2NT3A

Receiver domain from myxococcus xanthus social motility protein frzs (y102a mutant)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
SKKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRKLKAHADEAVAKPVDADQLVERAGALIGFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An atypical receiver domain controls the dynamic polar localization of the Myxococcus xanthus social motility protein FrzS.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Signaling protein
molecule keywords Response regulator homolog
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nt3A00
2HQOA 4FE4A 3GRCA 2FMKA 4IMJB 3KCNA 3N6VA 3OLVA 4TLLB 3N0RA 1MIHA 5KI6A 4EUKA 1JF8A 1YMVA 3JY6A 4N47A 4RXMA 2HQBA 1FFWA 3UKJA 2VK2A 1EHCA 5TQ0A 1BVHA 1CYEA 3QX9A 1DRJA 1EWVA 1PEYA 5IUJC 3O2JA 4IRXA 1CEYA 4MQFB 5JS1A 1OXKB 1LBIA 2XDYA 4PEVA 2CHFA 1CHNA 4RKQA 4OTZA 3JPWA 3HCWA 3ILHA 4RZSA 5IULC 2HJ9A 3KS9A 2CWDA 3FDFA 3JVIA 3L6UA 5IX8A 2H0AA 4YRZA 1JDNA 1JYFA 1B00A 3K4HA 4NV3A 3GV0A 4ETNA 2FEPA 3LUAA 3H5WA 4TMYA 4L4UA 3HS3A 3O1JC 4MR8A 4PE5B 4FB4A 1ISRA 4LE1A 1DZ3A 2PKXA 4IF4A 1Z18A 3IP9A 4IILA 2JVKA 2FQXA 1OXBB 5IEBA 3H6HA 1NXTA 5DLEA 2OQRA 1W9HA 1QNLA 3TB6A 1F51E 3G1WA 5TQJA 1ZGGA 1JFVA 4D6XA 1ZESA 4TN5A 3HM9A 4XXHA 4YCSA 2GX6A 3I5AA 1EWKA 4MR9A 5EWMB 3LKBA 3L49A 2E4XA 2WJAA 3CNBA 3OM0A 1M5TA 1MAVA 4G86A 4XASA 4EVSA 3SM9A 3E61A 1TJYA 5TE9A 5DCLA 5JNUA 4WWHA 5DTEA 3T8YA 3H1EA 4EYOA 2R4QA 1P8AA 4MS3A 2FVYA 3RVNA 1JHZA 1QP7A 2WWVD 3R0JA 1MB3A 2LUOA 5BRAA 1D4ZA 4MGEA 4H3HB 5JNWA 8ABPA 3CU5A 1FFGA 3LUKA 1ZHHA 2JRLA 3NHMA 2PUCA 5EWMA 2P4UA 3T38A 4TLMB 2QSJA 4W5NA 3B2NA 1DC8A 4MR7B 1M5UA 3Q9SA 1NY5A 1EWTA 2JBAA 2A9PA 2HQRA 3CLKA 3KLOA 4WUTA 4LRQA 1Z26A 3MQ4A 2FTKE 2BGGA 1DG9A 1Z2EA 2KYRA 2PAFA 4NICA 4YP9A 3RVPA 4KNYA 5FWXA 4N0PA 1VRVA 1QKKA 3A0UA 3Q41A 4ETMA 3GBVA 6CHYA 3G85A 1APBA 2HPHA 3LKVA 1DRKA 2PLNA 3KJXA 1E6LA 3RVQA 2FQYA 4ZMRA 4G0ZA 2ZAYA 4KK3A 3LUJA 2IDMA 1VKRA 1P6QA 3HUTA 3NNNA 3KG2A 4HNRA 1GCAA 4DN6A 1YK1A 5B3JC 5HM6A 3UK0A 5IC5A 2MSWA 2LPMA 3DGEC 3ROTA 5TPWB 3DZDA 5ED4A 2QU7A 4RK5A 4F8JA 2M1ZA 3JPYA 5T7BA 3BILA 1PNRA 2FLWA 3H5LA 5IBQA 4LDAA 4Y9TA 1JFTA 4HNSA 4KREA 4N41A 2QZJA 5FWYB 2FN8A 3KHTA 1E6KA 3HJFA 4Z4HA 2W42A 4KMRA 4PICA 3OLWA 3CKMA 2QW1A 3ILYA 4E7OA 2VUIB 3HDGA 3Q7RA 4RY9A 4S04A 3HXMA 1GUBA 4W5QA 4RS3A 5E3JA 3T95A 3K9CA 4N03A 1ZITA 3CHYA 1ZVVA 3C3MA 3H5OA 3MF4A 1JLKA 4QYMA 4RK4A 3RVSA 3F73A 2FKAA 4Z4EA 3FFXA 3OMWA 1M2EA 4Q6BA 2IPMA 3GWGA 3H5TA 1USIA 1C0EA 1BA2A 5BQ3A 4F11A 4EY3A 3KKEA 4O1HA 4YR7A 3CRNA 4UHJA 4JB2A 2WB4A 2JVJA 5KWSA 4G0XA 3EDCA 1PHRA 4W5RA 2JK1A 2OENG 1YTUA 3FFTA 3O1IC 3CS3A 1H9CA 1RPJA 1U0SY 2I6FA 9ABPA 6ABPA 1USKA 4JA2A 5JNTA 5KQGA 5EWLB 1QO0D 2A9OA 4HYEA 1ZY2A 1RZRD 3M6MD 4HNQA 2TMYA 1E2BA 2NZUG 4D74A 3Q15C 4ZJPA 4QYWA 5JS2A 1A0OA 2B1JA 1U8TA 1YVUA 3H1GA 1W25A 3CFYA 3GL9A 1M2FA 1PEAA 3NNDA 4H60A 4Z0NA 4MR7A 2AYXA 3FMVA 3TD9A 5KQMA 3TX6A 1JH9A 5DGCA 2PUDA 3D02A 1KRXA 2IYNA 2E4YA 2E4WA 2R47A 3OO0A 5KC8A 2MYTA 2LBPA 4RSMA 3LUFA 5HQJA 2FMHA 2QR3A 4RU1A 2Q5CA 1KRWA 1D2AA 1USGA 4YLEA 3C6QA 2VYCA 4KQCA 2WY2D 4MQEA 1VPWA 1GLGA 3OLXA 4G97A 2F8TA 4MS3B 3IP7A 4RK6A 4WZZA 3UUGA 2JB9A 1DCKA 4Z99A 3JTEA 4Z4GA 3CZ5A 1EFAA 1BAPA 1PUXA 1Z15A 1D1PA 1DBPA 3C3WA 2QVCA 2IOYA 2IPNA 2QXYA 1UDRA 4MS4A 4G0MA 3RH0A 1SRRA 3EQZA 3IPCA 3I42A 1Z17A 3EULA 1BDIA 4W5OA 2FN9A 4RK1A 2GI4A 5EWJA 1A2OA 1NXSA 4KVFA 3EGCA 1BDHA 1AB6A 3QLUC 2PJUA 4FE7A 4G0YA 3IPAA 4KQ9A 3A3KA 5CNKA 2FMIA 1QO0A 1L5ZA 3GT7A 2ID9A 3RVOA 2E4ZA 2GKGA 1DCFA 3HUUA 3O1HB 4F06A 1FQWA 3F6CA 4NQRA 1MB0A 3EODA 5D2CA 2FXIA 4MRMB 2L17A 2IPLA 1AB5A 2RJNA 1LJUA 5HSGA 2R25B 4JP1A 2HSGA 3I09A 2YHAA 4YGXB 4ZPJA 3SAJA 5BR1A 4N0QA 1LBHA 4UHKA 1ABFA 2LIVA 5JNRA 3CG0A 2WRZA 3O2SB 2GWRA 4OBBA 1Z16A 4OATA 2PUEA 4Z4FA 2MYUA 2PE5A 3BREA 4MQFA 1TVMA 3H6GA 3OQOA 3NNSA 3C3KA 4RK0A 2GBPA 5TQ0B 4P1ZA 3MMNA 4IGAA 3M9WA 3OLZA 4RV5A 3P9YA 4P98A 4EVQA 4YV7A 4MS1A 3M9XA 2NT3A 3HZHA 1YK0A 3T6KA 1U2QA 2IPAB 5EWJB 3QLTA 2JVIA 4QICA 1DP4A 3HV2A 5CNIA 3O21A 1ZN2A 1SD5A 1Z2DA 1ZDMA 4Z4IA 5F64A 1QQBA 1LJLA 3NHZA 3O2QB 4LE0A 4MAAA 4O1IA 4XAQA 4W5TA 3MA0A 4G0QA 2PUFA 4Z9AA 3OQNA 4KRFA 4LDZA 3VNBA 1F4VA 1URPA 3KLNA 3OLYA 4RY8A 3JVDA 3D8UA 1NXVA 5TQ2A 4ML3A 4GPAA 5I4CA 4LZLA 3QELA 2M98A 4L85A 3Q7SA 2L19A 3EQ2A 3OMXA 1DCMA 3A10A 5TQ2B 4ZYLA 2JCGA 2AYZA 1VLZA 4XLTA 5DKFA 3C97A 4OG2A 3QLVC 5B3JA 1DBWA 4EVRA 1K66A 1TM2A 3RVLA 4ETIA 3IP6A 2FEKA 3SY8A 2L18A 2FEWB 2FW0A 1XWWA 3HSYA 4MYRA 4KZKA 3MM4A 3EAFA 2RDMA 1ZAYA 4XARA 3F7NA 3KYJB 4MRMA 2ID7A 2IKSA 3KSMA 3GBPA 2VUHB 3S99A 5KQLA 1RXIA 3KYIB 3O74A 1Z12A 4MS1B 1JBEA 3IDOA 3RQIA 3HK2A 1T34A 5FBKA 1ZH4A 2CD7A 2X7XA 2ZWMA 3NBMA 1HEYA 1GUDA 1QPZA 1IIBA 4JOQA 2A9QA 5FWXB 3LUGA 5TPZA 3QLVA 1NATA 4ZMSA 1ISSA 3SNKA 2PL9A 3Q7TA 5IUNC 2FMFA 2JBAB 4KFCA 5JNSA 3HVRA 2E4UA 1PNTA 3DGFC 2P9HA 3ROFA 2QVGA 2O20A 3O75A 4G0OA 4IMIB 5HKOA 3N8IA 3IP5A 4M88A 1WETA 2QV0A 4GNRA 1NXXA 2PUBA 3DLBA 5CHYA 1RZRA 3OQMA 1JX6A 3HO1A 1BDJA 3EJWA 3N0XA 4RKRA 4Z9BA 1TLFA 1FSPA 1D1QA 1YS7A 3H5VA 3KTOA 5KC9A 3QK7A 3H5IA 3QX8A 3FGZA 3HEBA 4MLCA 5TPWA 3OM1A 4WT7A 3RVMA 5IUKC 5CNJA 4YO7A 3JS5A 4JAVC 4CBVA 2PUAA 4RY0A 1JL3A 2E4VA 2PUGA 1MVOA 2FSPA 1RXEA 2MSLA 2NZVG 3RVRA 1XHEA 3BRQA 4G0PA 2PL1A 4RXUA 1JDPA 1ZGZA 3LUDA 5CNMA 4YS6A 2A9RA 5KQPA 1NTRA 4OLAA 3LUHA 1Z13A 4E7PA 4KPYA 5T3YA 1QMPA 5PNTA 5FWYA 4PYRA 1D5WA 3TMYA 1YIOA 3QEMB 5TPZD 1YS6A 3QEKA 4LE2A 4F12A 3I45A 1E6MA 4N76A 4B09A 1JFSA 2MYPA 5EWLA 1GCGA 2NUBA 4MLDA 4S05A 3CTPA 1Z25A 3MIZA 4NCAA 3LTEA 5GQSA 4MQEB 3LUCA 4H3KB 4Z4CA 2RGYA 1SXHA 2WMYA 2L2QA 1FFSA 1R8JA 4KK4A 4RXTA 3CG4A 1S8NA 4RK7A 4JASB 3RVJA 4KV7A 3URMA 4DADA 3HDVA 1I3CA 1U04A 2R48A 3BRSA 3N53A 5C5EA 4NCBA 1KGSA 2J48A 4EYKA 2LP4Y 4DQDA 1P6UA 3H1FA 1QQAA 3VNAA 4YWHA 1JWLA 1C4WA 2NT4A 3BBLA 2DRIA 3N0WA 3LMKA 4WXEA 3TO5A 4JB0A 2CHEA 4RDCA 3QEMA 5IEJA 1Y1LA 3MYYA 3N75A 1J56A 4F3TA 1U2PA 1LK0A 2MYNA 2RJOA 3DBIA 4EYGA 1SXGA 3H75A 3W9SA 1JYEA 1NXPA 4MR9B 1ABEA 3OO1A 3GA5A 2B4AA 5BRJA 3DLHA 3F6PA 4QPJC 2PMCA 4MS4B 5FBHA 1DC7A 4PZ0A 3QLUA 1K68A 1QP4A 1DJMA 5JNVA 1QP0A 1KMIY 4LX8A 2FLKA 2N9UA 4RWEA 5C5CA 1SXIA 3LOPA 1RNLA 4O5AA 3CZCA 7ABPA 1YMUA 3SG0A 3E3MA 3SQNA 3QELB 1NXWA 1NXOA 3LFTA 4MR8B 4Q7EA 4Q6WA 1XHFA 1P2FA 1EAYA 4OLBA 3RVKA 2H3HA 4D6YA 3GYBA 2MSKA 5ABPA 2WJWA 1ZH2A 4EYQA 3FFWA 1TMYA 4MPTA 4XFKA 2FQWA 1L5YA 2V0NA 2YHBA 4WXMA 2F8SA 3A0RB 4EGSA 5GOTA 1DBQA 1A04A
chains in the Genus database with same CATH superfamily
1T4GA 4XCVA 3I2IA 4MYHA 1K06A 3WOVA 5DHRA 3LQQA 3ZJVA 3SXJA 4HADA 2P2CA 4Q9JA 2AG5A 2YYYA 3ECSA 1YMVA 3KQVA 2IPXA 3PKIA 4O2AB 4GPBA 5C1DA 4MWEA 1QE3A 4A4DA 2RHHA 1WMAA 16PKA 1EWVA 2UV8A 3C7TA 4CIDA 2C96A 2HIMA 4P3KA 5TR9A 2KW5A 1F6DA 2ZIGA 2VQFB 3DXFA 3SBXA 4JLDA 4YT5A 1HNZB 1DXYA 3MMPA 4JP2A 3SLRA 1E61A 3BMXA 1GFWA 3TB4A 2POCA 4Q05A 3TDMA 6AT1A 2BBTA 3HKEB 4G5GA 3B3AA 5AYVA 4KVAA 1X9HA 3OIFA 4TZTA 1WKVA 1N34B 1Y80A 1GPKA 1C9KA 2YY6A 2GGSA 1N2GA 4UBOA 3H5WA 4PHGA 5D3QA 1MO4A 5IJZA 3GDFA 3ZH2A 2LCIA 2OBLA 4MEJA 2RGDA 4OKNA 1DZ3A 4AJ9A 4E33A 3AGQA 2PG3A 4G5OA 1MUUA 2WNHA 1LTKA 4JUDX 3H1BA 4J0CA 1CIPA 1SKBA 4C88A 2HU7A 1M7BA 3CINA 4OQQA 1SPBS 4KCGA 4E07A 4L72A 3GB9A 1IDN1 4MO9A 4EG1A 1CP2A 4LFCB 1JHVA 1ML4A 5LPNA 4MKXA 2ZYIA 3EPHA 2X77A 2D4AA 4LV5B 5CX1A 2JARA 3HM9A 2I78A 4PGFA 3ZI7A 3CR3C 4DLAA 1Y8ZA 1DV2A 4XJVA 3SFZA 4TSFD 4LRTB 1K0FA 5JCJA 1UJNA 3I4LA 3IUBA 4QDXA 1G8HA 2ZJBA 3U37A 1MJGA 1IJEA 3AR5A 3R6WA 3DT8A 5D85A 3EXFB 4C1BA 5K3FB 1VBFA 1LLUA 3FPFA 2C29D 3H04A 2GUWA 3C4JA 4OREX 4DGSA 1NP6A 1QO9A 3IT0A 1YJBA 4P36A 2IU3A 4KXUA 5L7YA 1JU9A 1XD9A 2C8JA 4Y6GB 1MQAA 3DAFA 3LVRE 4ETWA 3TG8A 4TSKA 2IIPA 1T1IA 4MUJA 4QOGA 1G20A 4H35A 4ZHQA 1LX6A 1OXMA 3DV9A 3OTHA 2CZGA 4AUEA 1VMKA 3HR8A 3KZNA 3TKAA 1MENA 4XWYA 2Q21A 2J59A 5EJAA 3BTVA 5GTDA 2VK4A 3E23A 2RHTA 3FLBA 2IX3A 1GN9A 2GILA 4UUQA 1YBMA 3E53A 3QKRB 1QCCA 2HSEA 3E2PA 3AXTA 4NICA 2UVQA 1YE3A 5HF9A 2JJ1A 3NZEA 4RYDA 1TYEB 3ABQB 1E3IA 4TS1A 3WISA 1YUMA 2AC2A 2PTHA 2WIAA 5CBKA 3GBVA 3IV9A 3EZ6A 3ORRA 4REOA 1VGVA 3ND5A 3GF4A 3O9MA 4WACA 2N47A 1HL3A 1DIAA 2X42A 3E6AA 1DDIA 4NJOA 2HB6A 2RK4A 4OOEA 5IM5A 2ZAYA 1VKRA 3VPFA 2NM0A 4W5JA 4Z3KA 5CEEA 2QN3A 3RAGA 3CXRA 3UGQA 4FT2A 2RGNC 4MPRA 2IT1A 3EGOA 4LUCA 1INLA 1U6IA 5F76A 1B8VA 5JBIA 3ENKA 3MJVA 4R2MA 4MJLA 1U31A 4EG5A 3BJMA 2OGUA 2Z56A 2X1VA 1CJCA 4Q9HA 1YVPA 3LP5A 1KK1A 3TD6A 4FN4A 3TZBA 2GK3A 3IUQA 3SR0A 1TUGA 2WIGA 3MJ4A 1JFTA 4PAQA 4U9UA 3HJTA 2IE8A 3C1OA 4CG0A 1CFJA 1Z5WA 2JIDA 4NSNA 4DEXA 2FN8A 1K3UB 1P0MA 4FI3F 4BO2A 1O6BA 1U0FA 2C7GA 1AZWA 4NEHB 2PM8A 3HDGA 4MDEA 4F4HA 4YMUA 4A8TA 4YQZA 4PVDA 2BFDA 2GESA 4UE3S 3RUCA 3R5TA 1KEUA 2J0EA 1GUBA 3G2JA 3KCQA 4JBXA 3LUBA 3TPFA 2SCUA 1WB9A 1ND5A 2HRQA 3OQBA 4JLAA 1H6BA 4YROA 4FFOA 1EFDN 1JHMA 3Q88A 4G36A 2J45A 3GU3A 5A03A 3NXKA 1CJVC 1SBIA 1NDHA 4MOWA 3UV6A 5CB8A 2WAMA 5LB4A 3B9QA 2HLDD 4AJNA 2VPZA 2B7LA 2C82A 2J9RA 3AVWA 5C46F 1FW8A 4X8LA 2IQIA 3F98A 4EDFA 2FSHA 1Z4KA 2ZCUA 3A31A 3VR1A 3AVXA 4Y2YA 1Q0PA 1FOEB 5DIZA 3M0EA 1AJEA 3WMRA 1EDOA 2GEVA 2RI1A 5BR4A 2GD6A 5FI1B 3U9SA 4D81A 4H0FA 4Y18A 5FPTA 3GZNA 5HRUA 4PPFA 4Q4HB 4AWBA 5JAQA 3MIIA 4AZ3A 2XJ9A 1FMJA 3R0IA 4C08A 3PS9A 1O6ZA 2PO5A 3FUUA 3BH6A 2R6CA 4FCTA 1Y6QA 4F56A 1GLNA 1RR6A 4CGYA 3GLSA 4HNQA 4DEYA 1T8PA 2HJGA 4C4SA 3FCSB 1N1GA 4QOFA 4D97A 5AVJA 3U40A 2ZYHA 3QPBA 3KUKA 4L7VA 2JCVA 2XBLA 3CFYA 1MO6A 1V1RB 3H11B 3GFTA 4FINA 3TD9A 2V6BA 4ASUA 1C3JA 4BRUA 4EYSA 5IASA 2V7GA 3CEAA 3L0BA 1SQ0A 1VXRA 3IESA 4ZO8A 5AJZA 2R47A 4CQMD 5KC8A 2V7EA 4KR7A 1ZM3A 3UWKA 2YNMD 3VYTB 4KO4S 1FZTA 4EHBA 1U4SA 4YCBA 3RHZA 3WGJA 1Y9ZA 2ZUFA 1SXJC 3CONA 4DIFA 2Y76A 4LK3A 3HKCA 3ONWA 3IP7A 2CDRA 2PA3A 4B45A 3HBAA 4K6FA 4DR1B 2R1TB 5BW4A 1QGDA 2JB9A 1PEDA 1MNAA 1UFKA 2NO9A 2Z2YA 4GMXA 4ITRC 4PLFA 3ITDA 3QEJA 5EC8A 3I62A 4YRJA 4LRYA 4RE6A 5DLQC 2HFJA 3AIMA 4OAQA 2FPPB 3SLGA 1SZCA 5KJ1A 6Q21A 3OKFA 4LHSA 2G5GX 4MS4A 1R9GA 2B20A 1GUFA 2XVYA 1KVRA 4S2EA 3NBQA 1EVZA 3I5XA 3EULA 4HEHA 2HK7A 1HYQA 4XPIA 2G67A 3JQFC 2BMFA 5IVDA 3USZA 5JU6A 3HKDA 3HPQA 1KU0A 3TFWA 3K71B 1KR5A 3FYDA 4DM7A 5GZ1A 3DL2A 1PT7A 1LPPA 3LU1A 4NP6A 5AVVA 3ZY3A 1BDHA 4OJNA 3QLUC 4BWVA 1VE9A 3PUYA 5KYUB 5L7TA 3A3KA 4BGEA 3DVQX 1VKHA 3GLFE 1HWYA 3A6JA 3QBTA 1RI1A 4P54A 2E4ZA 3OICA 3FPAA 3OQPA 4JL6A 1WMEA 3NBUA 4J7XA 1JTVA 1MU0A 2YFYA 2FPRA 2WKWA 3NC0C 2IPLA 4CMKA 1AB5A 1G0OA 2BCGY 2FPGA 4V0RA 3UM9A 2ZJAA 2IK8A 1E99A 4ZVPA 3KD3A 3SAJA 1R5BA 3AHIA 3OCCA 2LIVA 2C42A 2YQ5A 3MGCA 3OZRA 1FP4B 1OFUX 1U7HA 4FOLA 3JARA 4OQPA 5EJ2A 5LR6A 3SC2B 2C2YA 1G20B 4AJOA 4Z4FA 1HNNA 1I4LD 4W1SA 5G1NA 5KYKA 2K5UA 4D8VA 1HDXA 3RVBA 1ZN9A 5JDIC 2XUOA 4XX0A 1HMPA 1RC0A 3KQNA 5TQ0B 1E3JA 4OA5A 3P9SA 1LVGA 4M0KA 4P4UA 5COAA 4IGAA 1R27A 3A28A 2FPIA 4L75A 4LHVA 3ABRB 1KAMA 4RPGA 4C76A 3BFPA 4S0ZA 2RBGA 3ESCA 2FK7A 1NI4A 1O6GA 4OI2A 4F4UA 1L7MA 4PO9A 2DB3A 1I4TD 1RVDA 3M9XA 3UXYA 2HNAA 4ZVLA 1JG4A 1KQPA 1JILA 3WLOA 3OCJA 1PKXA 3GGPA 2P9GA 3MS2A 4F3RA 5BT9A 5C8VA 1HQCA 2RE8A 1J24A 2GLXA 2WTNA 3B1FA 1C3EA 1WP4A 4PO1A 1E77A 4DARA 4S24A 3V46A 2VP2A 2AJDA 1GUYA 1WTCA 4G0QA 2AI3A 1JQJC 4DREA 2CUNA 4BZPA 3K70C 3A4NA 3HFGA 1QX4A 2I2CA 3ER9A 1NXVA 4KXNA 2AR9A 1T8WA 2VEOA 5LQJA 2QW0X 2FW7A 3LBNA 3CUEF 3Q7SA 2QG6A 3TECE 1R4NB 2FOIA 2HEIA 3ZCRA 1TQ6A 2ZSUA 4CUZA 5A1TA 3IMKA 1JA1A 4KX5A 5F12A 5BSUA 3C0KA 3TTVA 3RADC 4JT8A 5JMTA 3V2UA 1V71A 3JATB 4K9PA 1R0SA 2V1XA 3QLVC 4ITVA 1N9ZA 2QLTA 4HB0A 2VK1A 4NENA 5JZOA 2HSJA 4P4TA 1I3KA 1AO3A 1YRWA 2FEKA 1K8XB 3TSOA 3VU8A 2O59A 4MLZA 5CDYA 4YMLA 4KZKA 3EPLA 3T1VA 4ISCA 4P3PA 3K72B 3UAOA 4MVJH 4YCJA 1RXIA 4BVJA 1Z12A 2GBLC 2NU6B 2AE1A 3AQIA 2RH4A 3HJBA 3HK2A 2ON6A 1DSSG 1V3UA 2QWXA 1SGWA 1SKUA 2X7XA 4TS4A 4F1JA 1GA6A 4IIJA 1M67A 4I66A 1PK7A 3PWSA 4I9GA 4ZMSA 3ZY2A 5DM70 2JC3A 2QM3A 1BU8A 3KZMA 3SNKA 4EUEA 1FJHA 1PW5A 1BX3A 2WM3A 3OPVA 4KFCA 3BORA 3UAYA 3C98A 4IUDS 2AC7A 4HGNA 5CIWA 5BQFA 2E4UA 3FOEC 1SQ6A 3DGFC 4JXKA 4YQYA 3ZJTA 5EEGA 3MRSA 2GPBA 3I04M 3M33A 5K3OA 1UZNA 2XUAA 3P27A 1Z5UA 1KY2A 3ENWA 4HGPA 1JJBA 2NV2B 1J9GA 2KHZA 1TJ4A 2BD0A 1AUPA 5TF0A 5HM8A 3OQIA 3OQMA 1JVBA 4NATA 5KSYA 2RCYA 4JR2A 4N5MA 2C2BA 4TKVB 1YD7A 2JHGA 4OP3A 5DXAA 3A05A 3TQCA 4DW8A 3IXQA 5KC9A 1ID8A 2O0MA 3KLPX 4G5RA 3RIYA 3WOHA 2ONYA 2IA5A 1X7WB 1FF9A 1NLZA 4GQAA 4WGFA 4GDMA 1J23A 9LDTA 1OREA 4EITA 2IS6A 2G36A 4UMFA 5J5CA 2PUAA 3AF4A 1W88A 3OEYA 1PD0A 3A6KA 1RXCA 3PUXA 5EERA 3PFWO 2VJDA 2PKCA 3BIFA 4JDPA 1ACJA 1G55A 3QIAA 5D84A 4S12A 3TOVA 1U8UA 3LBAA 4ENPA 4HC4A 1LBTA 1QFZA 2JKVA 4P2BA 5SY4A 1TYBE 3TQTA 3VSBA 3ZLTA 2OQ2A 1FP2A 3RUPA 1XTJA 4WOBA 4DLSA 1J21A 1DS6A 2ASEA 4WASA 2GCGA 2DYKA 1IFXA 3VR4A 3ACDA 3LDUA 3DPSA 3SYKA 4L8FA 4J43A 1R8QA 1FC0A 4H16A 2O0JA 4I08A 2HHLA 2JI7A 1P2GA 1S5PA 4JQSA 2F3UA 4C21A 2P9QA 3BBPA 4HGRA 1I7NA 4B46A 3LW8A 1XWFA 5A9SA 4UVHA 2EBUA 2X4GA 5J40A 1RYDA 2DPMA 3WLIA 4IOLA 1XOIA 4BLRA 4DLXA 3H8WA 4M9RA 2Z1MA 1Z39A 2AOWA 3KZVA 1VDZA 1ZQ9A 3OHPA 5C4MA 4JLMA 3E58A 4DJDC 5KSZA 4URWR 1JDBC 1M6VA 2VPWA 3PICA 4BO1A 1OPXA 4BNDB 3NC1C 4D3SA 4DRZA 3TVTA 3GI1A 3GJ8A 4DR7B 1FRVA 2DCUA 3LQFA 3PGA1 4O1MA 4RDCA 5IARA 3H2JA 2OCBA 3GLFA 1GPUA 1ODSA 1AM4D 4UQLA 1KFEB 1I1HA 2FF7A 2MU1A 2XEXA 1XEWY 4FHEA 4FOOA 1SOUA 3WS7A 4F9EA 2H16A 4FGZA 4YAJA 4R7TA 1I14A 1ABEA 3UW1A 1GAXA 1VIVA 4L9AA 5DIFA 3FWKA 2B4AA 4D9HA 4QPJC 5LVAA 2GZ1A 4RF3A 2XMQA 3GAAA 4OBXA 5ALTA 3EEOA 1SHTX 1G64A 4A92A 3ADCA 2VSNA 3SK0A 3R8XA 4RC9A 3RKRA 3ZGNA 3VMMA 3D7LA 3R3ZA 1I1OA 1NFQA 2Q99A 3DEJA 1OYYA 1NU8A 4KAFA 2LRHA 4EOGA 4P80A 1E4EB 3UT6A 1D7OA 4Z8YA 4I3HA 3OT5A 3OX4A 3E9MA 2WWTA 4L6CA 2ZRNA 3DPUA 1V43A 1CY8A 1ZONA 3P20A 4LYDA 4CCYB 2BHRA 2CLIB 1CCWA 1L5YA 2XUKA 1VBMA 4OGLA 1T3HA 4WCDA 2WDZA 4LFBB 1DRVA 1QG4A 1QO7A 4NV1A 4JJEA 3VRHA 5CCEA 3LA8A 4NBSA 1YRYE 2CEKA 5GOTA 1DBQA 3S2IA 4HPJB 5IT4A 2QSYA 1W36C 4DNOA 2ATCA 2R8ZA 4FE4A 3TNLA 1KJ8A 2VP6A 2ERXA 3SICE 3LLVA 4L0QA 4TLLB 5DCUA 1GOTA 1NYLA 4AP5A 3ZWCA 4U0JA 4DSOA 4Q4JA 2FUKA 2Z57A 1QGUB 4ZAGA 1K98A 3SS8A 5KUTA 3OCWA 1R10A 1NLUA 4UU1A 1C7FA 4MEBA 5JSFA 5D1HA 1XPRA 4GSKA 3L6RA 3RAPR 1AX9A 1CHNA 4C0AC 4P3OA 2PE5A 5ALXA 1JFRA 4E51A 1Z6PA 1VJTA 2QVYX 5E4YA 1L0BA 4UW9A 1FE8A 3S2GA 3AJDA 4MVJI 5FKJA 4A8HA 3IIMA 4BP1A 1KFJB 1UOEA 3EXHC 1XVUA 1H05A 2BT4A 4BNNA 5B12A 5EKUA 1B00A 1YC2A 5TMBA 1KGDA 2PAAA 1Z6GA 2VCYA 3EDRA 1C2YA 4JYZA 5EY5B 4DCCA 2FN4A 1Y8QA 4FUTA 4EG0A 4EG8A 1KERA 4QREA 3AONB 1SQFA 4FJ2A 4PYKA 3AFGA 3RIEA 4F5EA 1GRRA 2Q5LA 3L40A 4L4ZA 3K31A 2XHEA 4Y9UA 2J4FA 5B30A 2HF9A 2EZUA 4CQJA 5HQ3B 2PJDA 4LCEA 2B8TA 3BXFA 4JUBA 1QK4A 2HJSA 1ZA1A 5EIAA 2NSDA 4F97A 1U9CA 3O3CA 2AOXA 3OESA 4V2UA 2B83A 5KHAA 3H16A 1GZDA 4BZWA 4U1RA 5B3AA 5CT8A 4ZAXA 1PJ8A 3QV1A 1EWKA 2W8BB 3QVJA 4RPKA 4YCMA 2VT7A 1ZG3A 1XLTA 1SM4A 2AK2A 3JALB 4KKVA 1BRMA 2H7XA 4UUMA 5HPYB 3WAJA 3OZFA 3T3NA 4G07A 1SC3A 1RTKA 5IKPA 2B4YA 4R5MA 3D8BA 1DAHA 3L6BA 5BORA 2WAOA 5CTJA 2OGZA 1GGEA 1X7GA 1DT3A 3D7NA 1VB3A 5ECWA 1L5VA 4CHTA 1OKKA 1XFAA 2FJUA 2I4NA 4CR8A 2F6RA 4OJKA 1PT6A 2YW2A 1D4OA 4L4XA 1BIFA 4LXGA 1KBQA 3GELA 1RQNA 3GZTB 2FP4A 3MQ2A 3ES9A 5E6SA 3VYVA 1UBHS 3M34A 1E3DA 1V16B 3JASA 4LRUA 4M76B 3TRFA 4D6PA 2M6SA 4KO1S 4OAPA 1NONA 2TSYB 1N8NA 3M4YA 4A8JA 4CF3A 3B2NA 1DC8A 1N9GB 4HLNA 2QTLA 3CEHA 3P4UA 4IH4A 4YVFA 3ZY4A 4AKTA 2XYHA 3EXHB 3ZC3A 4CLEA 1NY5A 3QITA 3NEPX 1DEOA 4FYWA 1U5BA 3CLKA 4HV4A 3DTNA 1W581 5BQXA 4FYVA 3I9OA 1NQAO 2YVKA 2KYRA 2PAFA 4DV0B 1TTTA 2AX3A 1SBZA 3B89A 4RCYA 3TWOA 3C6BA 3DKPA 1WIWA 1ZMXA 3RYFB 3E22B 5DXFA 2CNBA 2DHQA 5JPDA 3B1XA 1U7ZA 3A6DA 4CMEA 2I3AA 3EVZA 3I9NA 4BBZA 1LPOA 1A8QA 2FZWA 2IEGA 4ZAVA 1E9FA 1KS9A 3KPVA 2PZEA 3KV1A 1J7JA 5LZ9A 3GAMA 3DW3X 1GPWB 5DISB 2H2HA 3H1TA 1JWBB 4GIBA 3SX0A 4DCJA 2XLCA 5AK5A 1G60A 2H1SA 1FXWA 1O5TA 4Q5IA 3SU8A 4EX6A 4GR9A 3EWNA 3O8NA 4JQYA 4JVSB 4R84A 4MRVA 1DIGA 2WR8A 2XTMA 3JPYA 5T7BA 1BEEA 5EQFA 4DKJA 2X4IA 5GV7A 4JEIA 1QAQA 4KN9S 2JFWA 2AUTA 3QXHA 4YUXA 1I0IA 3UXHA 1ZINA 4PYIA 3HEMA 3I92A 4UARA 2ZSDA 1N5MA 5DI9A 4XGKA 2DQYA 2HD4A 1Z0ZA 2OSVA 4HD8A 5TGTA 1UDAA 2AFVA 3CZPA 1PEKE 4N8EA 1UKBA 4PICA 4ZD6A 1XJWA 1HEIA 5TJHA 3C48A 2ACEA 1OZ0A 2CXXA 4FW8A 4P3YA 4IIJF 3SBEA 4D02A 1BJRE 3ZKWA 2ET6A 4C9BA 1HT1E 1DPFA 4RTLA 2RB5A 3W2HA 1NBEA 2R11A 2R4TA 3GMDA 3NWJA 5I3CA 4QYMA 2J3LA 2FWRA 1AIPA 2P9TA 3HZOA 1NJ1A 1E4EA 3T5PA 5FOXA 1OLOA 3TQHA 1JDTA 4BX2A 1T10A 2CD9A 2XQVA 2PIDA 1Z2AA 3GWGA 5AOAA 1NF2A 4R3NA 2Q8PA 3KBOA 4G5FA 4HLUA 2XECA 3IQZA 5HNKA 1JJAA 2P0EA 3N58A 4Q93A 3VUEA 4CKWB 1TO2E 3HB1A 2GSDA 3PBKA 4ZOBA 5E1DA 2Y2VA 3MWKA 5T6MA 1NW7A 2GAJA 3R41A 4M6WA 2E48A 4B31A 2PKWA 1C9EA 4JNCA 5FI5A 3IVRA 3VX4A 3FFTA 1BHQ1 1JG3A 2V58A 2XUZA 1LV7A 1B42A 2WLSA 4L9RA 4W6QA 5JZBA 9ABPA 1GAWA 5DX1A 3QU2A 2GR9A 2FRXA 4HDKA 3WE7A 3ZDQA 5EJ6A 1CEQA 1GL6A 2G09A 3PDUA 2C94A 3PQ2A 4JSTA 5EP4A 3BKXA 1SD2A 2PT5A 3K0BA 2WUFA 4G89A 4ZJPA 4B6GA 2PGDA 2IXDA 3WQBA 1RWQA 3R5FA 1A5BB 4H60A 3GOQA 3FMVA 1L3IA 3BHIA 4UHHA 3P4YA 3DPIA 3ESQA 1OWLA 3OAAD 4QRHA 1TJNA 4BTEA 4EDHA 1N92A 1QRTA 5FUWA 1Y1QA 2HV9A 3QH4A 5JPIA 4GKBA 2D7CA 2FEMA 3RRXA 4X8OA 4XEHA 4C7XA 3FOCA 3D5QA 3VR6D 5EP1A 1N0IA 3KEGA 3PNYA 4MQEA 4X44A 4PZPA 1Z8HA 4OGWA 3PEFA 1E0DA 4EY5A 4HAOA 1XZDA 3ZVMA 2Q07A 2F8TA 2J3EA 2B8EA 3LHSA 5KVVA 1JEOA 3B70A 3FZNA 2PS1A 2LV8A 2FSGA 1Q1GA 1UJMA 3O7WA 2HNKA 1MX5A 2OFXA 3OQHA 2PEYA 4E22A 1K5DA 3F9RA 5I48A 2QVCA 3ITNA 3O6VA 4GXTA 4MRAA 1U4OA 3WQQA 3WP1B 8OHMA 2D1TA 1EM6A 2BGKA 1M74A 1N6LA 3BWMA 1T0PA 3G2NA 1WCXA 3A1UA 3N7AA 3R6DA 4MGKR 2EP8A 3SCZA 1K3FA 4QD3A 5KPJA 4ZYZA 1K2VN 3E5NA 3CR8A 4IFEA 3TRHA 1RZUA 2HC9A 2X6QA 2PWBA 4AECA 3CX7A 5JYCA 2R2AA 3HA2A 2CXTA 3KQQA 2YC4C 4UVGA 1KZ6A 3E9NA 3H9UA 5A6VA 4DR3B 2ANCA 3PGXA 3VPAA 3KKQA 3K2EA 5G0VA 3DEZA 3IPAA 3L2OB 1N2CB 2XQKA 2RGUA 3NPAA 1DMRA 3P9PA 3A1VA 1J1UA 1MN6A 3BL8A 1D09A 1XZBA 2FMIA 1QO0A 4FYJA 4HJXA 2H48A 3Q40A 1CUWA 2FKNA 3TZEA 1ZU4A 3ILSA 4PV7A 2H1WA 3HB7A 4QFDA 2C98A 3OZUA 1YE8A 2L17A 4U9IS 5K3BA 3V2GA 4C6TA 5IHXA 5JISA 2R25B 1SH7A 4XPIB 5EIHA 1QRUA 1M8GA 4MDYA 2RGWA 2JGJA 2F48A 2PBFA 2QB5A 3A04A 4CL0A 2H6EA 4J0EA 4PC1A 1U6JA 2XCLA 5D5QA 2PUEA 3A27A 3AERB 4FFPA 3L06A 3EVAA 4WK2B 4L8YA 1UXOA 1KSJA 5CT6A 2H2IA 3C70A 3FJYA 3GK3A 1ULZA 3ADKA 5SYMA 3G5TA 1LZKA 4GO1A 2RH8A 4BV3A 4HI0E 1IXSB 1UJBA 1E4VA 2EZ8A 4QVKA 5DN9A 3ZQ4A 1EQUA 2OV2A 2UAGA 3CH4B 3PUHA 1TCUA 3WWPA 4C7BA 2YJ4A 1M66A 2HRRA 4IFBA 3NM5A 1S8AA 2JVIA 2O05A 2ZR0A 4KH0A 1D04A 4MWZA 4RCZA 1A27A 2A35A 2CUTA 3HN6A 1PCXA 4R1MA 2DFVA 2DJ5A 2FFRA 3SR3A 3ML1A 2I87A 3C8UA 2YY5A 4ZOEA 1E2MA 3D3EA 1ONSA 3HMKA 3CEMA 3HWWA 4Q3EA 5KJ6A 2YMLA 5FYDA 3VR4H 2WQ6A 5H8WA 2GCNA 3AVQA 4JV5B 2HAEA 3QZUA 3KQHA 3FLAA 4QA9A 2RC6A 4XM0A 4NCIA 1RRPA 2F9LA 1PVVA 2DY0A 3KQOA 4OHKA 4RJLA 2A67A 2NZXA 4FBLA 3A4IA 3HNRA 4XWOA 4ID3A 3HJUA 4HO1X 1E1QD 4P22A 3GZNB 2B1RA 2OHOA 4ZI5A 2VH1A 3C97A 3SVZA 1JH8A 1K89A 1RXSA 1AKTA 4W8HA 4TTIA 4WGGA 3M70A 3ZVRA 4KQGA 4LMPA 3WLEA 1L5NA 4QRDA 3GPLA 4LJ5A 3DOCA 5KVAA 2FW0A 1NNI1 1JG2A 3S7TA 4UU7A 3RFTA 2RDMA 1B74A 3QUCA 3ZQKA 1E5TA 1Q57A 2EKQA 5L3RA 2XI4A 4MRMA 2NYRA 4EJ6A 4H1TA 3S99A 1CBUA 2NADA 1GPNA 1DHRA 3CSSA 3O74A 1FY2A 1H0HA 5FUXA 5FV4A 4IJMA 1JBEA 1DWUA 4M54A 4GL2A 1CS0B 1F17A 3UFBA 5ICCA 4EW6A 3T5AA 1M0EA 3D4NA 1GUDA 3MHTA 4WK6A 3PA6A 2JAQA 3IYLW 4J1NA 5AD1A 5JSZB 4JC8A 3FRHA 4Q00A 4I4CA 4F84A 1M6HA 3STYA 2FAXA 3EVTA 3JD4A 3I9V6 5SYAA 1G1AA 3LP8A 3TDKA 4WADA 2V7WA 2WSLA 2WWGA 5JRZA 3H9BA 5AJXA 4IFTA 3DDWA 3T4UA 4E5PA 5JNSA 2WYHA 5TQVA 3E3OA 5DHSA 4AJHA 2Q2WA 1HDIA 4OMFG 4ALLA 2PSEA 4AZVA 5CEJA 3GHYA 5EFZA 1V11B 1KYIA 2IXAA 3SKXA 3RJ9A 2WB2A 1P7VA 2FP4B 2QYOA 3DVLA 5CB4F 3DLBA 1IVNA 2OZKA 3GROA 1ACMA 1UM9A 4LBWA 4AB1A 5IAGA 4AY3A 5LDGA 1GM5A 3VNVA 5IW8A 4FKMA 4L0DA 2D2VA 4DKXA 3AF5A 3PE3A 3X1YA 3UCFA 4BFVA 4BKMA 1IHPA 3OEHD 3H5IA 3VC7A 3PP8A 3EUEA 3HV0A 3RVMA 3RSZA 4D0SA 3RB8A 1Y3IA 3TKLA 3KJGA 2XUDA 3R9KA 1GEEA 5AOBA 3WSWA 3ZHYA 4B84A 2ORIA 1QOQB 2NU7A 4MUFA 4BN5A 2I7XA 1IZ9A 1FU4A 2CB9A 5B5SA 5JCZA 1C3XA 4HMQA 3TZ6A 1XKQA 3IUYA 1T5IA 3OQ6A 4GYJA 4N01A 1OXSC 2PUWA 2ERCA 1DJLA 3UKOA 5CX1B 4NU5A 5ILGA 1QB7A 2AMVA 4KPYA 2O9JA 2X14A 2IIQA 3KT8A 2AOVA 1ODLA 1VLQA 2QX7A 1SA0B 3KWJA 1ZCBA 4N40A 4OB8A 3WBJA 4F6RA 1TX4B 1YS6A 3QEKA 3ZH9B 5LQNA 4ACBA 3CWCA 5KNDH 1CW2B 3NASA 5ADWA 4B0PA 4MLDA 1E98A 4U3JB 5ALWA 4UM9B 5E9QA 3G0DA 1FNDA 1PFQA 3FMPB 3G17A 4ERXA 2UXBB 4KE7A 5DGHA 1Y7IA 1UZLA 2FDXA 3SC2A 2H06A 1N9GA 2Z3VA 2GN6A 3A06A 1RXVA 1NR7A 4RPLA 3HVIA 2IXFA 1V16A 1X1TA 2C03A 4IZ6A 3PIDA 4OA8A 4RK7A 4RSGA 1O97D 3HO6A 4AX8A 2ONJA 4TS9A 3Q8KA 3IP1A 1E2IA 3WWCA 5LYYA 1M1NB 3AL0C 5ARDA 3GUCA 2GJSA 1UZMA 5L4NA 1GDDA 1OFHA 2LP4Y 1OBOA 4I1IA 5BV0A 4YLYA 1W1IA 1ABBA 1KP2A 1IM8A 2OESA 1GU1A 2HPAA 3PGKA 2HJHA 2WF8A 1QDLB 4NOLA 2FZ5A 5EUQB 3N0WA 3OFSA 4TYMA 3AUXA 3P97A 1QTIA 1PJQA 1LU9A 1J8YF 2XEDA 1YQXA 4F3TA 5KAMA 4DAOA 1PJTA 3BAFA 4U9HS 1YOBA 4OFZA 2A6PA 3P32A 3W9SA 4WDRA 1MFZA 2OD7A 2W93A 1MH9A 3KBBA 1LDNA 2FY8A 1UOOA 4FU0A 1OXXK 4M0EA 4Q4AA 5E8JA 5IP5A 3SJUA 4LXIA 2W2LD 3G9TA 2W0MA 2XXAB 4Q37A 3C3CA 1GRQA 5I9LA 3PJGA 1PJZA 2Q0XA 2ZRJA 1OBCA 4LX8A 4Q12A 1YKFA 2PGAA 4KPGA 3CZCA 3S1AA 1KMNA 2WG0A 3CZ9A 5GONA 2ZM5A 2WHRA 3OZ7A 4DHEA 4G4IA 3C4QA 3S8MA 3HFRA 5FHQA 4C0HA 3QFTA 4PWYA 4PZYA 4Y98A 2BGRA 4J0FA 2P7HA 4RESA 1UEIA 1EFPB 4QQFA 3O26A 3ZD6A 2C9OA 3H05A 1AQ6A 1X8LA 2J3MA 3AOEC 2MSKA 5AQEA 4DQ0A 4R3UC 1NHGA 2CE2X 2MSEB 2Q3JA 2ZANA 4B73A 4MPTA 3FSEA 3EQ6A 4CLHA 1WUHS 3WGVA 1AQNA 3EQ8A 3GUHA 2FEXA 3P9NA 1PZMA 5AH0A 3RAFC 1HZJA 5B58T 1EZ4A 5HK8A 2XGGA 4P4LA 4ENRA 3B5EA 4YYEA 1IHUA 3NTXA 3WGYA 2JIOA 4O0MA 3KOOA 4WN3A 5EMKA 4R69A 5FF9A 3FLMA 4A2PA 1WV0A 1ZJ5A 2AWOA 2HWKA 1T4CB 2D1SA 5ALGA 2NZWA 1HTBA 4D45A 2D59A 2X0JA 1FP6A 3QNMA 4JODA 4R31A 1X9GA 2SECE 3L8CA 4KL8S 2D06A 3UKJA 3V48A 1ISMA 4CODB 1VE5A 1CJKC 3EPRA 4IKEA 4I3FA 1FUEA 1Y9DA 1N6HA 3OG9A 4QUBA 4RVFA 2V03A 3S8YA 1I51A 1PFVA 2YWJA 4FR0A 3T9EA 4E08A 1MC8A 4DDHA 1IBLB 1AHHA 2B0CA 1HO3A 2OQIA 2UVPB 3ILHA 3GZ4A 4IDDA 3SZRA 1XN1A 4G1VA 3LYLA 1EGHA 4E6EA 5JQGF 1VZ3A 5JJIA 1CIJA 3O8QA 5DTIA 3WBBA 5JXWA 4P7FA 4DUGD 4ODIA 2JASA 1X1RA 3K4HA 4MZXA 3PPIA 4JT2A 4LMAA 1Z0UA 2Z6VA 3M4XA 4A9AA 4TLBA 1CZHA 1Z29A 4D9FA 3AYXB 2HLDA 4K9RA 1MCZA 4LY6A 5ALZA 3DZJA 3O1JC 2BI8A 5CPFA 1FX0A 1QK5A 4EMBA 2CLMB 2P2LA 2JBHA 3VX3A 4OQZA 4PAWA 3EAQA 4DLVA 2PWAA 3NTRA 2PKYX 4CDGA 4H27A 2IDJA 5AKJA 3M1AA 3NH6A 4BS9A 3RTGA 4NS1A 3I8XA 5H3CA 3LGAA 5IHPA 2P2NA 3SC3A 2ZYGA 3OEWA 2J87A 3G0CA 4XJSA 4J6EA 3BSWA 3TRJA 4BV2A 1P0PA 4P3NA 3O0TA 3TE6A 1QDEA 5JIBA 2NXEA 4L2IB 1CV2A 3RSCA 2ZIZA 4LY0A 1EHIA 1IJKA 1VL5A 2Y9PB 4PLZA 5D1NA 2DPGA 4Q1FA 2CDCA 1A3CA 5B1DA 3PF8A 5IAAA 5EESA 2P2GA 1D4FA 4E21A 3S1LA 2IUSA 5BRAA 3ITKA 4F4JA 3OQIB 3UZUA 4AS2A 2DHCA 8ABPA 2FW8A 2XYGA 3MGAA 1R9JA 3QPDA 2W4MA 4A8PA 1NNLA 4FW9A 3NHMA 3JW8A 1P73A 4UTVA 5LQSA 3QA3E 3ZNNA 1EXNA 1CR2A 5ALEA 3Q87B 5DO9A 2BY4A 3BE4A 5LQMA 3BX1A 3V97A 4MCIA 4XDHA 1RKVA 4JEUA 4NCNA 4XCQA 5BMVA 1EWTA 2JBAA 3P5SA 4P38A 3OFND 4WUTA 5AIAA 4HB4A 1JWAB 4ZOLF 5EUBA 3WL6A 2RJ3A 1AQUA 2XMCA 4YP9A 4D79A 4DYDA 5LIRA 4LFAB 1SR8A 5DI3B 2BIFA 5DM2A 3PR1A 5THXA 5K0CA 1ZCZA 5LP6F 1DOHA 3A0UA 1Z0DA 4TWRA 3PB3A 5DCYA 2DT8A 3WKBA 3CRRA 1VYHA 1U9YA 2DWCA 4M53A 4NULA 5HP4A 4EELA 3AJ9A 2AR7A 2YR0A 5IVPA 5CXXA 3MMSA 3WLTA 1KSHA 3NATA 1OFTA 2QRPA 4IINA 4U2CA 1PGOA 4WNAA 3NW9A 4G0ZA 4GZ6A 4RZXA 2OMEA 3MRVA 2ZATA 4HNRA 3UUEA 4COKA 3VPDA 4DN6A 4BMPB 1UC8A 3F71A 3L04A 4Q9IA 4B8WA 1LDYA 2QNBA 5A9RA 5C9ZA 2XCRB 3G68A 1M1YE 3G1UA 3NKFA 3W1WA 2G1UA 3NONA 5IG2A 3WO0A 3FR8A 3FYSA 3PHIA 3U61B 2JLQA 1JHRA 1U8FO 2PFSA 3BILA 2R1UA 3BDIA 4NR0A 1ZKDA 3OTGA 5C1BA 2ORWA 2OHHA 3UICA 3B6MA 4MB0A 4Z1MA 3P0EA 4F6RB 3H0EA 2E89A 2A9KA 2UYHA 1K8YB 1U1EA 1QGOA 1IM5A 3B1JA 5J4YA 4Z4HA 4FJ0A 1XQVA 1YCFA 3EBPA 2ZYAA 3RYHB 4KMRA 1HE1C 3RFFA 3HBLA 2VPPA 3HRHA 4Z53A 2QW1A 1VB5A 2VUIB 3LQYA 5D3MA 1ZUD1 5H4HA 1EP2B 2G9QA 3GHHA 3O83A 3T95A 4PSAA 4IIBA 5JXIA 3GVCA 2GEDA 1NI5A 2EDCA 1KI9A 4DQKA 2N1MA 2HA7A 3B5IA 1XTSA 3HJAA 3QQPA 2O8EB 5FPPA 3DMFA 3LWZA 2FHPA 1B4DA 2HCJB 2ZWVA 2IHUA 2PSDA 3CRZA 4IIYA 2XD4A 1M2EA 4H18A 4NBNA 4PGHA 4UPDA 3BHNA 4ZDWA 2EW8A 2IPMA 2HGZA 1OYVA 3RC3A 1P4HA 3S5UA 5A5VA 4DB2A 2ZRCA 4UTOA 2G1KA 3RTCA 4YRNA 2CNKA 5IDYA 2FX3A 3IEIA 3T35A 1XAGA 2HHJA 5A04A 4OF4A 3BMNB 4QDJA 2ICAA 3EDCA 3H2GA 4LS3A 1F2UB 2ZDHA 2NPIA 1VSVA 2W90A 2ZETA 3SEQA 1FDIA 2VP5A 3O9ZA 3BRWA 4F2HA 5BNWA 3IX7A 1C5KA 3IURA 4QNMA 1CQJB 4FZ3A 3WO1A 3G0GA 4M60A 4PYQA 2C7PA 1QYCA 2PH5A 4IHAA 4BZXA 4RO0A 3BCSA 3LH5A 3O90A 4FGUA 4X1OA 3QBEA 4QT4A 1W5AA 3C3YA 2YZ2A 2WM8A 3CGGA 3EBOA 3H1GA 4MW4A 4RF4A 1WQ3A 1FFHA 1KZ4A 4YA6A 3SZOA 4RTPA 2JLUA 2GZHA 1XRQA 3AI3A 3DLCA 5KQMA 2K7FA 1PK8A 3PPYA 2J5XA 4QPZA 4PG8A 3VV3A 3JQ6A 2DZDA 3WBKA 4FMBB 2D54A 3VR5H 1J90A 1ZCFA 4F3KA 3S68A 3ZUPA 3D0QA 4BUZA 3W34A 1H23A 3HJCA 3I1FA 4LYJA 1YQUA 3AVOA 2ZUWA 4RPHA 4EI7A 2NLOA 2E21A 3HP1A 3KJHA 1ATZA 4G97A 5CM8B 2CVOA 4MS3B 1G6KA 3D8NA 4KG7A 5GWXA 3BRWD 4RMGA 4ZO9A 4DPLA 3RS0A 4FYIA 3OIDA 3JYQA 1HZZC 2WMNB 5IJAA 3COVA 3BQNB 4HDQB 5LYJB 2TECE 3BMCB 4A3SA 1G41A 1V7CA 3NT2A 3DR5A 5P21A 1A1SA 3DFZA 4CIAA 1FUUA 2J7PA 5BVGB 1FMTA 1CY4A 1NSYA 3W8FA 4F3YA 1D0VA 2HGSA 4BC0A 5D5PA 4B40A 5DM1A 3X2FA 2HBZA 3KHUA 1VIAA 3R6TA 4QQRA 3F1LA 5LB2A 4RK1A 1Y5LA 2YNMC 4ZU3A 1HDYA 1QIIA 2WU4A 1P6XA 1TAQA 1SEVA 1R6XA 2X19A 4JLSA 4KVFA 4NZMA 4WUVA 4EATA 3LOQA 4G0YA 3RTDA 2IYVA 5DYNA 5THKA 4NG4A 4BRWA 5JXHA 5CK4A 3I5MA 4PFQA 1XTKA 2G82A 4B3IA 2OCXA 1EFRA 3L4SO 1HLDA 4MINA 4EHHA 4YCAA 3X2SA 4LSWA 2Z9CA 4RDIA 3MCZA 3AEQA 5IKEA 4QG7A 1USWA 3U9TA 1CX9B 3FTCA 1LBHA 1OVMA 4Z1MD 3RK0A 1LLFA 2AH5A 5T6BA 2H1RA 2BRUA 1L7PA 2CT8A 1UBLS 3VR0A 1KEWA 2WJIA 2FE4A 4GDFA 4Q24A 2H1HA 4F85A 3GEGA 5FOTA 1BX0A 2C07A 5EUCA 4C06A 3SXUA 2XHZA 2XADA 4WK4B 1T5LA 1CNMA 2E5WA 3M6UA 2JI6A 2Y1KA 1RJGA 5IDWA 4DA4A 4MIYA 3W3AD 1XNJA 5A4KA 5LDDC 4I6EA 3BWBA 5CDSA 3R3YA 3JQ9A 4HH0A 4G6ZA 4I4IA 4H7KA 2QTGA 1XRNA 3RV3A 1U2QA 1RLUA 2FWIA 3AKDA 3IH5A 3KB1A 4DMCA 2IODA 4K40A 4KQIA 4PC7A 4C0LA 5JAIA 1Z2DA 4A16A 4P58A 4Q9NA 1Q7BA 2Q7DA 1KEPA 2R8PA 1JBQA 1G3UA 1T91A 3NV7A 1F7VA 1EB9A 2ZIXB 1CXZA 3AY3A 4QYIB 1Q3TA 1MTOA 1BXGB 3KQSA 4IVQA 1AURA 5E4FA 4HWPA 5EVCA 2DSNA 5F3WB 3E7XA 3BCRA 5LNK6 1HTTA 4NL4H 3KTAA 4HRAA 1G3QA 4IVNA 2M98A 5CW1A 1KDOA 4ZCIA 4TMKA 2A86A 1VBNA 3DTVB 3BZWA 5M04A 4G1FA 1CZUA 4BO0A 4EGCB 1EP9A 1VLZA 5EKSA 4GE3A 4J3JA 4EFKA 2I29A 4OG2A 4C6HA 2BMEA 4MO2A 2FRVA 3JQPA 3EGDA 4FD3A 1PG2A 2RK6A 5TDHA 1H22A 1T3GA 2H0RA 2VTEA 1QR6A 2W0SA 4U2EA 4MYRA 3R7NA 1EQ2A 1UAGA 2ZBGA 4LEIA 3VKVA 5HUHA 1W7AA 2I9KA 4ZK6A 3HDJA 3PNSA 5C1IA 4EHNA 1P9WA 3GBPA 3FTQA 4WA8A 4CGZA 2QTVA 3CT4A 1A8SA 3C8ZA 1BOOA 3R5KA 1J42A 4MV0A 4MRSA 3ROMA 4LXHA 3SN6A 5FBKA 4CXMA 1JP7A 5LBIA 1WZEA 2HYIC 1H6CA 3KE8A 3L7MA 4QPDA 5C37A 3IAS1 3ZKAA 1W4LA 5FWXB 5I7FA 1KEEA 1E2LA 1WXHA 1H4QA 2WSMA 3R20A 2X5NA 3HA5A 1UBEA 5CCDA 5ADUS 3P0HA 3WAGA 3ONFA 1HNWB 1QHNA 4GP9A 4B47A 3DKVA 2ATVA 3VMFA 1TYZA 2ATXA 3QHQA 1BN6A 4B0OA 3NJ8A 3CVJA 1H8EA 4GNKA 4U7HA 3TQRA 5KU7A 3H87A 3O75A 4G0OA 3AEKA 4DYHA 1TECE 3N8IA 1E7QA 1J5EB 3ZWMA 3HRKA 2IY9A 1XZHA 3KJNA 1ISFA 1WUYA 1VE7A 4D5GA 1G6HA 1TRHA 3CY6A 3LX6A 1QWOA 1GPDG 4RKRA 2BEKA 1ZUNB 2XVZA 1PDWA 2KLHA 4XWTA 2ZTSA 1W59A 2CK3A 4BKPA 4I1UA 4E4TA 2I4RA 4HRYA 4OUDA 4C7JA 1O97C 4HB2A 2B30A 3PUJA 3T34A 1MOZA 5A3QA 3GLIE 4MVYA 4AQYB 4JAVC 2QM8A 1RM5A 2WA1A 4D4GA 5B3KA 5HOQA 3LO8A 3GGOA 2MSLA 3M4NA 5F3RA 2H4JA 1VYUA 1KHTA 3WFZA 3LVBA 2YMQA 3BRQA 5DN6D 1A7JA 3NRBA 5DX0A 4BDTA 3DMDA 1CDEA 1TIBA 4Q34A 4YMGA 2A9RA 1A2KC 2YC2C 5JSUA 1MC4A 1BQ3A 1XCBA 2JA2A 2F9FA 3ELBA 5FUMA 1UMBB 5LZ5A 3WMEA 2QD4A 3B60A 3ZWNA 4FIDA 4PYOA 3DO6A 4KODA 1P77A 2R8XA 2ZRPA 3V33A 3IULA 4H9GA 3WWDA 2IYTA 2XNDD 5FBWB 2NO5A 1H1TA 1Y33E 3FKQA 5MN6A 2P2YA 4F1WA 1HE3A 4AN1A 1JEDA 3B3FA 1ZU5A 1SOAA 4NOJA 5EA2A 3LTEA 2B4QA 4BUJA 4XA8A 1YC5A 1DBVO 1ESZA 3A2LA 4BGUA 4MVCA 3SHFA 1LW7A 1BYUA 3WRXA 1I5EA 3L1UA 4CM8A 2GZ2A 3K94A 3BJZA 4HYQA 5CR9A 1Q3HA 2NN3C 4OI0A 1LW6E 1W8IA 2BZ0A 2O5RA 4KV7A 5H9WA 3UO8B 1J2EA 1ZGJA 2GCIA 4YAEA 2HPZA 1KK3A 3TEJA 2H3EA 2QRUA 3NHKA 1KDZA 3TSWA 4XWKA 1SXJE 1O5OA 1G6Q1 2QVXX 2Z98A 3N8GA 3KOZA 1TM4E 4OXKA 4XLLA 1GKIA 2R44A 4EYKA 2AG1A 4BU1A 3ER8A 1QQAA 1RI4A 1Z8FA 4YWHA 4NQZA 2RAPA 3PRHA 1YZ3A 4R81A 1NJ8A 4UTRA 5IEJA 3K3PA 1KI2A 4ZVQA 3MYYA 1Z0AA 4NJMA 2VWQA 1U2EA 4Q4HA 2WKRA 1SXGA 1KPIA 4Y6OA 4WY5A 4B6PA 2VWPA 3PU6A 2OCYC 4C0QC 4OIMA 2GLUA 1HOXA 1GAJA 1VL1A 3DS8A 3FZEA 4PZ0A 4Y7DA 5E6SB 3VAAA 3JAWA 4G0UA 3PDWA 1JYSA 1Q95A 2YV2A 1NAHA 1XNHA 4RWEA 1G21E 1V8ZA 4OEHA 3DNPA 2IYQA 1PTJC 1Z45A 1UIMA 2PDAA 5HJEA 2GBGA 1T2UA 1UIRA 1PQUA 5EJFA 4X3CA 4CKYA 4YHHB 2VEDA 1P2FA 1QG0A 4HDRA 4LCJA 4RKWA 1EAYA 1WXGA 3A32A 1L4MA 3E5RA 4D46A 2WJWA 1GADO 2EAUA 1GZ5A 2DQ4A 5AK0A 2JFFA 2Q41A 1IEQA 3DE0X 4WXMA 4X00A 4IDBA 3I2GA 3OTWA 1GG2A 3HWX1 4DA0A 4FFLA 2OPHA 4JX8A 4ESEA 5TLSA 1B7GO 3ECAA 4GBJA 5K6AC 3EXEA 2REQA 2FW6A 3RBZA 3EPJA 1EP3B 1K4MA 3HI4A 2GZSA 3X1MA 3I8OA 4GI2A 1OVGA 4IIEA 1EG2A 1WMFA 2OXRA 2VRCD 2ZOSA 2ECPA 1TM7E 3GEPA 3QPVA 5EXDA 4EEKA 1WD7A 3LBHA 1W48A 3ECCA 1UWLA 4OHXA 5BV1A 3K8ZA 2B6NA 2VDOB 1X1BA 3FROA 4ZJYA 4Y2GA 4A5SA 2BFAA 2PQMA 4IRUB 2FWBA 2YS6A 1CEYA 1L7AA 1LBIA 4ALNA 4F46A 4L5YA 3V8RA 1J0BA 1YR6A 1Y5IA 1WWKA 3ZVLA 3D0RA 4KYIB 4RZSA 1GD1O 3KQWA 4IY1A 3PJEA 2QRKA 1ZISA 4XYMA 4QUEA 1NJGA 1Z2NX 1DHTA 4E2YA 5K8LA 1JQAA 3PENA 2O3JA 4LXUA 4D8YA 3QF4B 3GP3A 1V4BA 4JITA 1E2PA 3NWPA 2I2WA 4KIWA 4ZYVA 1XA3A 3T7CA 2G06A 2ZRQA 3LLCA 5SY9A 4GGOA 1US8B 5K20A 3BXGA 2GPWA 2GHIA 3EQ7A 3H19A 4LI3X 3RF6A 1RQLA 5KNLA 2ACKA 1V2GA 3IP9A 1S7CA 1ZJYA 4A26A 4RTKA 1QWSA 1ZRHA 4D4HA 1P1BA 2HK6A 2MDTA 4X45A 2WOJA 4YPFA 5A4MS 2QJRA 5JH7F 5B1IA 1GGHA 1LF5A 2ODTX 2OQRA 1TFUA 3BGOS 1ZM2A 3PHLA 4YONB 4C0JA 4NOMA 1HZZA 1JFVA 3IAUA 3LRPA 5KX5B 1N3IA 2Y92A 2EKLA 4Q3OA 3ZCVA 5HMMA 5B7NA 3UT5B 2QLLA 3DLAA 4EUFA 3FA2A 3G0IA 3T9FA 2QAGC 2QVLA 2R7AA 4E5MA 4RGQA 5ICSA 2JLVA 4FMCF 2WYIA 2XT9A 3FHTA 3ED1A 4KQFA 4WWHA 1ISJA 3GG9A 4AU1A 5HZGA 2UZ0A 2WE7A 4Y2UA 2P67A 4JJGA 4F71A 3SHOA 1BXRB 4MP8A 4AL4A 3WL4A 3R0JA 1L4BA 3VSEA 3MCUA 4BKOA 4RD6A 2QOEA 4LQLA 3WK4A 3ST7A 1WPXA 1A88A 1Q5PA 3TLCA 4CWAA 1KS2A 2SICE 1QIMA 2CNDA 2XIQA 4EMTA 5K1ZA 4O59O 1JIJA 1FRFS 4HYYA 5BOSB 3QIVA 3WYBA 4BWFB 2O8FB 1KDTA 1P62B 3ZTTA 4FI3C 1M5UA 4F60A 3TF5A 3MJTA 1N1EA 1MABA 1Z2OX 2JGEA 4MXDA 4OXYA 4GZLA 3T7KA 4DBZA 4E15A 2DWUA 2UU9B 1K9VF 3FBTA 4X1YB 1Z2EA 3QUTA 4JGIA 5DSTA 3K2IA 3VOSA 1XFDA 1STOA 1WKCA 3QBJA 4LW8A 4OQFA 3GN1A 3SYMA 1ODCA 1GAEO 5K01A 3EOZA 1S2OA 2FEOA 5LLDA 1TUEA 2WT8A 1LSUA 1SCNE 1QZZA 2Z09A 2V7PA 1MJ5A 1VHWA 3M9LA 4NY1A 1TJ3A 2BF7A 3AHDA 3UV7A 1RHKA 5EFOA 4NE2A 1KJWA 1CUEA 2XMBA 5CJ2A 4ALKA 5HJ5A 3ZW7A 4NCHA 3PNKA 4ZQHA 3NANA 5AVTA 4KMMA 5DW3A 7MHTA 3RLIA 2ECKA 4GYWA 4MULA 1YK1A 1SC9A 2I76A 4A0SA 3FUXA 1XK6A 1CQIA 2W37A 3IKMB 1X2EA 1N2CE 2OE2A 2WZQA 2ZIUB 3O93A 3PT5A 3Q7EA 1WB6A 3CRW1 4I6JA 1NT4A 5AT1A 5KWIA 1PGJA 2R5NA 3JQBC 1TQHA 1VLLA 3VPHA 2IC5A 2P9BA 4PYJA 1SWWA 2VWGA 2ZSKA 3IIEA 3U4HA 1KH3A 5FLYA 4ZEOA 4JS0A 1MHTA 2KWIA 3OZTA 4V0NA 3CJRA 2VZ9A 1Y5RA 2KLBA 3GVPA 5CYOA 3REFA 5FNVF 4DXAA 3F96A 1I3MA 1JEYB 5FWYB 1TYDE 2I7VA 5HE8A 4MW5A 4L50A 2CUKA 1IN7A 2Q1XA 4EG3A 1UMDB 4OMUA 1EVJA 2Y1CA 2QR2A 3ZK7A 4CV0A 1K6XA 1CDZA 4JJ4A 1W85A 2DFNA 2M2IA 3BGWA 3IUPA 4R2XA 5K03A 2ZVJA 1W0JA 2GBCA 2GXSA 2CFTA 3T3DA 4YAGA 1R6DA 3IAFA 4LZJA 1TMKA 1N7JA 2H4WA 5DX8A 4K28A 2I2XB 4KAJA 5ETJA 1J6UA 1XB2A 3IBGA 3LECA 4O4LB 4TXJA 1KETA 2EBFX 1O1YA 2G72A 2J31A 1W34A 2QNRA 4QARA 4TXMA 4WFIA 1QHIA 4CT4B 1A1VA 1G8JA 3EZLA 4DPKA 1F1BA 2BFFA 4BYGA 4Z9FA 1BVYF 1JZQA 1NVKA 3VPGA 2BMWA 1OLSB 1YRLA 5EJEA 4F91B 4BO6A 2Q4OA 5ALLA 5L6MB 2C2XA 2ONZA 3F6RA 1NBMA 1I1NA 1OJLA 1CUYA 1B6SA 3BAZA 3FVVA 5B53A 2H57A 7REQA 1PV2A 4NPCA 3NALA 5JVDB 4OLFA 3G5AA 2V6FA 1QE5A 4RVHA 3HXTA 3JQDA 1WCYA 4ZREA 1ODTC 1O94A 3PFHA 1DV1A 2ODEA 4DSTA 4RL6A 1BXKA 2Z2KA 3L18A 3LQ1A 4ZQIA 3K53A 1L8LA 1S89A 4GRAA 3ZDZB 1SA0A 1Z07A 2E55A 1USVA 4TQUS 5FL3A 4UM7A 3O1LA 3KQKA 4KN6A 3INGA 3BFXA 1GIAA 2B1JA 2Q5HA 2VDMB 5KWVA 4HWGA 2NAPA 3NDRA 4Z0NA 5H82A 4R05A 5IKMA 1TKAA 3DUFA 1JJ7A 2DBQA 4GMFA 1XK7A 5BPFA 1S0UA 1ILWA 4OJYA 3BEDA 2FRDA 2MTBA 4ZIRA 3AB3A 1M0WA 2E87A 3GFVA 2BGNA 2OC9A 3MK31 2B94A 4JX9A 1RYEA 4CIBA 4BVHA 1DAIA 2B2CA 2DR2A 5EI5A 5AVOA 3I6IA 1GLGA 5B2FA 3OLXA 2G9RA 3LT1A 4IDGA 4P35A 1A5SB 3NHJA 1MPTA 1YB2A 3FOWA 4QODA 1RHJA 4BVKA 5T67A 3U6KA 1PZGA 5DPMA 3D6VA 1H2YA 1S8FA 4Z99A 4TZKA 1FRNA 2DAPA 3U3JA 3QU9A 1KP3A 1SY7A 3CBGA 1NBMD 3P9XA 4NOKA 3PD1A 1R7RA 3OSZA 1P0FA 3IPCA 1JGTA 2HF8A 4O4JA 2JAOA 2PX8A 2B4KA 5KSOA 2TS1A 5CA0A 1XDSA 2V6JA 3TQOA 1MJHA 5IZCC 5ICMA 1FP7A 2I1QA 3IAHA 5DSZA 4G63A 3VSCA 4BQPA 1U28A 4OXNA 4IEIA 2PJUA 1YBAA 1LUAA 1YVEI 2YV3A 3RTEA 3GFFA 3ELUA 4UBIA 4F3NA 2DERA 1PWZA 2DPYA 3DVRX 2AHOA 4QPPA 2Y77A 2PX2A 3IQIX 2EZ9A 4OP1A 1EEHA 2QGZA 3VZDA 3SQXA 2B3TA 2YW9A 3MCAA 1SXJD 4K6KA 4ZAFA 2R62A 2X0DA 1YJCA 1CDOA 1UJ5A 4YGXB 1U3WA 2YHAA 2YVLA 2EX0A 3Q5EA 2ZSJA 3JVUA 4UHKA 1TCCA 3SXPA 3FDZA 3M4JA 2QG4A 5FXMA 1FDUA 3KYDA 4I5EA 5JS7A 1ZJ6A 5HIAA 4E1AA 2ZRBA 1QF7A 4J49A 1X7XA 4P92A 5AHKA 3BREA 3EEQA 3OQOA 1Y7TA 3G89A 2PJZA 4OBWA 2CUZA 1KI6B 1J5PA 2GN0A 3B38A 3WC4A 1JG7A 1I2ZA 1B6TA 2GBPA 1XZCA 4RK0A 1Z7WA 3AI1A 5SZHB 3UOWA 4F96A 3QNUA 1P3JA 4LVOA 3C6XA 2IVFA 3RO7A 2Q5JA 1CF9A 2ODWA 2PX5A 3GEBA 3WQRA 1ZNZA 1I01A 2OCIA 1CS4C 4B3GA 3B9RA 1YB5A 4PSKA 1FS4A 3N59A 1KAOA 3TEFA 3TAUA 2D13A 3F0TA 3EG9B 4J0IA 4UCWA 5MN5A 4EKNB 3O2QB 5L3QA 2WWWA 3G9XA 3PXGA 3JSAA 2WWYA 1V5EA 4QGFA 4NYMQ 4DLBA 1UC4B 2PZ8A 1JVNA 2V9CA 3PUZA 4AP9A 4XWAA 1J33A 3ZWXA 4D0GA 3B20A 3D31A 4IVRA 3RLFA 3WYGA 5JNLA 4LY9A 4C14A 1H94A 2IHKA 4AY5A 3S6JA 5LLTA 1VA5A 2GF9A 3IJEB 3NP7A 3LHIA 1DCMA 1KYYA 2ALJA 4IOKA 4LZWA 4OGKA 5G1OA 4OQYA 1FJGB 1IWPB 2PMWB 3EVNA 1ZIDA 3M5WA 3FYUC 4QXMA 4CQMB 5B1YA 4LGYA 3T52A 2WTUA 2WM2A 1B43A 1E8MA 1H8HD 1GXSA 4B1FA 1DAGA 4PFKA 5JO0A 3RVLA 3GD5A 1RRVA 3E4DA 1A4XA 1YUNA 2P9ZA 2R1VB 2XMDA 4FQ8A 4GWKA 4LYYA 1OLUA 5FPQA 4MX8A 2PUHA 1ZAYA 1G7SA 2KM1A 1NQWA 5BYJA 1G2PA 4CFSA 3BWDD 2BGIA 5DTMA 2XMPA 3IVGA 3KEFA 2AKAB 1PVOA 3BTOA 3PUIA 4R6WA 2ZYTX 5D3ZA 1T34A 3T15A 1EVLA 3UN1A 2ZBFA 1O6FA 3CN9A 2FQQA 1VLMA 1QPZA 4BNXA 2AUNA 3LRTA 1BFDA 2J08A 2V7BA 2YZNA 4N5DA 4ARZA 5LNK1 5AKYA 1P29A 3BWXA 3C8HA 4GOXA 3BMOA 4O4HA 2WSYB 1HDCA 1MIOB 3PLNA 4BCDA 4NHEA 3ZE1B 1NWHA 3D5EA 5AWFC 2MMCA 3IB3A 1T43A 4QSMA 2OSBA 2VKQA 3PXDA 3UMSA 2A1UB 2Y8EA 1SVLA 3UJBA 2GF0A 1G4AE 2YDXA 5LWHA 3EASA 1JIQA 1NXXA 2V5UA 4MTLA 1XJ0A 2BJHA 2QUJA 2ZUTA 4DM4A 1CY0A 5JQGB 4L0CA 1AHNA 3DLIA 1LSOA 1IQUA 1I3LA 3KTOA 4EA7A 1G21B 1T29A 2AW3A 2Q8NA 1P2BA 3QK7A 2ZUUA 4OXRA 2WE8A 3JWGA 5TPWA 3WADA 4MKIA 4CM6A 1IQRA 1TDJA 2PGXA 2RHCA 1EVYA 5A7HA 3ZJYA 4DB4A 1S2MA 2VAXA 1NUQA 3HLKA 5I9BA 2Q1UA 1YZFA 3TIXB 3ZE0B 3DYVA 3UWPA 1OLXB 4F38A 1XHEA 3O73A 2P9EA 3QVKA 2IGTA 4LNAA 2W6JA 2X0NA 1A4RA 4C4XA 4YRMA 1S8OA 3P9QA 4PLYA 3BIWA 2VAMA 2IHVA 5KTMA 1NTOA 1A4UA 3HXPA 2CZQA 4P2GA 5CH3A 3EGXB 1TVKA 2VSXA 3PNVA 4G2NA 4HFJA 3N05A 1V48A 2XKAA 3BYZA 3QEMB 3K9WA 2P0YA 4N76A 5SZKB 4B09A 2B2NA 5AVSA 1R8YA 2XJ4A 1T6NA 1TTPB 4PPNA 3CTPA 2O0KA 5E7QA 1ID1A 1K4KA 3STXA 5KMGB 3U4QA 4RKYA 1P60A 2FPWA 1X7XB 3DHNA 2ZIWB 1QH1B 4CM4B 4LHYA 2ZE6A 3I58A 3T1OA 1SXHA 3JWIA 2E4AA 4I9UA 2G8NA 1TEHA 1LNZA 5TY0A 3CM0A 1XTBA 4WN9A 4J91A 1PDVA 1W0KA 4EIWA 3OU7A 2P68A 4L22A 1EFLA 4YMTA 4KQ1A 3DL4A 1X15A 1QH8A 4QTZA 4B7AA 5C5EA 2F3SA 3DZGA 3E9EA 1I0ZA 3QKSA 3IP8A 2VYVA 1L4LA 3IUMA 2OECA 2VJMA 4ESVA 3OOSA 2I03A 2J5RA 1WHSB 1KYXA 2G0TA 1P1KA 5DMXA 3W78A 4CDNA 3GT3A 4K03A 3D81A 1QMGA 5T4FA 2H7YA 4YMSA 3NJRA 2GWHA 3H8JA 4PZAA 2AEMA 2OV8A 4KGVA 3K0KA 1BE0A 1QZTA 2QSUA 4D98A 5HIIA 2HW8A 2OK8A 3VZSA 2VHQA 4C1NA 3WDSA 1YB1A 1KMCA 3RK4A 2OLJA 5BRJA 3PC2A 2RMKA 2RSLA 2HPVA 5FULA 4DMUB 1V7QA 4FSXA 1QP0A 1WXDA 2K2QB 1M7HA 1Q83A 2VXCA 3EJ6A 1BDBA 3ABIA 4IO1A 3DSRA 2D2FA 2QN8A 2C7OA 4C4TA 1NXOA 1QHHA 2WF5A 3QPAA 5DYYA 2CC2A 2G70A 4QM7A 3LD9A 1W36D 1E1YA 1E8DA 2ZVDA 3T4EA 2YH2A 1XPOA 3EOBI 1NX6A 1TADA 2PPVA 2BR3A 2VSFA 4QJIA 4QQNA 2FSSA 3IAM6 4H6WA 2PZJA 2P79A 3YASA 1W5BA 4BE7B 1GILA 2IF0A 4J7AA 4IJ6A 5CDTA 5K2OA 1NJSA 4ZHSA 1FXUA 2BUBA 2BEUA 4DLUA 4FIZA 4BZQA 4MUKA 2BVNA 2Z4SA 3LDFA 3DOOA 2QKYA 3M49A 3C1UA 1W75A 3ZVNA 1H5NA 4MA5A 1Y9AA 4GM0A 4O2AF 4OHPA 5E6UB 3ZBTA 5L7WA 2FR0A 2YWBA 2HJRA 3QFSA 4KQXA 4LRWA 3ZOKA 1CUAA 1V5IA 1WB4A 3U7EB 4EX7A 1XQWA 4RD0A 5DRTA 4MUNA 1EWRA 3GQBB 2JIBA 4KBYA 4EG7A 3WB2A 1W8DA 4IO0A 4WLFA 5F2OA 3T3EA 2IHZA 3QX9A 3BE6A 4ALIA 3FTNA 1QPGA 2EATA 1Z38A 1QC5B 1GVNB 1QHFA 3HQ4O 5B37A 3ZR4B 4BX3A 4F21A 1WEKA 1MX9A 1W47A 3G5UA 2D00A 4H17A 4H3VA 4J0GA 4KQEA 5IBRA 4YRRA 4Q9AA 4E70A 3LVFO 1CY6A 4KACA 3U7GA 3PXCX 4G1MB 1NDQA 4DIDA 4TTSA 5CITA 2O8VA 1OTHA 3K9BA 4L07A 1T9DA 4W7IA 4B9EA 4UTNA 2EWMA 1GA1A 2H0AA 2Y1EA 1GNRA 3HYLA 4ZZ1A 3AJEA 3NORA 3QBVA 1QJCA 1TUIA 2B5OA 3IE1A 3GLHE 4P33A 5KTPA 1KQGA 2C20A 2PTGA 4U7JA 1HT2E 1X74A 4DLZA 3AJRA 3RUIA 3FWZA 4IG9A 2BOVA 5K3FA 1ZSYA 1IJFA 2LR0A 3HEAA 1PQYA 1Z18A 2KBEA 3CCFA 3L0ZA 5IMBA 4NFLA 3IR7A 2A2ZA 3ELDA 4Z7JA 2V55B 3OX3A 3QXSA 2VYVD 3BSSA 1GCIA 3S5JA 1NXTA 5B6PA 1RWOA 5E6UA 1LD3A 1NPDA 2H5EA 3R6LA 4MW6A 2C95A 3OJOA 3ZXXA 1P9RA 5C7YA 2WU1A 3ENZA 2O54A 4QU8A 1RACA 5TMEA 3ZS9A 4ZOLB 2CFIA 2O23A 4QUIA 2WEKA 4KO3S 4PXYA 3L49A 1JQEA 4O63O 2TMGA 5L3VA 2O5EA 3G8AA 3ND7A 1J8MF 1HETA 1T8YA 2BEVA 4IH9A 5JHHB 5M7EA 3G2QA 4GRDA 5TRTA 3ND8A 2XITA 4HQKA 4EF6A 2VKTA 2R6ZA 2BCJQ 5D6OA 1VHTA 2H5JA 3OU6A 4IGEA 4XYBA 3V4FA 3NDJA 3VTKA 3WB1A 3KU1A 1QHHB 2VDWA 4N8SA 1XEXA 1H2FA 1FK8A 3PDHA 3W6UA 2ZAIA 1B0ZA 4NZOA 1GV0A 3VJKA 1PGPA 3P9IA 4GX0A 1ZIPA 1NXQA 3DCNA 1DAOA 3QU5A 3F6YA 2EKBA 4TLMB 3VJRA 2QSJA 4QDKA 3HNPA 4OJTA 3ZWWA 1KJZA 1U3DA 4NIMA 5F51A 3ZDXB 3DDSA 1IPHA 4DMGA 1I2CA 1C4KA 1U94A 2CEAA 2R6AA 4R2KA 5KWEA 3QXGA 3OIWA 3U4IA 2DF8A 2QG9A 3DZBA 1HH4A 4BCBA 1NDUA 4QBGB 5A2QA 4JP5A 4E32A 4EH1A 3AHFA 1UMBA 2QPAA 3JQFA 4IWNA 5K0TA 4ZMBA 5KS2A 2OHVA 1HTWA 5K2MA 3LKVA 4UBLA 1MGPA 3TDNA 2C31A 1K7EB 1OT3A 3JWEA 4TGLA 5BOSA 4IIUA 2Y9MB 2EOAA 3UQYS 1UXJA 1U7XA 2GM9A 3IBTA 1Q7RA 3BB3A 3NVAA 4US1R 4F92B 3OI7A 3SQLA 3LNTA 4TV8F 2PK3A 1F8GA 3WZLA 1VYTA 1G19A 2O57A 1RWMA 1B6GA 3KHSA 3DGEC 1KZGB 2P11A 3QJYA 3VYUB 3GPCA 2B8WA 2UXCB 2P0AA 3HY6A 1C80A 3CNLA 4MH0R 3CZQA 2Q3FA 2ZBVA 1QOZA 2I8LA 4BEVA 4X3PA 4H6PA 2BR5A 5K6RA 4XGRA 1WSWA 4II7A 2JCXA 4N41A 3D4BA 2QRLA 3AILA 3ESZA 4IKPA 1P2DA 2O0LA 8MHTA 2CBGA 3AESB 4KUHA 3N8HA 2HMTA 1PQPA 2C59A 2Q3EA 2P2DA 1Y8CA 4BVFA 4EPYA 1L5HA 3T0GA 1UMKA 4OOFA 2EGHA 3NS7A 5A71A 4QGAA 1XELA 2H63A 1II9A 1MAHA 3GRFA 4QBFA 3UB2A 5G0SA 1Z2CA 4HZUA 4RS3A 2DBYA 1ZUIA 2B1QA 2FZGA 2ILTA 5EIWA 3V9AA 4EHFA 2W4IA 1N7GA 3NDPA 4YBZA 1ZM9A 3PPWA 2O7QA 5AK3A 3AXSA 4L4YA 2Z9DA 4R3WA 3RVSA 2COEA 3FWHA 2W2VA 1KMQA 3R74A 3ZD9A 1UFVA 2JJ1D 2QP9X 4ZC8A 1E9CA 1L5LA 1Z0KA 3DXXA 1B1AA 4CHGA 3A37A 3IMFA 4MITA 5L4SA 4MB6A 1AKRA 1EX7A 1PJ2A 3L4BC 4F11A 3RQSA 1T3ZA 1VLHA 2FQ1A 1IUPA 2VDPB 3IV6A 3LK7A 2XRFA 3HCNA 3QW2A 3IA7A 4PLVA 3N2NA 4YALA 2WFMA 2AQ8A 3Q2OA 2XPCA 4L4RA 4URVR 3PRJA 5FPHA 4OH7A 4W5RA 1AQYA 3OC6A 4RPJA 3S7ZA 4CQLB 1KZ9A 4KR2A 3L7YA 2P1ZA 3ZE2B 2OA0A 4EKDA 1IG3A 3QTTA 5AJTA 1MRSA 3I9MA 2P7IA 1EEXB 2ZCVA 5EHXA 2C54A 2IF2A 3UMYA 1KJQA 2OQVA 3TFOA 2Z8ZA 4KXYA 3VJMA 3DMRA 5KQGA 2V59A 3FOFC 5JBNA 2ZM6B 2Z6AA 5JI3E 5I9TA 1I4WA 2NZUG 1R5JA 3IVMA 2IZ0A 4R9SA 5AKLA 5JADA 5DOVA 4ZC1A 3TI7A 1JR2A 2GAOA 1DOAA 1I1QB 3LO5A 8LDHA 1OAOA 3HL4A 2E3JA 4HZUB 1E96A 1PEAA 2RK3A 1N6IA 2C4MA 3JV7A 4R8LA 4XDYA 3SJ7A 2Z4TA 1HR0B 3U48A 3GGSA 2JRCA 2WTEA 4EKYA 2EF0A 1NRWA 3GAFA 4UC0A 4QULA 2F1KA 2OOKA 1CQZA 1PDOA 5FBLB 3FGOA 4RSMA 4BATA 2WIDA 4RZQA 1GTRA 1AUOA 4KLAA 2WJYA 3AUFA 3CLUC 3EZ7A 3S1SA 1FXSA 1KRWA 2XE7A 4MW9A 3WLMA 4BECA 1GNPA 2WD7B 4XWGA 4RZHA 5JR3A 4I8IA 1SFRA 1T0HB 3H2YA 5K0SA 4RK6A 4L78A 1K4YA 1Z0FA 4BAZA 4DG8A 1JMYA 1NVVQ 3L02A 2R4UA 1DCKA 4KPFC 3ZDBA 4WBXC 1IXKA 1JHOA 221PA 4V03A 3TJZA 4AG6A 4Z4GA 4X6YA 3R0QA 2WMDA 4S1PA 3V1TC 3MHPA 2EWWA 4M99A 5EJ4A 1YGYA 2Q6LA 1JRLA 3B53X 4PC3A 3HC7A 4YI3A 5D51S 2PNJA 4GEKA 3VKFA 2R7MA 3IQGX 1SJ9A 4QDZA 5CFPA 1D6NA 1EJ0A 1QHSA 3HACA 2OEPA 3C2QA 3LT2A 4GMDA 3GG2A 3IL2A 1HFEL 1GJRA 1ZP6A 2FP3A 2IYSA 4ZT2A 3BM5A 1YIDA 1T36A 2UYCA 1ATIA 2RBKA 3EISA 1VYVA 1QAOA 5AVRA 3QA9A 2E1PA 2GKGA 4I4TA 3DBLB 3O1HB 1EXWA 5ICFA 5D2CA 3ROEA 2VHEA 1MB0A 4ZAWA 1O96A 3AEXA 4RVGA 3QEBZ 1MABB 3CUSA 4IMRA 1E7MA 4M0PA 2W6NA 4WEOA 1O95D 2C1EA 4XB6B 1LJUA 5E7IA 4BBAA 3P0JA 1XEAA 2Z3WA 3D59A 4CM8B 1XLWA 2BM1A 5JNRA 4GF5A 4MGYR 4I50F 3WGOA 4OBBA 1L7BA 3MILA 1GGKA 4KJXA 4M87A 4WY2A 2NU9B 1WX1A 2GB4A 3IAM1 1VRCA 5CD1A 5EE1A 1FZQA 1IBMB 3L8HA 3LYAA 2EG5A 3G7SA 4U3JA 5AM1A 3CA8A 1YKSA 2OC4A 5CM9C 4C7OA 1SZJG 3GFPA 4H31A 3PXAA 4F5DA 2C4TA 3ASYA 2OHJA 5GMOA 3A9TA 1MOPA 2BGLA 2Q46A 2RHRA 3WI7A 3OFJA 4D9EA 4DDKA 1ADCA 3WAKA 5CBPA 1EGVB 1L7RA 2C8KA 1DQZA 3V6LA 2DULA 1CQWA 4I1RA 1S1MA 2QZ9A