A 1XKTA 1CUFA 1XFAA 1SOWA 2H2DA 1MMFB 2VP5A 3IBGA 4DPMA 4EMUA 1VMEA 4IQ0A 1EZ4A 2V9ZA 5J59A 1J2UA 1IL0A 3KJQA 4XIFA 3TRIA 3MWDB 4JWKA 2YJ4A 3W8EA 3A70A 3JARA 2WTNA 4JLJA 3MVEA 4OYRA 4URZR 4D0GA 4HYEA 4KYTA 1FXWF 3CBQA 1LQTA 2WFMA 3C87A 1EFTA 4P7JA 4XWTA 3W79A 1ONPA 3RASA 3HRHA 1C7JA 1CUEA 1THZA 2FCRA 1G6OA 5HMMA 1RIFA 4ENWA 1JW9B 2ACWA 5J5VA 3Q2KA 4B3IA 4CI0B 3AJEA 4UCXA 3RARA 4ZHQF 2FMUA 3K9NA 5AVJA 3UA3A 4G4JA 1EA7A 1EUCB 4LXHA 3TCKA 2HHHB 5AOCA 1I7NA 2EZ4A 2O2ZA 1D6MA 3GNQA 2YIDA 1PE0A 4M9QA 4M0MA 4NPAA 3KYDB 3OT1A 3VC7A 3IV7A 4BMVA 2VF2A 5F52A 3MWJA 1N9GA 4DR7B 3EGCA 1WDLA 4LZOA 2XJ4A 4XYMA 5BR8B 1M2OB 3VZPA 3GFOA 2M6KA 4P35A 1WM1A 1EFDN 5A9RA 4ZKEA 1XEAA 4LVUA 3IHTA 4N8EA 1CPYA 4F1JA 1A1SA 1X1BA 2WSYB 5JAUA 3EZ6A 5EE9A 1QE0A 3IXQA 5D5PA 2HMWA 4ZT2A 2XUJA 5B7PA 1QFXA 2HA6A 4XOUA 1ZD5A 4J8PA 4TLMB 4C7OA 1PGPA 4QFBA 4E6PA 1TMOA 2EL7A 2JASA 2RHRA 1LPNA 3KKLA 3LBNA 4HLUA 4OB6A 4KFCA 2J3IA 3L40A 3SJUA 1DBQA 4OK3A 5JS2A 1PCXA 1I3LA 3DM9B 1A04A 2XVMA 3UUFA 3ABSB 4DIKA 5K6TA 4CMBA 3DKRA 4FS3A 3SQXA 4NQRA 2BFCA 3BXGA 5K6AA 4J3JA 3AHHA 3CF4A 2ZRGA 4I6GA 5L45A 5DMXA 1B73A 4M46A 4WKPA 4Q3LA 2H59A 2XT6A 3BWYA 3F7MA 4R8MA 5ADUS 2ZAGA 3HXMA 3AM5A 4X9XA 4I9FA 3PX3A 4X3CA 3P0RA 4B3CA 1O9BA 4I1VA 4II7A 4PZLA 2YWGA 5FQOA 3BMOB 1EFHA 3O47A 4TYYA 1HYHA 3ESRA 3V6LA 1X38A 1DC5A 1I3CA 1OUMA 1NOIA 2IYEA 3V8PA 4DQVA 5BSFA 1J20A 1ZVMA 2MT9A 2W6PA 1N8SA 4JASB 3F3YA 4Z0HO 3UK1A 1F38A 1QANA 1UPFA 1VE3A 2X9NA 5J58A 1BS9A 1IPFA 4YBRA 5JUWA 4IM7A 1P3Y1 2QMHA 4QTTB 1C3OB 2R0QC 4AECA 2XRFA 2AN5A 2XUZA 3LC7O 4FOPA 4KAAA 3VAZA 3WKBA 2WMNB 1D8TA 3GCGA 5ECGC 2O8BA 3QW4B 3D8BA 3KOOA 4I8IA 4LZZA 5IXYA 4UDOA 3HLTA 1CQZA 2UZ0A 4LS3A 3RABA 4RELA 3ZKWB 1GP2A 4QGHA 1OXKB 3P9PA 5HDQA 2HO5A 1JKFA 3QLUC 3M4JA 1NG1A 1EJ2A 2O2XA 3NTUA 4S12A 1DWQA 2FGKA 2X6TA 4MQ6A 1MV8A 3RR2A 5B57C 4CKZA 2PE5A 1DX6A 4WXRA 3BT7A 1AGXA 2CFIA 3DXFA 3MJFA 1KK2A 2Q07A 4JI4B 1PGQA 1M74A 2PFKA 3SF8B 4Y6OA 1ZH6A 3QYPA 4U2CA 1EKXA 3EFOA 3X1ZA 2JFQA 1RPZA 2AG8A 2ZIZA 2YV4A 1UP6A 2VA9A 4FONA 5KKNB 1W85A 1Z0IA 5TIIA 1SOVA 3TZKA 3UFXA 3ZHYA 2GEBA 1ZSYA 2HWXA 4R9UC 3HKBB 1JLSA 3BXZA 3S8YA 2GETA 1PVOA 1B8UA 2LW7A 2PMDA 1EUDA 4IDAA 1BEEA 2IKQA 4JVOA 4RD1A 4GBGA 2P2NA 1WEHA 4YP9A 3A1UA 5HZGA 4HF7A 3L4KA 1NBHA 4GWGA 1Q0UA 5F7JA 2BONA 2LZ0A 4AN1A 1V1MA 1W35A 2XNJA 1AKUA 3PFWO 4K6HA 2HMUA 1CKEA 2G9VA 1A2KC 1SD1A 4IO1A 4RHUA 4LOLA 1QIHA 5DM0A 3O73A 4U2GA 3FB4A 4XDGA 4E46A 1WE2A 3EOAI 5I7WA 3VTAA 4ETWA 1V8OA 1EFRD 2E6KA 4IKOA 5IKEA 5CA1B 1LBEA 1L8AA 3K9GA 1EHIA 4ZZIA 5B3AA 3ZDDA 4PHHA 3SK0A 1J2TA 3FTDA 5AI9A 1T3TA 1PRYA 2G25A 3LX8A 3IIIA 1ADYA 2GXAA 4EI8A 2WHRA 2D4AA 1ZIYA 2WP8J 1KK1A 2VA8A 5ALKA 1UMDB 3IHLA 1SBQA 4TT3D 4D0LB 2Z5GA 4ZARA 4GUDA 3Q5DA 1D9ZA 1GHTA 2VPTA 4EPWA 2RSLA 3HEAA 2LE0A 1PFGA 2QZ9A 4G3XA 1U6IA 1X6VA 2FQQA 4HTAA 4O5OA 4YRPA 4WVFA 3CMCO 3W6ZA 2W2TA 3ZS9A 4DCNA 4ERNA 5E1DA 2I6QA 1Z07A 2IYXA 5T67A 2WFZA 1VYHA 3IPLA 2IDKA 2DFTA 3I2FA 3SZGA 1YMVA 2FB9A 4WN9A 3ENWA 2WAMA 3ZU2A 3PDIA 3J80A 3NEAA 1KZHA 2O23A 4GC9A 5FXMA 5A1TA 3ZVKA 2A9VA 1CK4A 5FF9A 3KUKA 4KR9A 5LZ9A 3GELA 3PFFA 5FX2A 4RULA 4UFPA 1ZYUA 3I9OA 5HRUA 4F4IA 2C2KA 2XDQB 4G24A 1A8SA 3ER6A 3MTJA 1UFVA 2G82A 3EA0A 4PGHA 2HUPA 1FFXA 1WV0A 4MDYA 4PPYA 3UAYA 4FZJA 3VUEA 3FNEA 4RD0A 1MG0A 2OGWA 3NC1C 2ZSJA 4BNFA 3QI7A 1EVZA 3OIFA 4IZIA 2PTHA 2HA7A 4MTLA 1SB9A 1W34A 4P0TA 3W8RA 1WV1A 3FKSD 4L27A 5K0FA 1NP6A 2CHQA 4Z1MA 1ILEA 4S1NA 2O7QA 2UAGA 4H3SA 5DGXA 4D92A 1JSRA 1AS2A 2OM2A 3WFZA 4BNYA 1C1DB 3I28A 5JS7A 1Q3KA 4XDYA 3SX2A 4DLXA 5IBRA 1OBOA 5LQNA 5IS2A 1YZFA 1S4QA 1K3FA 3QKSA 1PZFA 1QIGA 3B1XA 1JUDA 2Z0MA 3B48A 3DUWA 3LOQA 4HS9A 4UU0A 5B2FA 3A6FA 1IHUA 1Q0PA 1VECA 3QLVA 1KZGB 3DH0A 3UUEA 1PJBA 1NE2A 1JJIA 3IB3A 2XRMA 3ESYA 4N03A 3DDHA 3UGQA 2PSHA 4Q4CA 1JDUA 2R1TA 1ECGA 3OM0A 2Y3IA 2GLXA 4MWDA 5CVUA 1C3EA 3C48A 4OREX 4DQ0A 4RNDB 3W1WA 2CXTA 4YAEA 5HTKA 3N2LA 4NEQA 6ADHA 4LXTA 1TLTA 1D4FA 4L78A 5K03A 1X1TA 5DLPA 1VL6A 2ZB4A 1LFAA 4ZAWA 3HU5A 2XRZA 3OKPA 5DNDA 5JISA 3ORQA 1R6XA 4MKXA 4YP1A 2O8FA 4AFNA 5HW0A 1O5OA 3FKQA 3UXYA 2NZUG 2HH9A 2VFAA 4MS1B 3HTXA 1YQXA 3TRHA 1AN0A 2GBIA 5JXIA 4ZI2A 1UMCA 4FB4A 2X8JB 3Q87B 3DEKA 5IKXA 1CTQA 4LQLA 3TOZA 1P5FA 1TUBA 3BIFA 1BXGA 4KWCA 4LOKA 1FL9A 2GZDA 5EQDA 4NESA 2PSJA 3V1TC 1YRBA 1KMHB 3F3SA 2NXEA 3C7KA 3CEHA 3JASA 3OT5A 3H5IA 1L7VC 1T1JA 4QXRA 2XBMA 3L3BA 3ZHRA 5A7FA 2R6GA 4HN4B 1U7WA 5D01A 3KXLA 4AJ4A 2BEVB 1QB8A 5C53B 4XM0A 1VRVA 2CLDX 3QX7A 4G67A 2Y1DA 4MV9A 4QD3A 2HBRA 1US8B 2VAXA 4YJ2B 2RBEA 2J0QA 1JKMA 4RWEA 5IEBA 2IZ7A 4QBIA 3PUJA 4WUVA 4EW3A 4N01A 2X0DA 4CM9A 3MJVA 1AKNA 1ZA2A 1R0RE 4KUGA 4W8OA 1CHNA 3GJQA 2JGIA 5LP1A 1NQTA 1G8YA 1XZGA 3L9WA 4EJSB 3WRVA 3QH4A 3CURA 4PHCA 4S35A 1MPTA 2IL1A 2XKAA 2EGUA 2X0NA 3HI4A 1NN3A 3H4VA 3WK4A 3BS4A 5I9BA 2FW0A 3IYLW 2VRNA 4GP6A 1DB3A 2X0FA 4IJQA 2QRMA 3E9CA 3JS5A 5AOAA 1F20A 3T9DA 1TYAE 3PUHA 1TC1A 4QO7A 5KMGB 2H5EA 3BQMB 3LG2A 2IUTA 2WYOA 4ZEVA 4AY5A 2BFBA 5IUKC 4MV4A 2DKOA 2DPHA 1DNPA 2BSAA 3R3YA 3PQ3A 2C0PA 1R16A 4LRWA 1DJMA 2OBBA 5CXSA 3HFSA 2EX0A 3K2EA 3ZLUA 3KB2A 1HG1A 3LNTA 4MICA 1GCUA 1YQUA 1OR8A 4D44A 1T8TA 1ETHA 2RK3A 4OGWA 4AMZA 3FRHA 4TXNA 4H6VA 3ZS8A 1QMGA 2A86A 2DMRA 3JVDA 4F5YA 3RC7A 5EIXA 1KI7A 1WD5A 3ZE2B 1L4FA 1SVOA 4G1VA 3HC7A 3LCJA 3IQFA 4TMXA 3NP7A 3TSYA 4EPXA 1ZU4A 1FDUA 2JHAA 1BXKA 3LZ6A 1LLUA 2O50A 3LVRE 3V8VA 4YFVA 4QEDA 2O5CA 1VQ1A 4KPFC 3JX9A 4B0PA 4TWZA 4J0KA 4F04A 4Z51A 1TCVA 4DUPA 1N2CA 2COKA 3O4FA 1I36A 1YQDA 3CR8A 4ZAYA 4JLUA 3PF9A 3JVIA 3NG1A 4WERA 5JSFA 1EFPB 4KMOA 5SYNA 3AHJA 3FF4A 3H9BA 5DULA 1M5RA 4I55F 4AKEA 2R8EA 4DPLA 5J4KA 1ZUIA 2R97A 4RY9A 5DBHX 1F8GA 4AXBA 4RENA 4D9IA 1Y7TA 1E1KA 2VPPA 4CZ2A 2ONKA 4NFYA 1TT5A 4PC7A 4W5QA 2F9MA 3HDJA 4WXPA 2VDUE 1I4WA 1V41E 5K51A 1LKZA 2IHKA 1YVPA 1YCDA 2WR8A 4PSDA 2GEKA 2B8JA 2GCPA 2P9FA 2ZQZA 4Y2HA 3L0SA 3D0OA 4RM3A 5CM9C 3AWDA 4BOYA 2DLCX 4K5QA 5CDTA 3GZNA 3QF4A 2W90A 4BYGA 4X24A 4V1CA 1HRKA 2YV1A 3FA2A 3LQQA 4WOBA 1HEIA 1E5LA 3P26A 5E7JA 4MVYA 1IPEA 1SZDA 3RJZA 4B3FX 1BJTA 4A5OA 1P45A 1CR4A 4LXGA 4CT4B 2QTGA 2DH5A 4XQ9A 2ISCA 4DA4A 1XJ0A 3E3MA 4QHSA 2VAMA 1SFRA 1QRTA 1T2DA 1ENPA 5TMEA 1R6AA 3K09A 3K6SB 2IITA 1NLMA 3A6ZA 2FZ4A 4ALIA 2X5XA 2IY7A 4JH0A 1ZK2A 2X6RA 3U13A 1XXHE 3AEQB 2EBUA 3DP7A 2J9GA 2XB4A 3PF8A 3QVMA 1S0UA 4XPIB 2ILVA 4ZT7A 1NF2A 4B17A 3AVVA 1SCUA 2PT6A 4MKHA 1Y9AA 2V5AA 1DVRA 4UVIA 5M7EA 2FLWA 3CZMA 5B58T 4BVKA 4EBFA 1AQ6A 4GL2A 1RRGA 3ZE7A 2YBEA 1AHHA 4AVYA 3FBWA 2Q28A 3IE2A 2QW0X 3F2IA 4DJTA 2PFSA 5CA0B 5JVDF 5GWXA 1GTL1 2Y6VA 1C0PA 2XXJA 2OUIA 3V2HA 3DZHA 3L93A 4FEGA 4PTZA 4WGFA 4YDQA 1ZUNB 1WBDA 2C2XA 4GI7A 3VI3B 3KKNA 3ZVMA 1NF3A 2HA3A 1W1IA 5G0SA 2JA1A 4OEHA 2IEZA 5DP1A 3NNNA 1T9CA 4YASA 2NU8B 1Q95A 3U9SA 3JQ6A 2B8EA 3HV2A 2B5VA 2N46A 2NTYC 3FM9A 3JVVA 2RGRA 2X5KO 4RNCA 3ZVRA 1HC7A 1NMEA 5JY1A 1Y3DE 3AFNA 1T5DX 1RQNA 2PTGA 3DV9A 2BZSA 2WHXA 1QVWA 3NOVA 5FJIA 4DQDA 5LQJA 1OH7A 2NU7A 3MN1A 2RGYA 1IQUA 4O4LB 1SUWA 1NGSA 4MLDA 2QMQA 4Y1FA 4C06A 1A5ZA 2X40A 2VBCA 1G1AA 5G3ZA 4NV3A 1RLJA 4NYMQ 4A7PA 2BDEA 1EFAA 1EXDA 4MCHA 4OI0A 1XQ9A 4G84A 3ROXA 13PKA 4M8KA 2Q21A 4IJKA 3VYTB 3INTA 3W5UA 2G8NA 2C07A 1J0BA 1CUIA 5CLGA 3KU4A 1LB1B 3VAYA 2BMVA 4HV4A 4PC3A 4B8WA 3FCXA 2N75A 1YBAA 1JEQA 1Q7GA 2FUNB 2C2GA 1G7CA 2JVIA 4YEDA 4PR0A 5J40A 3RG8A 2LR0A 1CZKA 4MARA 3O74A 2C20A 3FSGA 4ZO4A 4M1KA 1JB1A 2FPMA 1FS4A 1C4WA 1C50A 2Q5LA 4L51A 4CKCA 4O2AB 4PO3X 4CDRA 5I8PA 3AR8A 1CT9A 1O95D 3GV0A 1T43A 3CLTC 1MDBA 3AVXA 4TSRA 4FOOA 3RWMB 2BGJA 2BFDB 2XTJA 3CZPA 3OCWA 1ZGCA 3M4YA 1GPUA 1ZXBA 1JTFA 1IWPB 3WQQA 3MOGA 4BQEA 1HV8A 1Q12A 2R751 4KQEA 2JGFA 3EEYA 4DZRA 1U9IC 4GSYA 2EGGA 2W6JA 1TZKA 4MVJA 2XE4A 1AUXA 1SULA 1EUQA 1JGTA 2OXRA 2I76A 2QL6A 2PN1A 3LYUA 3P94A 4R9VA 3G8BA 4PFKA 3KS9A 4UZFA 3IT2A 3IPXA 4XIJA 2X7XA 3P0HA 1XPOA 4C0KA 1Q19A 4P38A 3OZSA 3S99A 2CHVA 5CG1A 1QB7A 1DC4A 2BR3A 2QUHA 3VHLB 3O9ZA 2H1SA 4J1TC 4MV3A 5HJ2A 1CIPA 1SY7A 1FFSA 4UBJA 1Q0HA 4Q24A 5JY6A 4B85A 3B36A 1BOFA 5K45A 5DB4A 1AS0A 2BFPA 3BHNA 3OZGA 2C92A 3EG9B 1BSVA 1M1ZA 4FJ2A 5D3QA 4BVJA 5FHRA 3OZCA 5D3KA 1MVOA 2P2LA 3QBTA 4KQJA 4YJFB 4G4SO 2OO3A 4MVCA 3FNHA 3AR4A 1PQWA 4JUCA 2P67A 1SGWA 3BPSA 2W98A 5KUTA 1QV7A 4RZHA 1ML3A 1TX4B 4OGFA 2W93A 3C3CA 5EQTA 1OTHA 1T9GS 2LP4Y 3P71T 2C3UA 4YI5A 2WYUA 3F5MA 2I2WA 3VDNB 1CVIA 2NUAB 2NUBA 3PGJA 4O4IB 3SC3A 4ECAA 2HF2A 4EZIA 4NIMA 4IDPA 5CTAA 2XKJE 3JR7A 3G9ZA 2IEYA 4QULA 1YI0A 4FK8A 5CJ2A 3WRXA 3M6VA 3VMFA 3KTAA 4E21A 4LRSB 3KR2A 4R51A 5FPPA 4RIHA 3GLFA 1GZSA 3K72B 4RJLA 2C5SA 4BCCA 2IHNA 1DEKA 2WWTA 4J0JA 3LDUA 3OLWA 4TPKA 5B4UA 1U5BB 3SD7A 1RYEA 3MGAA 3SFZA 1JIQA 3DPSA 4GMXA 1X7ZA 2P9QA 5BRNA 3V7NA 5C5DA 3HCRA 2RH8A 4QGFA 4DMLA 2MOKA 3RREA 1DS6A 5FBZA 3KDSE 2NPFA 1WWKA 2CF6A 4J2OA 4L4UA 4YMTA 4H2DA 5HP4A 2C2OA 3JALA 3LUFA 3ZIAD 3VYVA 1A97A 1G21A 3O1IC 2IK8A 4XQEA 2HI0A 3AHCA 4TMVA 5KYVA 1LBTA 1FDRA 3LTEA 4L3VA 5D3MB 4X7RA 4Z99A 3T9CA 3LCMA 4EKEA 1CQWA 2VWQA 1JVSA 4HPJB 3HHEA 2BFNA 1HI9A 4KQ6A 1L5KA 1D2CA 3CUSA 4YI3A 3U2QA 3HJBA 4E22A 4BZXA 3E82A 1EZ1A 1JI3A 1DEAA 2GPBA 3HBMA 5TQ2A 3AG5A 3VPGA 1W4BA 1NW3A 1V4VA 4L2IB 1NLZA 3KXKA 2QXYA 2LDBA 2PBRA 5AXBA 3ZWBA 4JCCA 2OCLA 3U3MA 3GJZA 5B30A 2XHEA 2ZYRA 1EX9A 4Y2VA 1KQPA 4G0NA 1SD2A 4V3BA 1NE7A 3A1FA 1BFDA 2RI6A 4GQAA 1R6BX 1Q20A 1OV6A 1Q83A 3VYWA 3MHPA 1GLNA 1WSDA 4CN8A 1U0GA 3NHFA 4F2GA 3GPIA 3QKRB 4JLMA 3R3ZA 2NUTB 5HIIA 2P41A 5E3IA 1UKEA 5KNCH 1PR3A 2R87A 3DBHB 4WA7A 3WZ2A 1NBIA 3Q10A 3CEAA 2ZI3A 3BIOA 4HNAA 5GOZA 4CLHA 4F3NA 5J2TA 4GKJB 1HR0B 3ZJVA 2IP4A 5IJ9B 1EEHA 1RJ9A 3MRSA 1SOUA 1IIBA 4TTVA 3UJBA 4H1WA 1EP3B 2B1IA 2EF0A 2Z83A 2FX3A 3ZIUA 3U80A 2JKVA 5I47A 5C81A 1FYWA 3ZWVA 4BNKA 3ZCSA 1P4SA 3N05A 1TUEA 1SG9A 1X1CA 4YCDA 4R0MA 5AVWA 2J3KA 4LNUB 4KZPA 1OD6A 1R8XA 1C9YA 4DYHA 3DE3X 1TK3A 2GEVA 5AK0A 2HCJB 1TNDA 5FL7D 5JPDA 4LJ5A 1AHIA 3B6KA 4XX0B 4RPKA 5D87A 3ZZ0A 2GVNA 2VZLA 4ENUA 1PT5A 3GRCA 2X4IA 3EGVA 1NJ6A 4HDRB 3GLHA 1WRBA 3TH5A 1N3IA 2C77A 4G5FA 2Y2UA 5CBKA 4L73A 2DUUA 2OORC 3AYXB 3G88A 3AGPA 1GDDA 3ZCTA 2VAPA 2XNSA 2Z9CA 3A9RA 5ECWA 1IJBA 1JLLA 3CG4A 5H68A 1KA9H 4HSGA 3CR7A 1EJBA 3EDMA 5L8VA 4MUYA 3K9FC 2N9UA 1C1XA 4YRCA 1E2GA 4CKWB 2NVUA 1DADA 1GPLA 4QATA 3TSWA 4BZZA 5CD9A 3WLMA 2IYNA 1ZJWA 4LXUA 1SU6A 1EG2A 2BMAA 4Z0TA 3UAGA 1NVKA 1WPXA 3KEFA 2A4KA 5HKKA 1A4IA 1UF9A 3JTMA 1W0JA 2X0JA 1HH4A 4US0R 1R4NB 1BRMA 3D6UA 3M1IA 3EX7C 3A9TA 1T8RA 3BC1A 1XAHA 3B13B 1TADA 3OZEA 4KVGA 2QYTA 4OMDA 5JO9A 5KJEA 3ZW8A 2DPYA 1OX6A 1M7HA 3TPCA 2F8TA 1RACA 2C8LA 2CXPA 2DSTA 3H3XA 4FMDB 2HQSA 4K88A 5U4QA 3VRHA 3GG2A 4R81A 1UFRA 2P62A 1QRAA 4OHUA 3K7EA 3DOUA 4MQMA 4AURA 1P4AA 4B79A 4D8UA 4QXPA 4W6QA 2GGSA 2I3GA 2NSYA 5B1EA 1AX9A 3HWWA 4FNMA 4JDPA 1NV9A 1X80A 3VR3D 1TTTA 4GKAA 2NVBA 3HUTA 5IBCA 4ZI7A 2JHGA 4NK5A 2DVMA 4Y9SA 4MRSA 2PZKA 4KYVA 2PD6A 3ZBTA 3G1WA 1H93A 2I6SA 3NOQA 4QPZA 2XB8A 3VHXA 2E55A 1OYYA 1TFUA 3BMNA 4RD3A 5ALGA 4QRIA 1KI9A 3ILHA 3TNFA 4M89A 1ENZA 4IIXA 4L5BA 5EZYF 5AW1A 2G83A 2G76A 2Y9PB 2I1LA 4ZZ2A 1Z6AA 2WT9A 3IDSA 3JYQA 4A6EA 2WABA 2HTEA 1V16B 2P6PA 4IKPA 1WXFA 3D4IA 3N0XA 4ENRA 1LPOA 5CT6A 2V4ZA 1Z34A 2OV4A 4MYHA 2ZJZA 4QODA 1EE1A 1WHSB 4QREA 3UOWA 3KOYA 4F9EA 1T5LA 5FFMA 3SR4A 4AJNA 3VR2D 3NIDB 1UK6A 2IT1A 1BEUB 4P98A 4Z7QB 1QHFA 1EVKA 3H4IA 1JSXA 1NRWA 4X5OA 3HKEB 5CVEA 5K3DA 3WSWA 5CB6A 1ZGBA 2W43A 2WIKA 3NBUA 1TJPB 4KAJA 4GVXA 4AZ0A 3VNQA 3G0IA 3K9QO 4IOLA 2C4TA 2R2AA 4E08A 1L8XA 2IX3A 1NNEA 1KOLA 3STXA 1OFVA 2XKBA 3VR4H 4CQNA 1Q14A 4HUQB 2P0EA 2QN3A 2UKDA 3RVPA 1NPTO 5KDOA 3NAZA 1H9BA 1TQ8A 2AI1A 2ZANA 1SBYA 1PZHA 2PGJA 1U9ZA 3ITNA 1VL5A 2TMKA 2QT0A 4MAFA 4RETA 4EAAA 2BH2A 2CBXA 4BO3A 1P7ZA 3CF4G 4O6VA 1AK1A 2V7PA 3FZEA 2C7VA 1H1DA 3HU2A 3CLRC 2FUG1 4B46A 5A05A 1FU7A 2ORIA 2IOFK 5JNSA 3ZGVA 2NYAA 4KQIA 7MDHA 4R2LA 5ALMA 4AJKA 3FGPA 3SSAA 1I8TA 4L15A 5EHXA 2WD8A 1H8ED 1EM6A 2CNLA 2WF6A 4HGQA 4F71A 3U7HB 3ZUPA 3DMPA 3QUAA 1G2IA 2IXBA 4P82A 2WJAA 3GQBA 4DCCA 2OPHA 4Q1CA 4MIOA 2Y1EA 4CM8B 3W6OA 2CD7A 3G0GA 2BRUA 2BV3A 1TA4A 2ORWA 4JQSA 4M83A 5EI5A 1I0ZA 1N6OA 2BFEB 4LJKA 2QLNA 4GX0A 2I29A 2Q99A 1CS4C 2ZI7A 3KKEA 2GA9A 3EF3A 2VUHB 2LWIA 1OWOA 2RKOA 3G82C 3LDHA 3V1NA 3ZOZA 2Y27A 1FMFA 2E87A 1OBHA 4HAXA 4BE9A 3P8ZA 4DIMA 2QVYX 5K4HA 1NUAA 2XCIA 3ZY6A 5HOQA 4H1HA 2Y1CA 4XYGA 4EEXA 4MS4B 4DR5B 3SR0A 1XMSA 1LDGA 3MC1A 1OFIA 1Z2NX 2XIJA 3P5SA 1JF8A 4D99A 1EM8A 3DFUA 5A4IS 5HX7A 2A1TS 1MHTA 3DBLB 1Y6QA 3PRHA 5FJJA 3AETA 4LHXA 2YRFA 3HGTA 2O1SA 3MELA 4Q4LA 3UJPA 2JIDA 1A72A 2WWGA 5DFAA 5HJ5A 4ND5A 2OV3A 1RWNA 1GPNA 1KYTA 2JBHA 4I5DA 2XZOA 1XOIA 3H8VA 1X7HA 2BFAA 3THSA 4B3JA 3STWA 2GOYA 2M6RA 4J9VA 4DT1B 3A6EA 1UKZA 1S3FA 1ZMXA 5BPHA 1BXRB 2A5GA 1I01A 3MIIA 2WIGA 4KSYA 4JQZA 1XCGB 1Z5WA 3KDAA 2B0CA 3RRXA 3O94A 4G1FA 4I4IA 3U44B 4RZUA 4XEHA 5CDHA 3G79A 2VDOB 4KKVA 3LBFA 1MW8X 4JODA 4Z4EA 3UO8B 4F2HA 1BDJA 2CV2A 3NPMA 1KFKB 1ULAA 4UM9D 2BW0A 4N0EA 4K6CA 1LZKA 5AI4A 1NMXA 2PMFA 1KEZA 2GXQA 1UH5A 2QY9A 2VRCA 3FOAA 2W5UA 1HMPA 1KJ8A 2WPNA 1QK5A 3FG9A 1DC6A 3B82A 3CSDA 4BFXA 4B48A 2HIMA 1SUAA 1O6CA 4MAMA 3U31A 3ZGYA 4JMLA 4KXLA 2VP9A 2PL5A 2YIJA 1TMGE 1Z8DA 2WF5A 4W1RA 4J0DA 4DADA 4DJDC 5BN3B 4IJVA 4HVLA 1WABA 3UGTA 1H4VB 1TYCA 5AOVA 5HQ3A 5KTRA 1S2IA 5UKDA 3U5ZB 4MRMA 4ZDJA 1OMOA 4QGGA 1T6ZA 1JAZA 4I5IA 4D9FA 1GTG1 1ZEJA 2WLTA 3KT0A 3Q40A 3MWEB 4KN5A 1DBWA 4NDZA 5AW2A 1NMZA 4CM7A 4KITB 2MU1A 3MJHA 4JVLA 3HCOA 2XOKA 4W99A 2L0XA 2VDLB 4ZI5A 4LXQA 2CDBA 5JYDA 1P3DA 1M1YB 2GZAA 2VUUA 1RRMA 1ZGGA 1X7YB 3SY8A 4DLKA 3LUAA 5L3QA 1U8CB 3ILVA 4K9DA 3HVJA 5AW8A 5G1OA 3N2GB 1NC3A 2Z8XA 1IN8A 4W1QA 1IUOA 2YN2A 2H2IA 4JU8A 4LXIA 1C4KA 1KIFA 1NYQA 3ENVA 1XP5A 2GCNA 1NZJA 2ZBVA 1JHMA 2WU1A 2LTAA 3AEYA 4PO1A 3OPYI 3CZCA 1LQ2A 1VJ1A 3FFBA 4BMSA 4E4RA 3KL2A 4L75A 3V4RA 1TAHA 2O3JA 3F7NA 4TOIA 3QPAA 5HF9A 4ZANA 3UK0A 3N8NA 2J0SA 1UBFA 1NXTA 1COWD 5B3KA 1IZYA 1DARA 4DLBA 4AG6A 3THXB 3C43A 3EZFA 3V32A 3FYUC 2YXBA 4JJEA 5JZVA 1QFYA 1USKA 2YWCA 5KYXA 1DBSA 3IAAA 5BWNA 1CYDA 4FGKA 4LJ6A 1SXJA 4QQKA 1D2RA 3AEZA 1KRXA 2JHPA 3DDSA 1JHUA 1B8NA 2NW6A 2X15A 3LLVA 3TLKA 3K1AB 1CR2A 2X4DA 1RHQA 2R8ZA 4YDRA 2OBFA 4M76B 4Z3DA 4PRLA 3WJ1A 3SYLA 2M32A 1DBRA 2DHEA 2KQUA 4H3HB 4M6WB 1KIMA 4EX7A 4DG8A 4CG2A 1CUVA 3TG2A 4QM6A 1Z4PX 2CBZA 1JJ7A 5KTMA 2G09A 1RIIA 5JMPA 3PS9A 1ABFA 2V8OA 5DGDA 2EOAA 3SDZA 1K8RA 1OILA 2AOUB 2RIPA 1QX4A 4IQ8A 3REOA 4Z49A 4IX9A 1CJTC 4JQCA 1WOYA 5JOQA 2F8SA 5MFZA 4C6TB 1G291 5K0ZA 5K8TA 2AKYA 1MORA 4X8OA 1V6CA 3H83A 3FNGA 3TQTA 5JANA 2MJLA 5TR9A 5MGBA 1RFGE 1VIDA 1UDBA 1QQAA 5F7OA 3OM8A 4JX9A 1GCIA 2YWDA 4MKIA 3WLOA 2PY6A 5A7GA 2P30A 4HQ6A 5HXAA 2H1OA 5ED0A 1C29B 1TF5A 3ZYCA 2PKWA 2GJKA 3G7NA 2QJWA 3S1LA 2A14A 1Q0TA 1U2PA 3LSTA 4OYYA 4WEOA 5HWSA 4L9RA 1TYEB 1ZD1A 3IEUA 3KAJA 4HI0E 3GT3A 4HXGA 4JBNA 4B34A 4HTFA 1DG1G 1IUKA 2AE1A 5TQ0B 4BL5A 2YUTA 1SCJA 3CRNA 5AKXA 4P80A 1XRQA 1I3OA 1QU3A 4BVFA 4RTSA 4BX2A 3EYWA 3L1HA 1VPWA 5EJFA 3TLGA 5K8CA 4C4RA 1GAEO 3W1VA 5JS8A 1J1UA 4H0NA 1KQFA 4MUIA 3W1EA 5F9HA 3Q41A 1AXRA 3S7ZA 1QSGA 4TTTS 5ERGB 2HPZA 3WYBA 4JR0A 3ZDZB 3WG9A 2A1IA 5FIUA 2O6LA 3I8XA 3EZGA 1CUCA 3C4VA 4BV8A 2HJSA 1ID1A 4MWEA 3DUFA 4LOAA 5FP0A 1SXGA 1UFQA 1VKZA 2CUZA 4TMKA 3WGIA 1EBUA 4N18A 3WL7A 1U11A 4P31A 3LLUA 1W49A 4OAOA 5IABA 4PG6A 1YKFA 2AMJA 2QD2A 1BH2A 3B60A 4I9UA 1KKMA 4LY0A 4R68A 3EDRA 4JA0A 4RV9A 4W5WA 4PR3A 3ZDFA 4EYQA 4EI2A 9ATCA 5EJ6A 3HN2A 5KSYA 4KE7A 1KPGA 4MS3B 2QZPA 1P2GA 2RIRA 5FLYA 2FZWA 1ADJA 4ZVPA 4BVAA 4BX9A 5FDFA 3SBEA 3WK5A 4AP6A 4UHJA 1RI3A 4YRRA 4CIDA 5KTSA 3HXQA 1KU0A 5G1PA 4W5RA 4I1PA 4U7JA 4Q4JA 1K68A 3Q8WA 2GPJA 1JLMA 4XB1A 4UNSA 4UHCA 3A4TA 1UMBB 3VX4A 2ZRPA 5I7OA 1GRNA 4H27A 1X13A 5EXSA 4Q3OA 4YUYA 5CB4F 2EG9A 3T12A 1CLEA 3HSSA 4PXYA 3ZWCA 1PR6A 1JXAA 3I6BA 2D3TA 4Q9IA 1IZ8A 2A92A 4UTVA 5COBA 1MQ9A 4BFTA 4S04A 5SY9A 1T0HB 4ICIA 3VZQA 2HL6A 4WKNA 4Z7NB 4JBXA 4KO1S 1J2JA 4YDSA 2F43B 4DNFA 5JZ9A 5EUMA 2COUA 3F6BX 3MQ4A 1FUUA 4F6CA 1N4AA 3GYGA 2JLBA 4J94A 5BSRA 5BMVA 2UU9B 2VHUA 3PENA 1BHJA 3ZCPA 4DTIA 1HXHA 2H07A 2VZ8A 1UZLA 3WDSA 3I64A 1JEOA 1ILWA 5AI5A 1M6VA 1Q1QA 5DIZA 5E3JA 5FUWA 4FKBA 4P08A 1G8FA 4V0SA 1U2DA 3Q0IA 4BN0A 3IVGA 1N2CE 4EOGA 1R0WA 4PLTA 3T35A 3DNMA 4PFSA 1FJ2A 1GTMA 4TV9A 4IHJB 2B2CA 3MEQA 3P20A 1J8DA 4QDZA 1XTQA 5JZBA 1LF0A 3LV8A 1DC3A 3DGEC 2QPLA 4PZEA 4C0LA 1J5EB 2J85A 2I87A 1Z36A 1IN7A 1AUPA 1H2AS 2VQ6A 3MJ4A 4U02A 4AS2A 4GM0A 3NVAA 5I4CA 3G0HA 1CVRA 4QL3A 2VDRB 2V4MA 3C7AA 2HRRA 1OAOC 1SVKA 2C29D 1ZD2P 2MMCA 3EEBA 2ODPA 3FYHA 1VHJA 3L6RA 5CYOA 3FHJA 4AYTA 2TYSB 2JRLA 3HH8A 4LTNA 1W0KD 1F0YA 5K3SA 3UIEA 2PX0A 3FZGA 1KBOA 2RK6A 2CZGA 3R77A 1N92A 1XD8A 2ZATA 4DPKA 1KF0A 4ZEOA 2P2CA 3LY7A 3QMWA 1YRWA 1YRHA 4MWOA 4F4FA 4RTMA 3HABA 3OX3A 5ARBA 4J0QA 4OJKA 4KWTA 4FX5A 4PYMA 2V7BA 4OOFA 1H6CA 1NJ1A 2FUKA 1VHWA 4DLTA 2A9FA 2Q5IA 4US2R 2A58A 1W5SA 4F8YA 2UVPA 4PYJA 3IA7A 2A59A 2MSCB 1QDUA 4ZT5A 4EI7A 1ZM9A 1PJTA 2OBNA 1P3JA 1YQGA 3DMGA 2HBQA 2D5LA 5AM3A 1IBLB 4U6QA 2VJBA 3L07A 4YVFA 3V7YA 1AKYA 3EC1A 1M1NB 3JVUA 2QX9A 3L82B 4PAMA 5DT2A 5EXPA 3VMMA 2WIBA 4NR0A 2BSXA 3NH9A 1BE0A 4PFJA 1PL7A 4LNHA 2ERXA 1K7XB 2ZRJA 3GWGA 5L3VA 1L5OA 1VPEA 4PX2A 3QVGA 4XWYA 4KN8A 1XL1A 3K0CA 1P2TA 2RG7A 1ECBA 1OZAA 2Q3BA 2EG5A 2QVZX 3E7WA 2RGNC 2WU3A 1MCZA 2VLIA 3CH6A 1UBUS 2O9JA 2JD2A 2XW6A 3NHBA 3ORRA 3D54D 1E77A 3P9ZA 3G5MA 1BJKA 3F4BA 4UTXA 5BNFA 2ZTSA 2DBZA 1CY8A 4ARUA 2IH2A 5AD1A 5KWSA 4YCNA 1W4CA 3RROA 2EZ9A 4QWWA 5TEVA 2QL7A 1NWHA 3HVHA 1KSJA 3JQCA 1B6TA 2OCYC 4AI6A 4MUKA 3VO9A 3OURA 3FLAA 4MB6A 4HAZA 4QU0A 5E8JA 3IC5A 4PN7A 3VPXA 2CXOA 3N75A 4OB7A 1DOZA 2PQMA 3AY6A 4Q0MA 2ENUA 3TLXA 2EFEB 3IOEA 4B7ZA 4M38A 2OZPA 3KEGA 2G40A 4ND7A 1CYEA 1U98A 2ZSBA 3ZHXA 1J0EA 4LISA 4I9HA 3PHCA 4OKIA 4ZGGA 4MLPA 1S6YA 2ZXFA 4J4HA 1ULTA 5LP6C 4N48A 1ZO8A 2GDZA 4CM4B 3ABIA 4M53A 3V48A 1XMQB 1UJ4A 4E30A 1F2DA 1EAYA 1SB8A 2R4TA 3U4MA 3GDGA 2GXSA 2PRKA 2GM3A 3JATA 4FJ0A 4MVJD 2MYTA 3OMXA 1BWSA 3NDIA 1MRSA 1Z7EA 4NF2A 1HYBA 2H57A 2W6ID 2PU7A 3MM4A 2WMYA 3TAHA 2I6FA 4BQFA 3QP9A 1PF7E 4H7IA 3RV4A 4BLSA 2C1XA 1FTYA 3FYUB 2O0HA 3KX2A 2A88A 4EQ6B 1KIAA 2CVHA 2WV9A 1OT3A 3T1OA 2W2VA 2V7QA 2FXIA 5FCDA 1BMDA 4DUGA 5MN4A 1NM5A 2CE7A 1DJLA 5AXCA 1MX3A 2FSPA 3EXIA 1L7EA 1WVGA 2SCUA 3ZD9A 4A6DA 4BGUA 1GZUA 4DE5A 4ALKA 3UPUA 1OJLA 2BUCA 2IY8A 5PNTA 1W0CA 1X92A 2ZVPX 3SJZA 1T3HA 5F64A 1F5NA 2I67A 2UYGA 4INJA 5KPJA 1JQBA 3MGBA 3KPVA 3TD2A 3UJCA 2IPNA 3EOBI 1C81A 1YRYE 2BI7A 3A4IA 3OCCA 2OY0A 1J8QA 1PSWA 1CZRA 5IUJC 1W4AA 2PLNA 2RB4A 2WJ3A 3I34X 4G0XA 3SZ3A 5G1NA 3ND5A 4DQUA 2VWGA 3EZNA 4B6PA 3X1JA 4J7UA 4FHZA 4LSGA 4BLUA 3H5VA 2ZUFA 3QY0A 1KVUA 1QCCA 2GYUA 3IP6A 4KMRA 4QYIA 5D2CA 1HTTA 2DQZA 3HKCB 4O1HA 1YDGA 3W8DA 1ZVJA 1UJCA 3TUJC 3WNZA 3AUFA 4U00A 2BSQA 2IC5A 2AJLI 1F51E 2QRJA 5H82A 1L4YA 1W75A 2OCAA 4OXRA 5K01A 4DM4A 1YZQA 1BN7A 4AQYB 3CT6A 1FW8A 5TPWA 4D82A 3TJRA 3KVYA 2VP6A 1E9FA 1T6XA 2IXDA 2WD9A 1HO3A 1OXBB 1TTPB 3ESCA 4WLFA 1IN4A 1CQXA 3BRWA 4Q1DA 4RCYA 3SZRA 3TXYA 2QQFA 2WA1A 3WO1A 4DLYA 2P1ZA 5DYIA 2DFPA 1EU1A 3TTSA 2W37A 2R1VB 2DHRA 4TMYA 3ZY4A 3LOUA 1BWPA 4L4SA 4Y2TA 5JSHA 2YJGA 2EQBA 2XRYA 2GRUA 4PG7A 1MIHA 3NFYA 2UZ1B 4Q47A 1CRZA 4M1TA 4XCXA 3MT9A 4IV5A 1MA0A 1H2ZA 4MMYB 2OTCA 2R6JA 1VG8A 3LCRA 4BX3A 4ZEXA 2PUAA 1K75A 4YCLA 4JI3B 1W1UA 5JXHA 1M66A 1E59A 1JP7A 2H2GA 3BGVA 3EFHA 3TJZA 3KKKA 3QGMA 3VSEA 4AMVA 2Z98A 4ID3A 4DA7A 4AF7A 1WU8A 4I2NA 4ZAVA 4AUKA 4E1VA 3R6TA 3UY4A 1JIUA 4FLEA 4CDMA 4TM8A 2ADFA 5IDWA 1ISSA 5JNWA 1KSHA 3MJSA 3HDGA 3N74A 3BZWA 2ZRNA 2RC5A 1QTRA 4IEEA 1UPBA 1S2GA 1IZ7A 2EQAA 1TVKB 4RLSA 4JOQA 3GLFE 1POWA 2O8CA 4NBVA 1X14A 3L7OA 4J0EA 2C7PA 1RXIA 3L8DA 4N8SA 1ZD8A 3CX7A 2P9JA 3E4DA 2NSHA 1LH0A 2OFPA 2GPTA 4GMFA 4MIEA 2CK3A 5J2UB 3ELYA 4OQLA 4ZC8A 2F1HA 3IP7A 5A6SB 3DO5A 4ZOEA 4JR2A 1PU2A 5HQTA 2VHVA 4C4YA 3HCDA 3N76A 3DZBA 1E9SA 3CEMA 4EG8A 4E5MA 5DI9A 2J3DA 3KJIA 1G21E 1GGFA 5K3BA 5DPMA 3ZHCA 4G85A 4CQMA 4R69A 2IQIA 4HMOA 2WKWA 3FPHA 3QBDA 1XNGA 4G65A 3JZFA 5JCXA 1MXHA 3NHZA 3E1KA 2CE2X 3AH8A 3HUUA 1TL7C 3M3HA 3EXHA 3Q72A 1YKGA 1P2UA 3ZH9B 3CRVA 3ZE8A 4B76A 1FZQA 1PZMA 3FN4A 3RC2A 1GQSA 2QRZA 4S2EA 3VZSA 4TL9A 1F14A 5C37A 3I6IA 1HDRA 1UADA 4IX1A 1WXDA 3DDUA 3ZDXB 4BP8A 5CVCA 5EN4A 5KI6A 2O5RA 4D41A 4DS3A 3L5KA 2HEIA 5AICA 1EB8A 2A0FA 3HJHA 1OLUA 2Y1LA 3C8UA 3B38A 1M2VA 2CLSA 3GH3A 1NIPA 1XD9A 1IK4A 4P4UA 4YJHA 1GTVA 4IDCA 2WVHA 4ZYVA 1KI2A 3I92A 2PXHA 3W0LB 1E5DA 3N3BC 1Z17A 4BVHA 1A7KA 3VR4D 1JE1A 2DECA 3RAEC 1OY1A 1RBZA 3DMTC 4YQFA 2PAAA 4ZVRA 1ESEA 1I5EA 5C4MA 4EDHA 3NAGA 5K0SA 1E2DA 3EFEA 2W58A 3U3KA 4PAGA 1BX3A 1YB5A 3TWOA 4AUNA 5THKA 4JA2A 4LXYA 2YY6A 3UKDA 4OQQA 4JUBA 3QPVA 3TVTA 3GUCA 4OUDA 4P1ZA 1DOAA 2WMOB 4FGWA 2DFKB 1ZUHA 5CFLA 5KYYA 1AK9A 2Q2VA 1J33A 2AEFA 4ZCLA 1OTXA 1KZYC 3QX3A 1NVMB 3FCUB 1CEXA 1NBWB 3F98A 5AM1A 1FNCA 5FPHA 4BNNA 3H4TA 3BMCA 2XOEA 2E21A 4CM3A 3W78A 2GCIA 1FU4A 3GLHE 3CUKA 4MW2A 3FOFC 3D8NA 3LA6A 1YB7A 2XNDA 1VJDA 1GPAA 1H0KA 2WJ6A 2OAP1 5ESXA 5BP7A 3NDJA 4ZPJA 3SQNA 3RUPA 1NI4B 3ROGA 3EIFA 1DCTA 3HJAA 3T99A 3PTZA 1C0KA 1L0BA 1ZH4A 2J31A 3HMKA 4GI3A 1T4GA 4POOA 4CUKA 3GUVA 5EKTA 3WP0A 4KAXA 1FYFA 1GN9A 3HADA 2L17A 1H6BA 5KYTA 2IYFA 2IDMA 2IYVA 2Q1UA 1DX9A 5DWQA 5ELXA 1NFQA 5DTEA 4HYTA 5CJJA 1N78A 4YAKA 1JDVA 1WDMA 1OHHD 3DBRA 3HCFA 3G2KA 1XA4A 4KFTA 4B4VA 3AILA 1DX4A 2J48A 2JANA 3DE1X 5HR5A 2PKQP 5IANA 5LP6B 5KWVA 1VPDA 1UOOA 2LV8A 2QMUA 1TU0A 2FWAA 3DDWA 5FHQA 3WGKA 2HRCA 1N0IA 2VYNA 3K35A 4GYJA 1M2WA 3W77A 4BO8A 1ATZA 4DF3A 1U5AA 3EVBA 3CVYA 3BYZA 3N39C 2PWPA 3UWKA 3BCSA 4DWVA 2ZTVA 2ODTX 1X1EA 2X14A 3HDVA 3MCTA 4GVPA 5K0JA 1V3VA 1I7SB 1IBMB 1B1CA 2MSNA 4RTPA 4LYAA 3AERA 4PZYA 4JVSB 2G9ZA 4JQYA 2ZFUA 4XAQA 5JJBA 3PD1A 2PM8A 2Z1NA 2A57A 4P6VF 3D4BA 5L3RA 1ZOPA 1YI8A 2GWHA 1KYWA 5G0TA 2TMGA 1RQLA 2OHGA 1T2NA 3SQDA 3ZXIA 5GINE 4U2FA 2LCQA 1X1RA 3HJRA 2PLAA 3IX7A 3PE6A 2R2GA 5DVZA 2BKVA 3T7SA 2A0UA 3UUWA 4CL2A 3KYJB 5B58C 2L69A 2GH1A 1AXGA 3MOIA 1I1NA 1SK9A 2DAPA 4Q7MB 3TPFA 3DWIA 2QZZA 4QYSA 4UOQA 1RMQA 3C16C 1JT2A 4KH1A 4XUGB 4FHGA 5CYGA 2PKCA 4CLOB 4R1MA 1AOXA 4A10A 5GONA 3ZWWA 1GN8A 4BMOB 3LY8A 1DT5A 3BKXA 4QXOA 3ZHSA 4CKYA 1QORA 3HVIA 1XF9A 3AU8A 1P7WA 1XLVA 3BXEA 3FKJA 1I6KA 4G63A 3E7XA 1A4RA 1MQSA 1YJBA 2GN8A 2HDWA 4FDUA 4FNAA 4ON9A 3F73A 2QY6A 2LUOA 4EHKA 4QQNA 4EG1A 2XB2A 3T3OA 3RYIB 5D51S 2ZWPA 5AHRA 4N47A 4CEHA 3IQZA 3IILA 2HZBA 5H81A 2J3LA 3IP8A 3OQVA 2HJ9A 2PX3A 3EGXA 1NLFA 1MAVA 2BN4A 1JU3A 5ESWA 2VT3A 1WDTA 3IVRA 4C0SA 5FPQA 2ZI5A 1P5HA 4MV6A 3ZWYA 3IRUA 3C15C 3E22B 2JLQA 2XMPA 3OJOA 4GPAA 3D8SA 4GS5A 4TTRA 2RHCA 4WI1A 5DI3B 3ROZA 1OLSB 3PNSA 3HEBA 3A58B 1WHTA 1OZ0A 1YASA 2X5JO 3H87A 2EKQA 1SKYB 2OYRA 1KMCA 2Y6UA 2GBGA 3IQWA 2BR5A 4FFBB 5I6DA 2NU9A 4PQFA 3B1ZA 1HDYA 3TZEA 5EJ5A 4L8FA 5JQGA 2J3JA 5EKUA 3H2JA 2QRPA 1SO8A 4WX2B 5LDGA 1CF2O 3LSYA 3R3HA 4RF5A 1Z6ZA 5JWOA 4WY8A 1NT2A 2VDWB 4MR9B 5F1KA 5ULLA 1RHMA 2C7BA 4QQ8A 3GXOA 3TX6A 2UXBB 3BQNB 1Z38A 2C9MA 4TLEA 3AYZB 5F35A 3TXAA 3WGHA 2O52A 2I8AA 3QUCA 3O4VA 2HPHA 3AT1A 4OMUA 5DDIP 3Q5EA 2X1MA 5F2NA 2W2KB 1O0CA 1SC3A 2CN1A 2H63A 4NENA 3CPSA 1E9DA 1QGDA 1EP2B 1P2FA 3PRJA 3WK6A 1N3LA 1EFCA 2IV7A 5HTOA 1D2HA 1ST3A 3CX4A 3KQOA 3WWPA 2BE7A 4BGEA 4Z86A 3G6WA 1BN6A 3K2IA 5CRIA 4DCMA 1JEEA 1L4KA 4EVIA 1I3MA 1UJ5A 1MH1A 3QPDA 2FPSA 1T2VA 2SHKA 4NSNA 3DMNA 1FB5A 2R1ZA 2HF9A 1BMFA 2GAFA 1WS6A 1SIWA 3GJYA 1X1DA 1M2HA 4UXHA 2WSSA 3ASZA 4GYKA 3BB4A 1QYVA 2VOJA 4PICA 2YQ4A 4HGRA 2ZUTA 5JDIC 2AG0A 2XYQA 3DLTA 3I32A 3OMWA 4XVRA 2HLNA 3RTDA 1YQ9A 1O4WA 4Y0NA 3SYMA 3FOCA 4F11A 3LLSA 5AKYA 1VM6A 3AESB 4NYIR 1FVXA 3IQDB 4P5EA 5C8YB 3Q3CA 4C6HA 2V1UA 3FAKA 2LCFA 4KV9A 5F2OA 3N2KA 1N7IA 4GH5A 1Y3BE 1E8MA 1PKXA 1JBQA 3CW8X 2VSOA 3EH1A 3F9CA 1JA1A 1KO8A 3OLCX 5AOBA 3VKVA 1J23A 4TLDA 3BD9A 4YMVA 4YT4A 5IX8A 3HP4A 4OCZA 3CN9A 4J7CA 1Z6GA 4L72A 3NT2A 4NHEA 1FTGA 1KETA 3OQOA 1YCGA 4DR2B 3CB2A 2R00A 3DB1A 3KE9A 1IY8A 4JLSA 2FRVA 3H5WA 4WK0B 1QHIA 3JQGB 4OFXA 4RA6B 1U4SA 1ISJA 5DISB 2GN1A 5COAA 2FZLA 5A5GA 1PGJA 1QIKA 1Y5MA 3LKVA 5C4GB 1VE5A 2FY8A 2YZMA 1VGQA 3K2BA 3ND8A 5MN5A 1GUAA 2VDJA 3PC7A 4HYYA 1PR4A 2V45A 3UMSA 2E4ZA 1ZN2A 2VHEA 4OP3A 4W1PA 4RMJA 4LJ9A 1LPBB 1M1UA 3HMQA 1NXPA 3PQEA 2FN8A 3LHFA 2ZWOA 1IPHA 4AS3A 1N6LA 2OK8A 3HDYA 4DJJA 3Q9SA 3RIEA 1NP3A 5FD8A 1GL3A 4C3UA 4CGZA 1L5SA 2O1XA 2WZDA 3DPUA 2Z3ZA 4KQ1A 1T2FA 4R6XA 4Z9XA 4MRRA 4UAGA 4DCTA 3IUQA 1RPAA 1V11B 1WXQA 2FPOA 2I1VB 4TKVB 3TL6A 4YCJA 3IUSA 3TNYA 4AZ3A 1QIFA 4MXDA 2A8YA 2BEWA 1YI1A 1S89A 2GKOA 5TXGA 4Q66C 2OFWA 5KSZA 3R75A 2CGEA 5HZHA 2GN9A 3UH1A 2O8DB 3DE6X 1ORIA 2CLIB 3GLRA 2XKKA 5AVVA 1DHTA 3GFQA 4FBGA 1NX6A 1ZH8A 2D1TA 2PYIA 1RAAA 3C6ZA 3T5GA 4UVGA 3VSAA 2HMYB 4Y9TA 3D2AA 3RK0A 1SQ0A 3RC8A 2XCUA 3ANYB 2Z5VA 1QYDA 3OG9A 4Z9BA 4URUR 3DZCA 2C4VA 3MSXA 4ZMSA 4ES6A 4ZCQA 4I4TB 5BRAA 1E4EB 1N3BA 2ZZNA 2YWHA 2GJSA 1LFDB 2ZKIA 1GKKA 3CKYA 3DZFA 2H0RA 3GJ5A 2PEZA 3DEHA 2ODAA 3LHDA 4NNJA 2KHZA 3TXXA 7ABPA 5JCOC 4X97A 1Z7GA 1FTNA 1KBZA 2JJ1A 5CK4A 2HDOA 2J9FB 1YVRA 2O2DA 2VTDA 5LQUA 4PQGA 1XZJA 2YZGA 2ZI4A 3ZBPA 1I2CA 5HK8A 4DRXA 4GMKA 5ESDA 4X85A 3BWDD 4GUAA 3AFMA 1P0PA 1YUBA 1XX6A 5E6RB 3T0GA 5A9SA 3A4MA 4EITA 1VXOA 3OFVA 5SZIA 1SXJE 2OZEA 3T7RA 5KTPA 2VSYA 5HA5A 3WL6A 1OV4A 3NOXA 4U7DA 4X45A 5DO9A 1N8TA 1J0CA 1UBGA 1MX5A 1PL0A 1FBNA 3BDAA 2JGKA 1E1RA 1RWKA 2P4HX 4KDCA 1HDEA 4RJJA 2IYPA 1O96A 1WUTA 2BHRA 5CNIA 4MRPA 4UTOA 1A2OA 1XDGA 4IOJA 1KYZA 4PCLA 4L4ZA 4BFYA 1A0OA 3FVWA 4XD7D 5EXTA 2B8NA 1OLXA 1CD5A 1GGVA 4EPVA 2KWIA 2AS0A 2B1JA 3B1WA 5DGTA 2IGTA 3EEFA 3WRYA 4IZHA 1HA3A 1KQ3A 1XCBA 3BXHA 1JQLB 1PG2A 4LI0A 4BWYA 3HXPA 1P18A 5BVHB 3TW8B 1Y1RA 3FHLA 1MJNA 4GAEA 1TKCA 4C3ZA 5JEDA 2VSNA 4XGQA 1ETUA 1ZK1A 1IUNA 4HWSA 5FQNA 5GOTA 5KWEA 2YRXA 3SBXA 3DOCA 5AVRA 3T06B 3TW0A 2D00A 4OL0A 4RCZA 4XJXA 3CLHA 4JGIA 2XGSA 2XBUA 1M83A 3OESA 4Q4HA 1U28A 2VHTA 4MSUA 4FN5A 2MSLA 3ZXYA 3P0EA 1P19A 1PWEA 3MD9A 1GM5A 1NQVA 2C4WA 4NYJR 4LK3A 3TR0A 1A76A 3VJKA 5JE8A 5ALSA 1ZC3A 2ZBRA 3FHTA 3QE0A 3DXYA 4G0MA 2ETXA 1GGHA 4LV6A 1YC5A 2WF9A 2Z3VA 5IBQA 2ZYWX 4DUZB 4A8JC 3W3AD 1QR6A 3P27A 2CMKA 1JI0A 4JBWA 4MCIA 3SF0A 3U26A 2EZUA 1LGYA 1OAKA 3J81A 1MN6A 4IR7A 4TV8A 3N7TA 4IO0A 1HE5A 2C7GA 4CWAA 3GAAA 4MPTA 4QTUB 4FUTA 4XA8A 4PG8A 5CH5A 2QBYB 3ROMA 4MR8B 4KIWA 3WYNA 3H99A 3A27A 4HADA 2JFVA 1A9SA 2Z5LA 1BXZA 5ERYA 4N5DA 3Q3EA 1I7DA 4K0KB 1WPRA 4FYPA 2AA3A 2JAXA 5GJVC 5L4SA 2FSVC 1I6LA 4KXYA 2O59A 4ZOAA 4R1NA 1TJ4A 1ZBDA 1T8WA 3EPKA 4MUFA 4WASA 1QH1B 3HBFA 2QPAA 4XDHA 3TO5A 4HLQB 3BK1A 1MOPA