2NT3A

Receiver domain from myxococcus xanthus social motility protein frzs (y102a mutant)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
SKKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRKLKAHADEAVAKPVDADQLVERAGALIGFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator homolog
publication title An atypical receiver domain controls the dynamic polar localization of the Myxococcus xanthus social motility protein FrzS.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Signaling protein
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nt3A00
3IPAA 4YR7A 3OLYA 2LP4Y 4NQRA 4RV5A 3TX6A 1FSPA 2WJAA 1MB3A 4NCBA 3TO5A 4G0MA 1USGA 1U2QA 1YMUA 3OQNA 4YO7A 4JA2A 4ZMRA 2L17A 2ZWMA 1YK1A 4H3KB 3GBVA 4D6YA 5TQ0B 1FFWA 2L18A 2N9UA 3O74A 6CHYA 3RVOA 4Z4FA 1ZVVA 2MSKA 4TMYA 4LDAA 2LIVA 4RY8A 2MYUA 4LE2A 5TQ2B 3CU5A 1AB5A 3QLTA 3OM0A 3QELA 1U0SY 2P9HA 5HM6A 3OLXA 3KHTA 3KTOA 1BDJA 4MR9B 1F51E 4IGAA 4MQFB 3LUDA 4ZJPA 3H6GA 4LZLA 4RK6A 2DRIA 3JTEA 3GL9A 1RZRA 2A9OA 2VYCA 2WWVD 1QP7A 1YK0A 2QSJA 4S05A 2JCGA 4RY9A 1JDNA 1IIBA 1KRXA 3QLUC 3DBIA 4UHJA 3DLBA 1YTUA 3NNSA 1YIOA 3T95A 2GWRA 1DP4A 1LBIA 1M5UA 3QEMB 1T34A 2FEWB 3QLVC 1GUDA 4EYGA 4W5TA 3LUGA 3CFYA 3CTPA 3H75A 1ZAYA 3O1IC 1DBQA 4F12A 1RZRD 3HSYA 3RVRA 3Q15C 1A0OA 2ID7A 4DQDA 1LK0A 3F7NA 4YRZA 1F4VA 3BBLA 1LBHA 3N0WA 1JLKA 1DCKA 2E4YA 2IPNA 3Q7RA 4MS3A 1JBEA 3RVNA 4N0QA 1L5ZA 3N6VA 1EWTA 1R8JA 5EWMB 3C97A 2HQBA 3K9CA 3G1WA 5DCLA 1DG9A 1D1QA 5F64A 2MYPA 3MIZA 4FB4A 1D4ZA 2QXYA 3IP7A 2IKSA 5KQMA 4EUKA 3OLZA 1WETA 1NTRA 1DCMA 2FN8A 4HNSA 4YS6A 4W5RA 1UDRA 4WT7A 1KGSA 2E4XA 3H5TA 1TM2A 3SG0A 1KMIY 4G0XA 3RVLA 2M1ZA 4W5OA 3T6KA 3NHMA 2CHFA 2GBPA 3HV2A 1M5TA 4Z9BA 1PEYA 4L4UA 1JFVA 3GWGA 3H1EA 4HNQA 5KC8A 1GUBA 4KK4A 4XLTA 4KQCA 4MYRA 4ML3A 5IULC 1C0EA 3N0XA 8ABPA 3VNBA 1E6LA 1XHFA 5B3JC 1BDIA 2PLNA 4XARA 3GT7A 5EWJB 5BR1A 4G86A 3B2NA 1OXKB 1L5YA 4FE4A 4MQEB 3EAFA 3HK2A 4MS1B 1QNLA 1DRJA 5JNVA 4OTZA 2PL9A 4NICA 4OLAA 2PUEA 1NXSA 3SNKA 4GPAA 3QLUA 2AYZA 2F8SA 5TQJA 3O1JC 3O2QB 4RK1A 1YS6A 3C3KA 4QPJC 2YHAA 4RKQA 4XAQA 3LOPA 3FFTA 4N0PA 3SQNA 1FFGA 4S04A 3MYYA 3A0UA 2IYNA 2NT4A 3ILYA 3QLVA 4OBBA 1NXPA 1ZY2A 2W42A 3LUHA 4F06A 4G0QA 4IILA 1C4WA 4WXEA 4KPYA 2IOYA 4Q6WA 3VNAA 4EGSA 1QO0A 1JYEA 2B4AA 2CD7A 4IF4A 5KQLA 1Z2DA 1FFSA 2MSLA 2LUOA 5DKFA 3RVJA 3JPYA 2H0AA 3TB6A 4N41A 3BILA 3JVIA 4LDZA 5TPWA 1J56A 3HDVA 4RU1A 3HVRA 1VPWA 3H1FA 4MGEA 1QQAA 4N76A 2BGGA 2FVYA 5FWYB 2CWDA 5ED4A 5IUNC 4Z4CA 3C3MA 2PL1A 4LE0A 2VK2A 1NXOA 4Z9AA 1RXIA 4RY0A 3QEKA 3H5WA 1QO0D 4TLMB 1ABEA 1NXXA 4PYRA 4W5QA 2O20A 4ZYLA 1B00A 3BRSA 1JDPA 3LUAA 2FMKA 5GQSA 1URPA 1ABFA 2FSPA 1D5WA 5JNUA 4KQ9A 4G0OA 1I3CA 1HEYA 2CHEA 4F8JA 2WMYA 1JYFA 1JL3A 3KKEA 3GA5A 3QX9A 4RWEA 3CNBA 3RVQA 2PUFA 4MS4A 3N75A 2FLWA 2PMCA 3QEMA 4HYEA 5B3JA 4XXHA 5IEJA 3H5VA 1DC8A 3OO1A 1Z25A 4M88A 2FN9A 2RJNA 3E3MA 3BRQA 1AB6A 3ILHA 3E61A 3HUUA 3O2JA 4LRQA 3RVMA 3RVKA 3Q7SA 2IPMA 3OLWA 4PEVA 4WUTA 4QICA 2PJUA 1K68A 3ROFA 1Z2EA 4EYKA 3O75A 2PUBA 2QW1A 2GX6A 1LJUA 4ZMSA 7ABPA 3H5OA 2KYRA 2RJOA 2QU7A 2JVIA 3BREA 4GNRA 3FDFA 2HQOA 4CBVA 1SXIA 4KREA 5EWLB 2JBAA 3JPWA 3T38A 3JVDA 3M9XA 5KC9A 4RZSA 1NXTA 4KNYA 4MR7A 2A9QA 1DCFA 1M2EA 4MLDA 5KQPA 3KYJB 2ID9A 3F6CA 3KJXA 3A3KA 3QELB 4IMJB 3F73A 4MR8A 4OATA 4JAVC 5CNKA 4MPTA 1BA2A 4E7PA 1LJLA 5CNMA 4XASA 1MIHA 3LKBA 3D8UA 4YLEA 1PHRA 2OENG 4KZKA 3OMWA 3HO1A 2VUIB 3DGFC 5PNTA 3SM9A 4EYQA 5KWSA 1Z26A 4MRMA 3Q41A 1P6QA 1ZHHA 1SXHA 1GCGA 3HS3A 1VLZA 2WB4A 4RS3A 3HJFA 3NHZA 2MYNA 3CZ5A 2PAFA 3CHYA 3LUCA 4WXMA 1ZGZA 4PE5B 2MYTA 4D6XA 1EHCA 2FMFA 1JFTA 1QP4A 1E2BA 3T8YA 4EVRA 3Q7TA 4KK3A 1E6MA 1QMPA 2I6FA 2FLKA 3S99A 3LUJA 3H5LA 4EYOA 2PUGA 1DBPA 2YHBA 1MB0A 3TMYA 1DZ3A 1VKRA 4KV7A 2E4VA 2FEPA 4PICA 1BDHA 3CRNA 3CG0A 5CHYA 3Q9SA 5FWXB 3MQ4A 5JS1A 3C6QA 4KFCA 1PNTA 4G97A 4B09A 3KSMA 5FBHA 3OO0A 3GBPA 4RK5A 2PUDA 1RPJA 5IUJC 1DC7A 3LTEA 4Z99A 5BRAA 1JH9A 4Z4EA 4Z4HA 4EY3A 1GCAA 4O5AA 1RXEA 2L2QA 3RVSA 4RDCA 2QVCA 4N03A 1JHZA 1RNLA 3DZDA 2IPAB 4WZZA 3DLHA 3ROTA 4OLBA 3I5AA 4E7OA 1ZN2A 1U2PA 4FE7A 4NV3A 2Q5CA 5BQ3A 2R48A 5IX8A 2R4QA 1DJMA 1H9CA 2WJWA 4H60A 1DRKA 1SXGA 3EJWA 4TLLB 4JP1A 4F11A 5HKOA 3KS9A 5TQ0A 2FXIA 1Z16A 1XHEA 2QR3A 1JFSA 3CG4A 4RSMA 5DLEA 4RXUA 2E4ZA 1TLFA 1SD5A 5TQ2A 4N47A 5JNWA 4JASB 1ZDMA 5GOTA 4Z4GA 4QYWA 2HSGA 4WWHA 5JS2A 3NBMA 4MR9A 1A04A 3FFXA 5IEBA 3HM9A 3L6UA 4EVQA 2R25B 3O2SB 4MQFA 2WY2D 5T7BA 2NUBA 1QP0A 2XDYA 3FMVA 3HZHA 1EFAA 2AYXA 2WRZA 4G0ZA 4H3HB 1YVUA 3K4HA 2PE5A 1ZH2A 2P4UA 2HQRA 2M98A 2VUHB 4Q6BA 2NZUG 3H1GA 2LPMA 1W9HA 1NY5A 1Y1LA 4P98A 4YP9A 1PNRA 3MM4A 3IP6A 3FFWA 4RKRA 2PKXA 5C5EA 3CS3A 1ZITA 9ABPA 4UHKA 4IRXA 4ZPJA 1MAVA 3UUGA 2QZJA 4D74A 2ZAYA 4PZ0A 2FTKE 5KQGA 3MF4A 6ABPA 1USKA 3P9YA 3HEBA 5T3YA 4EVSA 5EWLA 5TPWB 1TVMA 4F3TA 2FMHA 4DADA 2B1JA 3OQMA 1OXBB 4L85A 5KI6A 5I4CA 3O1HB 3R0JA 4JB2A 2R47A 1M2FA 1CYEA 4NCAA 5CNIA 2OQRA 1MVOA 2RDMA 4QYMA 2FW0A 5EWMA 3GRCA 3QK7A 3SY8A 5JNRA 2JB9A 3IPCA 1CHNA 1CEYA 4KMRA 3HXMA 5FBKA 1P8AA 1E6KA 3D02A 3H5IA 2PUAA 2A9RA 1S8NA 3N8IA 5BRJA 2IPLA 4Z0NA 5C5CA 5HSGA 4ETIA 4MLCA 3OQOA 2RGYA 1QQBA 2J48A 1JX6A 2E4WA 3HCWA 4Q7EA 4YV7A 4ETMA 1TJYA 3NNDA 3H6HA 4KRFA 3OMXA 2HPHA 2HJ9A 1K66A 4MS4B 2E4UA 2JK1A 2QV0A 4W5NA 1NXWA 3I09A 3JY6A 3RQIA 3KG2A 1D1PA 3UK0A 4RK0A 5TPZA 4RK4A 3URMA 1Z17A 2MSWA 4DN6A 1P2FA 3N53A 4MAAA 5FWXA 2F8TA 3HDGA 2L19A 5EWJA 5D2CA 4LE1A 1Z12A 4YGXB 1YMVA 2V0NA 3GYBA 3I42A 3LMKA 3M6MD 3LFTA 3MMNA 1PEAA 4KVFA 5ABPA 4MQEA 4P1ZA 1EAYA 2FMIA 4MS1A 1ZH4A 4Y9TA 1DBWA 1NATA 2QVGA 3O21A 3OM1A 2FQWA 5JNTA 1EWKA 2X7XA 4XFKA 3RVPA 2GI4A 1A2OA 4YWHA 3KLOA 3EGCA 4G0PA 5TPZD 3KLNA 5CNJA 3GV0A 1U8TA 2JBAB 1Z15A 3QX8A 3JS5A 1W25A 1YS7A 4RK7A 4MR7B 2NT3A 1JWLA 3L49A 2LBPA 4MS3B 4G0YA 1Z18A 1JF8A 2A9PA 3IDOA 4MR8B 5E3JA 3EQZA 3A10A 4JOQA 3OLVA 3CLKA 3LKVA 5JNSA 4RXMA 1D2AA 2JVJA 3W9SA 2IDMA 5HQJA 4OG2A 5TE9A 3CZCA 5DTEA 1Z13A 4YCSA 1NXVA 4MRMB 1ISRA 5IUKC 4O1IA 3EDCA 3KYIB 5FWYA 3IP5A 1SRRA 3A0RB 3NNNA 4O1HA 1QKKA 1BAPA 5IBQA 3DGEC 3MA0A 4Z4IA 3C3WA 2FKAA 3RH0A 3IP9A 3LUKA 2NZVG 1BVHA 3HUTA 1GLGA 1FQWA 2PUCA 4RXTA 1ZESA 3EULA 1VRVA 3LUFA 3M9WA 2TMYA 2JRLA 1APBA 3KCNA 1P6UA 4TN5A 1KRWA 1TMYA 3EODA 1QPZA 3F6PA 4LX8A 4JB0A 1ZGGA 1PUXA 2FQYA 2H3HA 2JVKA 4IMIB 5IC5A 1USIA 3SAJA 3N0RA 2FEKA 5DGCA 3TD9A 2FQXA 1ISSA 4ETNA 3G85A 3UKJA 3CKMA 2GKGA 1U04A 1XWWA 3FGZA 1EWVA 3I45A 4HNRA 3EQ2A
chains in the Genus database with same CATH superfamily
2WF7A 1M2OB 2C98A 3PXEA 2HZ7A 1P4HA 3BZWA 3LC0A 3S70A 5IVPA 3K6SB 4DA9A 4NCBA 3VHQA 1FVOA 3I2IA 2XRFA 1R4MA 3DBHB 4MW0A 1SOAA 4MKHA 2EX1A 1CR6A 1HL7A 4PNPA 5AM3A 4UTNA 4ZXPA 1TMOA 1Y1PA 3K15A 1KMQA 1CUAA 2XVZA 1RU3A 3OWXA 5JSQA 4K9DA 1PZNA 3CLUC 1R4NA 1EVJA 1WP4A 1NOJA 2DQSA 2XZPA 3O8QA 4M38A 3SFTA 3TL3A 3WIDA 3OU7A 3L8CA 2VJPA 1TQ4A 2PGLA 3PRYA 2J0QA 2D3TA 3TBHA 1RWVA 1OIWA 1AKMA 2PJZA 5AR1A 3MQFA 1POWA 2FK8A 4L95C 5KWVA 1ZD2P 4QASA 2O8CB 5IDQA 4EECA 5JSZA 4NENA 5A62A 4LK3A 1PJ2A 4ME6A 2FG7C 2VG8A 3WGUA 4C2AA 2DRIA 2OPHA 3RROA 3HHPA 1PJLA 4K81B 4N6GA 1SRQA 4BGIA 1X1CA 3A9TA 3VR0A 3DMRA 4A03A 3A1EA 1I2DA 1GUYA 3NVAA 4B46A 2P1DA 3RTCA 1UJCA 1BJKA 1X80A 2SKDA 3WLFA 3T1YB 1ESCA 1P6XA 3G5LA 3HKBA 2Z5FA 3I23A 2JJMA 1M1XB 4ID3A 3QEMB 1L3IA 3WMXA 3W90A 4QOHA 3LG2A 1CX9B 1E2GA 1GPWB 2QG4A 3DZHA 5AI0A 3ZE8A 3E2MA 4DKXA 3QSYA 1Q1AA 2BGUA 1DEAA 1W2GA 4YJ2A 1MH1A 3L7OA 3RVRA 1A0OA 1LPMA 2B1GA 1FUKA 3MW8A 5AKXA 3UQYS 3HXQA 1RZUA 4Q9IA 1W36C 2HMAA 5CLFA 2W6JD 3NHAA 3PNVA 4P4SA 4JI4B 3PGXA 3RVNA 3OKAA 1UMBB 2JIRA 2WFZA 3Q5DA 3TIXB 2V55B 4O3MA 1M1YA 5EWMB 3MJCA 3ZZTA 1Z4JA 1GAXA 3GC6A 3RYFB 2JJ1A 5K3FA 1DAEA 9LDBA 1ACLA 3MIZA 4J2HA 3DDOA 2C3MA 4RIGA 1ZD5A 4H7DA 2WPDD 4KTVE 4KO3S 3T9AA 2ZSDA 3IS3A 2C8LA 3EIWA 1R64A 2CZGA 4HRAA 3DLTA 2H9AA 1VPVA 4EUKA 5LQKA 2UYCA 1YJAA 4PZUA 2Q3MA 1XEWX 4MOWA 1A3CA 1YJBA 1IN6A 3ID6C 2J07A 5F3DA 1U3DA 5DBFA 4MTLA 2YRFA 1L4LA 2RAVA 2F8LA 4C0AC 4MW4A 2NNLD 3HVIA 3EE6A 3FPLA 2AWOA 3W3AD 1L7VC 4YJFB 3COVA 1FCJA 1XKQA 1Y82A 4Z9BA 5DYIA 3I8XA 3QU5A 2DOKA 2QYSA 2JAQA 2Y2VA 2CV2A 4EJ0A 2XUDA 2QN1A 1H1LB 4XQ9A 3T4EA 2YVKA 3QHAA 1WO8A 4MLPA 1X92A 2BDUA 3JD3A 1XD2A 2WNSA 1GN9A 4G65A 3AB8A 4OSOA 3ZVLA 3TIIA 3V80A 2CJFA 1NLMA 4EMUA 5LQNA 1OBFO 3R20A 1OXKB 2B0CA 3KT8A 5FR1A 1L5YA 2VDUE 2ZQYA 4MQEB 1MABB 1XROA 2ASVA 4UPDA 2BM9A 3UA3A 3VZSA 1CUHA 3DO8A 4I4IA 1U9IC 4J3NA 1EYZA 2A1IA 5ARDA 4W9MC 3NGXA 1W88A 1YA4A 4WY8A 1O96A 1YBAA 3ILXA 1E5TA 4IGFA 3O1JC 1W85A 1U8ZA 4NS4A 2BHTA 4REMA 1E92A 5KJ1A 3G2KA 2FYTA 2GZ2A 1TM3E 3RT7A 4ZCRA 1P1HA 1V16B 3A7EA 3EMKA 4PLCA 3SQNA 3V4PB 2ZRCA 3A0UA 3IAM1 3ILYA 1YBVA 1M34B 1V35A 3ANTA 3PNSA 4I9GA 1R5BA 1PWZA 5HS6A 1BEUB 4EHIA 5B4VA 2WM3A 3PD1A 4LF6B 2Q99A 4ALKA 4MVYA 4KPYA 3A11A 1FYXA 4TT3D 3SR0A 3HCOA 5FKJA 4B7XA 4E0BA 3OOWA 1KI6A 1XNJA 3AXTA 2VUSA 1ZD1A 1HQYE 3CEHA 3W2HA 2Q5FA 3OE7A 5B7GA 5BWMA 2C97A 4WNAB 2XGJA 2PO5A 3FNRA 3VSDA 3ZDDA 1G3MA 1TF2A 2E3JA 2J0UB 3JZAA 3UUWA 2NW6A 2QM7A 1NWCA 2H1IA 4GIBA 4RFLA 5LMZA 4G1FA 4NMXB 3ABOB 3AR6A 5BMVF 2YS7A 5FWYB 3CKYA 1XQXA 5AI9A 4YRTA 1ADGA 5J5CA 3SR4A 3UQZA 3VR4H 3WYGA 4GRAA 4ATNA 3EB9A 4DA8A 2NP6A 1DTSA 2RGNC 1SQGA 3DOIA 3KB2A 4F2PA 1W87A 4EX7A 2CL0X 2EW8A 5BYKA 3U3DA 3U3KA 1EGQA 3AF0A 4PQEA 1JPVA 4OB6A 5AVXA 2HQ1A 2H7CA 3S8MA 1E2EA 2JFWA 1K88A 4XDHA 4MUEA 1X1AA 4JMLA 3PQEA 2R96A 1BE0A 4BBJA 1Z6YA 2BI4A 3ED1A 2AOUA 4Y6GB 1REQA 5K0EA 4R2XA 3QNWA 4O4HB 1GFIA 3VJKA 5B5SA 2ZRHA 8OHMA 2BGMA 2CL7X 4Y6PA 3R5TA 1YOVA 3REQA 4MV5A 2VSOA 2I2FA 2OGUA 3NBKA 4LDJA 2UYOA 4NOLA 2X4GA 3E6AA 3Q9UA 3WRWA 3VAAA 2YDYA 1SJ9A 2ZUWA 4KI0A 1B41A 4R1QA 3ILHA 1RI2A 3THXA 3O0DA 4LRQA 4BMNA 4BO4A 2WUDA 2PTHA 1LY1A 4Z54A 2FZWA 3V1NA 2DBYA 3OC6A 4MROA 4MYCA 2IYLD 3Q9NA 1KQOA 2XOKD 3HP1A 3GFBA 4IYJA 4W99A 3T3OA 4ZOCA 2IY9A 3H1BA 5HFJA 5GIOE 4HGQA 4N82A 3WK6A 4M1QA 1KR5A 1DIGA 3X1MA 5FQOA 2IXEA 2KMLA 2PFSA 4WECA 2IIVA 1UKBA 3O8QB 3VR5H 4DHWA 2EEPA 1ZC4A 4BX2A 3JQ6A 1QKIA 1VHDA 2NVUA 1E9AA 1O7JA 1E4EA 2PEZA 1MXFA 3WLHA 4LXIA 2PKCA 3CTMA 3U60B 4H0CA 3HHEA 3E15A 3ETLA 3Q9LA 4L08A 5IN4A 2C29D 2FR8C 5JSZB 4NENB 4LTDA 1I13A 3RIMA 3Q10A 1P33A 2JGAA 4R71A 4PLFA 2OXTA 2BI7A 1QHNA 3EDRA 3R4VA 3S2IA 3HLYA 1KO1A 3H04A 4KQWA 1H2WA 1XMPA 2ZREA 3BJEA 2PJDA 1ZHHA 1KSGA 3TKAA 4MQ4A 4C5AA 1OGJA 5ALJA 1QRTA 3G2OA 3AP2A 3CUWA 1T5OA 1TQHA 1WAMA 2R6GA 1HSZA 1EJ0A 3TLXA 2NXJA 4GUAA 3IEUA 1T6BY 4UZSA 4EFNA 4P38A 1HQDA 3LQFA 4MV7A 4F60A 2XAAA 4TX1A 4YJ2B 4BL5A 3R3ZA 4K0RA 4V38A 3CRNA 5JS1A 1NN1A 3P0HA 4BNUA 4DDTA 3PPVA 2JI6A 4O0LA 5EE3A 3PUWA 4P4SB 5LMCA 2PQ6A 1DDGA 1XJWA 2DWCA 3WNVA 4DTIA 3NPMA 4XVRA 3AF5A 1N4AA 4PYKA 1M1YB 1N1DA 1RKVA 2D3WA 4KV9A 4ERXA 5HKBA 5IUJC 1ZM7A 3QVGA 5K3FB 3DF7A 1JSZA 1XTSA 1U7TA 2ZP1A 4AKIA 1B4DA 2L2QA 4RANA 2P9EA 1U7ZA 2ZJFA 1LD3A 3M3PA 4MUNA 3WRXC 2I4OA 4UVGA 4EPVA 3H3FA 5A9RA 5KYWA 2A6PA 4M9ZA 1PV4A 2ZZNA 3E7DA 4OREX 3S55A 1MFPA 4PW0A 2ZUFA 3ETEA 1Y7IA 2IYFA 1QIHA 5HGXA 3PC3A 3THOA 3EVAA 1XN4A 3PUJA 2J3MA 4HLNA 3ETNA 1A4UA 3DTVD 4UNPA 4X9XA 4OUDA 3LLMA 4H0FA 4R84A 1CUUA 5F7OA 1JFSA 4Y2GA 4ZEWA 5H3HA 1E9RA 3AY3A 3L5KA 3EZLA 2WSMA 4MYUA 2FUKA 1CZUA 1KOFA 1VLJA 2YXEA 4QD3A 1XD2B 4X8MA 4ARAA 3KHUA 3SS9X 3TW0A 3RG2A 3HMKA 5HDBB 3LGAA 1JEEA 4A26A 3ND7A 1VECA 4ND8A 4CQMB 1KFJB 4US2R 4TLBA 2CE2X 4MR9A 4C0QC 1P9RA 1XX6A 4MDHA 3A36A 2OWDA 3TB4A 1QH8A 3LYLA 1Z6ZA 3KOWA 3QXGA 3FMVA 2RIRA 3SQOA 2AYXA 4OQYA 1XDWA 1RKBA 3CJQA 4RPLA 3VV2A 1R66A 2X2FA 1W88B 4M9SA 4MV4A 1O96B 1T2DA 2NZUG 3B36A 3N2ZB 4P3PA 4WDRA 4CTNA 1W85B 4EHFA 1ZQ9A 3GEGA 3B9QA 4BKUA 1V96A 1J06A 4R0VA 3KVRA 1M34E 1OFVA 1ZCJA 3MGGA 4P3YA 5BR4A 1RWNA 2X0IA 2V6IA 4CIYA 1TQDA 4E31A 5I5GA 1SCAA 1U3GA 2QRVA 2RC5A 3QE2A 3I6IA 3ICQB 3PA6A 3UUGA 4MI6A 5IBCA 4G4SP 3OZDA 4ESVA 5CLLA 4ALNA 3C6BA 3NWOA 4RESA 2QSYA 3PT5A 3Q3IA 4C7KA 2CC2A 2FLVA 3M6FA 3MF4A 5L7TA 5EE1A 1O5OA 3UG6A 1B16A 5DTMA 1LLUA 1LPOA 1TJNA 2JCSA 1YACA 2BFMA 5L51A 1ZWKA 4LQCA 5BR7A 1XQ6A 3B1JA 2XGSA 2X13A 1DAHA 3R77A 5THXA 4NXNB 4QXRA 5AOCA 2CJXA 4FFPA 3SKYA 2VZLA 4E15A 5AJWA 1LC0A 4IVNA 4YT8A 3QK7A 5KJFA 5CYFA 1M74A 5DBGA 2J5XA 1YBFA 2CXSA 3GDOA 4P93A 4B31A 2FSIA 1SUSA 3T7SA 4RETA 3ZX5A 3HXMA 1P8AA 2E82A 1IEXA 4O4JB 5TMDA 2FWBA 3TCKA 3NOOA 5BV8A 3ZGZA 3NDJA 4WACA 4H1TA 3D02A 1EUDA 3RTAA 4BU0A 3AB3A 1U7DA 4PX3A 5L3VA 5LQAA 2JHFA 3W3AH 5KB3A 3OZBA 3WWEA 2GKSA 3DKIA 2E4WA 2D7DA 1NJ1A 3TLEA 2ZETA 1L4KA 4G4IA 3RYIA 3T5CA 1CRWG 1GAJA 2AOUB 3JQBA 4UPVA 1TJYA 5H1YA 5FUMA 2GEKA 3HWWA 4KRFA 2JI9A 1VGRA 3H2YA 4KOAA 5JSUA 5H16A 1KOJA 4BMZA 3RBXA 1YOVB 3REQB 1P72A 4DGSA 4F3NA 4W5NA 1CETA 4WKNA 2ZUSA 1Y5IA 2HREA 3OE1A 3EPPA 4OSEA 1AX9A 3CZPA 4PZCA 2D74A 1E2IA 2AQIA 2ZT7A 3GD7A 1PQYA 3I01M 1P2FA 3HDTA 1W581 2GZAA 3EEQA 4BRUA 4G41A 3CB2A 3THXB 4FYVA 5AJHA 4TGLA 1J97A 4ZVMA 2R68A 4FOTA 4R8KA 1OI4A 3ECCA 2C20A 1VJCA 2INGX 3PQDA 2Q27A 1NP3A 2V0NA 3GYBA 4PCLA 5FOUA 4K40A 1TAQA 3BTOA 3L82B 4OGKA 4ZYZA 3CPHA 3EFHA 4PLPA 2EX0A 3AHGA 2H5EA 3H0CA 4PTYA 2IYSA 3VH1A 4CDRA 3TG8A 2Q41A 3GEDA 2JI7A 1AKYA 2NADA 2VDOB 2HBYA 4P4UA 5CNJA 2NO7A 4QOJA 4ZREA 3UY4A 1GG8A 1T3LA 3AYXB 2CE7A 1JHRA 1RYNA 4MWDA 2D1YA 4DR6B 3CCFA 4OLFA 2H4HA 3GVIA 2HRDA 2D5AA 1YGPA 2BFCA 2OCXA 3D2CA 3FKSA 3MJFA 2NM0A 3IDOA 4TV9A 5TVKA 2I2BA 2BUAA 3BKXA 5KTKA 1IXKA 4HDCA 5J43A 1Q2XA 4EKYA 5ALTA 2YN4A 1R8XA 2YBEA 3KQLA 1R00A 1Z5WA 1RJDA 2J32A 2E6KA 4JJ4A 4EK9A 4I1IA 5KINB 2X5KO 3BCRA 2YC4C 3TSYA 4OH1A 5HW0A 2UAGA 3WQQA 3MGAA 2P77A 1QGDA 3KYIB 3NKVA 4BVEA 3BVPA 1SRRA 5KYTA 3B48A 2QZSA 2JAPA 4REQA 4LWZA 1QKJA 1R8YA 1KMMA 4DMRA 1RXVA 2G1PA 3C5CA 3NV9A 3WL5A 1MPTA 4CEHA 3N58A 1RBZA 2PEYA 3LUKA 1HNZB 4CM4B 3P9QA 3EQ8A 1BKYA 3EMBA 2UUPA 1RAEA 5IVIA 5CLJA 1BU5A 4K6FA 4NFLA 1NZFA 3OEWA 4YCLA 1NLUA 1G19A 3EULA 2FSGA 2F9LA 1OBHA 4GU5A 1OZFA 3GARA 2FN3A 4QNNA 4X1OA 1PG0A 3W04A 1XQWA 1S2GA 4IGIA 4LX8A 5AK6A 5E3HA 5K8TA 2FPPA 3OJ0A 2H1WA 5IHPA 1RMYA 2H2IA 4QA9A 3UW3A 2AN9A 5HJ2A 5HA5A 2K2WA 3WLQA 4ARSA 1JPNA 2XUJA 1M1YE 2JLZA 13PKA 1M1NA 3GLUA 4MARA 5LN1A 4LUCA 5ALIA 3QVGB 2H59A 2OBYA 1J00A 3G5MA 4L8YA 5DI9A 1GCUA 1AXEA 1UEJA 3I45A 4GWKA 4IFEA 4V3CA 4EJ6A 3IBTA 3ASUA 1BOOA 1HGXA 4AUNA 4BFZA 5KYWB 5IK2A 2EGUA 2HNKA 4US1R 3KR0A 3JYQA 3SZUA 4RIIA 4BVGA 1Q0PA 1ZSYA 2ZIWB 4AYTA 4EKNB 1TA4A 5I3ZA 4DIDA 4TZ0A 2DPGA 2B4RO 3UT6A 1GQQA 4FPXA 3VX4A 3G6KA 4AMUA 1MQSA 4H3KB 1K8YB 4XEHA 4BNMA 5JC8A 4OUDB 2LRHA 5JIBA 3T0FA 1N7JA 5HILA 2AQKA 5ER6A 1WQ1R 4YDQA 2ZRKA 4Z4FA 1VZ3A 1X19A 2BEWA 3GJXC 3E5MA 1E6UA 1L1QA 1USUA 1B8NA 2ZITA 3C6MA 3KQQA 2ZT6A 5J1SB 3EX7C 1GFZA 2CDNA 2R8RA 2FWPA 3DDHA 4OYYA 4C21A 4JLKA 3MMXA 3T06B 2XQKA 1Z2OX 1D4FA 5KOIA 3W6ZA 4MR9B 1NF9A 3RVDA 5TIIA 1QH8B 2B1RA 5BOVA 4BNHA 4B2LA 1XMXA 1FFHA 3VYVA 5KYXA 3V4FA 2A9OA 3U1TA 3EVNA 4DARA 4TRMA 2D8AA 1QP7A 2AR9A 1ESMA 4EM6A 1JS1X 5A03A 5A5VA 1FUIA 3EWNA 4YAGA 4HXGA 4OMFG 5F12A 3R9KA 3AQIA 5FF9A 5THKA 1KRXA 2L69A 3QMPA 1KFBB 4GE3A 3SIRA 4WH0A 4IL5A 4DQ0A 5B6JA 5JJ5A 3ZQ4A 1SVWA 5IZCC 5HP4A 3GJQA 4K1XA 1DP4A 2PQ0A 4U5XA 1FMTA 1O6CA 2FEWB 4QOGA 4AZWA 1NWHA 4MGIR 2REBA 4LTNA 2QVYX 4N4AA 1RLMA 4HNVA 1A2QA 2ALJA 3GFVA 1RQ7A 3PNBA 1QIKA 1HV8A 1J8MF 1PD1A 2YNMA 4RW0A 4X1KA 4UNIA 1OFUA 4D0GA 2JA2A 2IV2X 4CEJA 2DPHA 1LBHA 2WIDA 4JC0A 1JJ7A 4PAMA 1DKRA 1W5FA 1OXSC 1SB8A 2MINB 4OL0A 1JGTA 5EUCA 4HC4A 4K0KB 1LX7A 1SNYA 2HLHA 2OM2A 5BSHA 4Q1BA 2GK7A 4WI1A 3FN4A 1JEYA 4J6FA 5DCLA 1SULA 1FOEB 2BEKA 4LN1A 3PKIA 4L8LA 4PQFA 3WL6A 3O9VA 1N6NA 1XMJA 2EATA 2I6QA 1QRRA 2RG1A 2BKVA 2H1SA 3BXPA 4YQEA 3T0GA 4EW2A 3FH0A 2H5IA 5HZHA 1V1RA 1HLGA 1EUDB 1UZAA 2WKRA 2G5PA 2RGAA 4DDHA 2EIHA 4I3HA 1GNRA 3O03A 1M75A 3LXRA 5E1OA 4B6GA 2H1LA 3CH7A 2XUZA 3AM5A 3C6ZA 5ESRA 2X5XA 2I1WA 2ZBVA 4E4TA 2WVHA 1ODCA 1O94C 4DBLE 1Y1QA 3RYIB 2WE8A 4MWBA 1I6KA 4TQAA 4UUMA 1DTWA 3UWMA 4DG5A 1A2KC 3H99A 4B84A 3RSOA 3PEYA 1RRVA 1KJNA 2B3DA 3VC2A 5JRJA 1G7RA 4RC9A 2O1EA 3CLTC 1NMSA 1ZXBA 4IDEA 3UCEA 3UKOA 4DV6B 2AEEA 3OOYA 3ZI7A 4E5PA 3OTHA 3PHLA 4ND2A 1QGOA 1FP6A 5K6TA 2ECOA 3JXEA 5F78A 3SR3A 1U8AA 3MWJA 2GZHA 4HNAA 1JEDA 2QEQA 4O25A 4WK6A 1A5AB 4F2GA 3VZRA 2FI1A 5C0OE 3WP0A 6REQA 1V5GA 5KZMB 5DSXA 1F0YA 1ICEA 1V48A 1G38A 3HVUA 2OQIA 1VHWA 4CLRB 2ZRLA 3IAS6 4QNRA 2IYRA 3KJIA 3MOSA 2NAPA 5EQTA 3DE7X 3MJEA 5I51A 3B60A 4KQEA 1PX0A 5B53A 2PBZA 2IYEA 2PWYA 5BSKA 1RJWA 1I80A 1ZIYA 1G6KA 5EJ5A 3DZJA 3VU8A 4XWWA 3O2QB 1CY2A 4RKQA 2C42A 3H7AA 1YL5A 1U0EA 2YW2A 1LXCA 5AVWA 2XJ4A 4FNGA 2H2GA 4Y98A 1U8UA 2ECKA 4PR3A 4XIFA 1RRPA 3LBIA 4G0QA 2BFCB 1LB1B 1A8SA 1KEZA 2E48A 2W6ZA 1VB5A 2IOYA 1EGAA 2YNMC 4LJKA 4M0FA 4DCPA 1R27A 4EGSA 5HPYB 4HL6A 5KQLA 4XRGA 4YMGA 4EB3A 2JGDA 2CF6A 2QRNA 4W8GA 2HUNA 2RHWA 3MB5A 2WOOA 1R9GA 3BMCA 3HVRA 2B0JA 3H1FA 4A8PA 4JB8A 3UWOA 4ND4A 2FE1A 1C7QA 1QCCA 2RCNA 4A36A 1UJ4A 1FDIA 4REQB 1K8QA 3ELWA 1FNMA 4O2AF 1Y4AE 1BU8A 4IV8A 4QTZA 3Q2KA 2D0IA 3JQ9A 2QL5A 2YR0A 1UQTA 5T41A 2G08A 4DQXA 3RJMA 3FOFC 4BXOB 3N3AC 4QC2A 3IO3A 3SYMA 2IHJA 1NOIA 3OECA 5A04A 1ZIPA 4HNHA 5ESXA 3RABA 5CA0A 2CDCA 3U5ZB 5GQSA 2O7NA 3BAFA 1ADJA 4KWCA 3IE1A 1SU8A 3NEPX 1D5WA 1SELA 3HI6A 4PFSA 3T54A 4BLVA 4IDQA 4UFOA 4PIPA 1NBWB 3NJRA 1HEYA 3O91A 4M2LA 5ALXA 1KPGA 4JT9A 2IK8A 5FUXA 4D8YA 2JGNA 1OE0A 1TUGA 3T9BA 2YWDA 4MS4A 5DNVA 4PONA 2PS1A 4X64B 3GP3A 4MV1A 4DSOA 2BLNA 1M1NB 3WZLA 1J8DA 1DC8A 1WLSA 5IW8A 1ZH6A 2FN9A 4U8GA 4ZGBA 3BRWD 2P4HX 4PXSA 1LI4A 3E53A 4GKAA 1UAGA 4QBIA 1C29B 1RC0A 1V95A 3DF9A 4XWYA 3OI7A 2PJUA 3PL5A 2NV2B 3NWBA 4I5DA 4E2FA 5HBRA 1O0BA 2WTNA 1Q12A 1DIRA 4ZMSA 3P0FA 4EY8A 1P5RA 5ADHA 4DR5B 2JVIA 1Q77A 2PZAA 1M7BA 2EFCB 3BX1A 3SZRA 2YMLA 3JRNA 1EI9A 2AZ4A 2H7XA 4M55A 3G8YA 2F3UA 2UYYA 1SXJB 3PR1A 3TOCA 2BEWB 4UEWA 2QOEA 3MGKA 4YRCA 3T38A 3Q7EA 4EF6A 4KNYA 1D04A 2P0EA 2XTMA 4WHMA 1U9JA 3WA7A 3HJNA 3FB1A 4N9QA 2D13A 1RZVA 5HE9A 5F3RA 3GGOA 1QO7A 3P26A 4W1SA 1E9FA 3R3XA 3SZMA 1FQJA 1X1TA 1OU0A 2XTNA 1CRLA 1P7PA 2W6ID 2B34A 5KYXB 3IR7A 1PR4A 4L27A 3F71A 3JASA 1C7RA 1UM8A 4CVNA 5K99A 2JGLA 2ZT5A 3MRVA 4NDAA 2QYTA 3CCBA 1K6IA 5TMPA 3YASA 1R9NA 4D4GA 4AJOA 3WYNA 1S7CA 3NVKI 4QKQA 3L18A 5K3SA 4Q4JB 3NW9A 4U7WA 5F7XA 1H9CA 4UTXA 1NDHA 3Q7TA 3ZCPA 4IO1A 3MCZA 1BD3A 1AK1A 1H0SA 1WNTA 3F47A 5HRCA 2IYWA 3VPCA 3R5JA 5FPSA 2F67A 3RTBA 4V02A 2HUPA 5E7QA 3AUSA 3OOEA 5LLSA 3WYFA 1QK3A 4D9KA 2G70A 2ZJ7A 1BVUA 2WIBA 3MTGA 5EYPA 4X1KB 5FLYA 3UENA 3NRCA 4CEJB 4PYJA 3ZG6A 5KYYB 2M9MA 1H66A 1P0IA 4B17A 5DW0A 2XRMA 5FBHA 3LBNA 3QMVA 4XWTA 3OPNA 5IJ0A 2QLJA 3H4IA 3TOSA 1CY8A 1GUZA 4B4OA 3GNQA 1GCAA 1W5SA 1USVA 1O1YA 3ADKA 3N39C 3OP4A 4MWOA 4ND7A 5HMMA 2P8JA 4B7AA 3R8XA 1XZEA 1DWPA 3BGDA 1AQYA 4MXDA 4IJWA 5MGBA 2HA2A 1VFNA 2P3QA 4OU5A 4M0KA 1T91A 3A6ZA 3I5AA 4E7OA 4COOA 1IY2A 1CP3A 5HE8A 5B37A 3LXXA 4MA4A 2F3QA 4TVSA 2OZLA 5EMJA 4A2QA 1ZN9A 3DH0A 4B8ZA 3V4RA 2UUCB 4RELA 1DTWB 2BGIA 1BE1A 1DXHA 4DLYA 4ZCMA 5LC1A 2DXIA 4OOEA 3B1VA 1QV6A 3L1VA 2WZBA 4GOOD 3ZWBA 2ADMA 2C1EA 3BWEA 4HXEB 1MJ5A 5LJLA 3OX3A 2ZQ5A 4UOEA 5DEOA 3EOAI 4DMUB 8LDHA 4MA0A 1N8KA 2NN3C 3FPKA 1ZLXA 2FOXA 1GZ4A 1UJ2A 2JH8A 4R8SA 5FOSA 3TG2A 1NVTA 2QN2A 2KBFA 3OEED 4HNAB 5CW2A 1SKQA 3EWIA 3TVTA 6REQB 1YRWA 2VDPB 3B52X 1SZDA 4WWHA 5TGDA 5K0FA 4MHTA 2G83A 2GYYA 4QQNA 1C14A 5HOQA 3ROMA 3AHHA 4CM1A 2ZIZA 1WF3A 4EVQA 4DCCA 1B3BA 2NUBA 3DZKA 2HLNA 3VO2A 3Q3HA 1LRKA 2FWNA 3EPHA 2CK3D 2C4KA 3SX0A 3JAWA 1BHQ1 1LF0A 2VN8A 2JH3A 3VV3A 2AMFA 1WRBA 1VL8A 3X2FA 4C3UA 3IP6A 1V6SA 4RKRA 4OXKA 4F2WA 3I4LA 2ZYUX 3CS3A 1G2OA 3FVQA 1QQ6A 4HV4A 3JAKA 1XCPA 4LKOA 1KERA 1UQRA 3AWDA 4YO8A 3OIDA 3EGWA 3W8EA 5LMNB 4UDNA 4NVRA 2FPGA 3KTDA 4B82A 1RXWA 5B36A 2C1ZA 4H1UA 1XAJA 3D6VA 2LCQA 4DMKA 2NMVA 5DTRA 2JGDB 1SOWA 3MS2A 3EEIA 2NYUA 3R4CA 4GMXA 2CVZA 5EWLA 5G3ZA 5BUSA 4P5PA 3IRUA 3HACA 3GPCA 4NPHA 1L6RA 2FMHA 3BMCB 1SZJG 3CRMA 2BDTA 3FTDA 3EPLA 5EIEA 3QA3E 1E9CA 4EQ6A 4Y6RA 1V8BA 1NLFA 4WZ6A 1M2FA 1NW5A 4QM7A 4RA9A 4FXOA 3FYTA 2GK3A 1ZD8A 1GRQA 1QBGA 5CNIA 5FWNA 1MVOA 2NXCA 3UYLA 3UJNA 3TNLA 2W43A 2E1PA 3KYCA 5HUJA 3QEAZ 3BE8A 5BMVB 2FQQA 4P2GA 1UODA 4POAA 5IKXA 4WDQA 1R6AA 1CEYA 1A9OA 1I3LA 3G9QA 3OMLA 5A7HA 1UF9A 2GHTA 1OX5A 4MYHA 3UATA 4BU1A 3DWIA 1KOGA 5FUBA 2EAUA 1T9AA 3IEKA 3NV7A 2NWQA 1S8NA 3CW8X 3E4CA 2DFPA 4Q9KA 1C9NA 4Z7NB 1A1VA 5ERYA 2WJIA 3CWZA 4DLBA 1NUHA 1CS0B 1AHHA 3K8QA 4HB3A 2ZUVA 3MJTA 3ADBA 3WGMA 4BNYA 1CV2A 1E64A 5CIQA 2ZVDA 4JVOA 1PYDA 1PRYA 4ZVPA 1OIXA 5H3CA 4EIWA 4MS4B 1HKHA 3TLKA 4A8HA 4BO5A 1UT6A 4J94A 4K88A 5EP3A 4KW7A 4AIIA 2IS4A 3GRUA 1NURA 3L6RA 4RK4A 3URMA 1RSZA 2AW5A 2A7XA 2MSWA 3TD2A 5A1JA 1TIKA 3UMBA 1DT3A 1XKTA 1XNHA 3IJ5A 3CR8A 3GJSA 4AMYA 1CJKC 1WUTA 4WEOA 1QTIA 4R16A 1Y8QA 2NYAA 2I1QA 4KVFA 1JA9A 2BGNA 2QGFA 4MRAA 4ZC1A 4ZWNA 3WK8A 1WWKA 1YJ8A 3HB9A 1ZH4A 4HGZA 1AT1A 4QQKA 3V4SA 1S4MA 4C7JA 5A3QA 3DOJA 4RJJA 3ZHSA 3C5WP 1RI1A 1C3EA 2X7XA 2F1IA 4MKIA 3A37A 1VMDA 2H2FA 3BB1A 1CNMA 2V5AA 3FNIA 4G0PA 4R3UC 1NKVA 1SXJE 1AGYA 2V7WA 2XDWA 3I92A 4YMIA 5TPZD 3TR0A 4QRIA 1FRZA 3VVCA 5C51B 1PT7A 1U9CA 1MAUA 3EZ6A 3AI1A 2ZBRA 3TQCA 4AP6A 4EG0A 2MCFA 4NECA 2IXBA 1OA1A 1WXIA 3TNDA 4YRGA 3AM4A 5FV4A 4B0PA 2JEZA 2V96A 4IP0A 4CHTA 3RYHA 2A9PA 1LWNA 4N8DA 2P79A 2PUHA 2YWRA 4N18A 5EXTA 2R7LA 4TS9A 5EA2A 3ZV5A 2X8AA 2G1KA 3CXRA 2GCNA 1WKCA 3ZDAA 1U2DC 2GZRA 1XTZA 3EA5A 3IP3A 4I1PA 3A31A 3JASB 3GLIA 1L9XA 1FL9A 1QDLB 1G8PA 1N3YA 2CYCA 2PXCA 2Q6KA 3EFEA 4JA0A 4JLOA 2WUFA 2BZSA 3A06A 3B7WA 4BBAA 4ZVUA 2VSYA 1QKKA 1U3CA 2QI9F 5PGMA 1E3MA 4U7HA 2JEOA 4KQXA 1Q3KA 3PRHA 3N8GA 1Z4NA 1AQUA 1N9GA 1OY1A 1SUEA 2F9MA 4QOFA 4RABA 4D97A 1BVHA 3SYTA 1PK8A 4JP2A 2ZYSA 2CNBA 1VHJA 3UHPA 4KPUA 1DI0A 4EHAA 3KQYA 3LT1A 4D9CA 2QROA 4J1TC 4YGYA 1YJ5A 2OAP1 3RFCA 1USWA 2VTVA 3FG9A 5FH9A 3EODA 2EKLA 3SSMA 2P0AA 4GVXA 3WLAA 4X97A 1TEXA 3IMCA 1NG1A 3SEZA 4KH1A 3GJ8A 1FFCA 2Y1WA 5JO0A 2NO0A 1E2NA 4C07A 5EGNA 2P5YA 3T7JA 5BYAA 5KNDA 4CFZA 1AMOA 1W0KD 4S1PA 5IJ0B 4XLLA 1LDNA 1XYYA 3WGTA 1RWMA 3UKJA 2EFGA 3R9XA 3TJZA 1I01A 3TD6A 5GOZA 4WY5A 1O9HA 4RHYA 1MO3A 4BATA 3OCYA 5JHHB 3TX6A 4ZAWA 4CMAA 1FDRA 2H4FA 4ZPXA 2QB5A 4G1MB 1UDXA 3QUSA 4YAFA 1EA5A 3TXAA 5DISB 4K9OA 3FZGA 4A16A 4DMCA 2L17A 1FTQA 3EUFA 1WXFA 1YK1A 2ZRBA 1CXZA 4IDPA 4KR7A 1KEEA 3K9GA 4I9HA 1AA6A 3HZRA 2FETA 1OOEA 5MFZA 2BYTA 1X7XA 1UMKA 1IEQA 3GRZA 1WXWA 4UPEA 1PQUA 1OAAA 2XDAA 3ORQA 3TRDA 4C1NA 1W1WA 1ZVVA 2FA9A 2FZ4A 1FVFA 4JX9A 4AXBA 3WLTA 4EG8A 5BT8A 5K0NA 5CFZA 1T26A 1ZPDA 1EUQA 3E9MA 4N3AA 1UOOA 1K86A 1K08A 4BKOA 1I2AA 1S8OA 2OYCA 3KEQA 2WAOA 3ONEA 1BZYA 4A3SA 2VEOA 1EFTA 3W5VA 4PVCA 4RTKA 2YTZA 2ZIEA 3JAWB 1DOHA 1WA5A 1E4OA 2CB0A 2P9YA 4M0PA 3RIGA 1IQ0A 2D0OB 4PLHA 1PG2A 4O2BF 4XGKA 7MDHA 5JZOA 1KEVA 1Z68A 2GPWA 2ZU6A 1VJ5A 4BZPA 1IOVA 4GQAA 2I80A 2O8EA 3JAMA 1Y8RB 3K9QO 1OXXK 3A32A 3JAKB 3UMCA 1CUDA 2HCFA 3DV2A 4LJYA 3T95A 3DLPX 4GOMD 2A5DA 4Q01A 5ICGA 1GUDA 1BVYF 1M6NA 2G4LA 3CE6A 2WWXA 3LPLA 1JTFA 1AUOA 4RD4A 4TVOA 5CM8B 1D1SA 1E3EA 3EMVA 2IX9A 1IOLA 3QVMA 3IQHX 1Q1GA 3GUUA 1RM3A 2LGJA 3VYRB 4P3OA 2PNJA 2E5WA 1F4VA 3GG9A 4EQ6B 3DCIA 2C2HA 4FCVA 1JLKA 2GGSA 2GN0A 4L0MA 3RNLA 4KE6A 4RA9B 3ZY2A 3USCS 5JG7A 1TOAA 1A9RA 1G5HA 2BN4A 4GI2A 3GW8A 4D8XA 4ZU1X 2QXYA 2G80A 2IKSA 1J0BA 1ZKDA 2C07A 2ZTHA 1JDBB 3QIVA 4U2FA 5IAGA 4CW7A 3VR6D 1A96A 1SIUA 5AT1A 4HB4A 4RTLA 3G49A 1EFLA 5DGTA 3EHDA 3IT2A 3D7MA 3RADC 5SZHB 1NBOA 3X44A 2E4XA 3STVA 4AS3A 3MUOA 4BNWA 5HTKA 1FZTA 3ONNA 4HMPA 2FMUA 4F5DA 1I10A 1E3JA 1JHPA 1W35A 1WPQA 2OV2A 2EP8A 3HRIA 4GX0A 4UASA 4HNQA 2AJLI 2ZDQA 4LJRA 3ZWCA 3H9JA 1MLDA 2DFLA 4G07A 2C3YA 4PYIA 3O8OB 1CUFA 2EOAA 3FKJA 5H7XA 3DEZA 1OB5A 1U6IA 4OB8A 1RD4A 1C3VA 3QWBA 4NOJA 4ZZ3A 4PTLA 3BJRA 2R1VA 3DEAA 4D82A 2ZI5A 2PLNA 4AWAA 4YRKA 3BIOA 1E6WA 2Q6OA 3TGPA 1N92A 3HY6A 5FFNA 3B2NA 3IUEA 1FTGA 2CLIB 1Y8QB 2HBQA 3GRVA 4UD6A 5LDHA 1ID1A 1P5ZB 1KWKA 1WL8A 5TJ9A 2FR0A 2VJCA 4LOLA 3IJRA 3SJBA 5DM0A 3U3JA 5BSWA 2NZJA 4OSPA 3QBTA 4N7JA 1N2OA 4EGAA 2ON6A 2VP3A 3IB6A 2RCYA 3C3KA 3DC2A 3C14C 4ZHQA 1CTQA 1QHFA 2C9CA 3H0KA 4FZ5A 4M53A 4N39A 1Q7EA 5C53B 2B9VA 1GZVA 1E5DA 1LNZA 2P5UA 3GNSA 4QPCA 3EHEA 1NF3A 4FQ5A 2W2OA 3DWGA 3HBAA 4XUDA 2GARA 1NKSA 2DX7A 3C4JA 3ZV4A 5L6LB 4MK4A 3LBYA 3TQTA 5LB2A 1XTKA 2I7DA 2Y1XA 3M1AA 4IF4A 4PGAA 4MUMA 4NPAA 3QYJA 3K8YA 4Q93A 3FYUB 2Z6UA 3P9PA 2PT7A 1K89A 4FHEA 4NS1A 4B2PA 1J56A 1VHTA 3WKBA 5LIPA 5DNDA 4HPWA 5AW7A 3CLRD 3UJBA 1L5GB 4L0CA 3S68A 1PFGA 5A4DA 1RW4A 4BTVA 1UXHA 3UAZA 3HJUA 2FUNB 3F7OA 2EJVA 3O4IA 1M6HA 5AVRA 4F5EA 2VK2A 2I8LA 4Z9AA 2FG5A 5FWDA 4C6RA 4F86A 3ZHTA 5KO2A 3HSKA 4O2AA 5ULLA 1YAHA 1H9BA 4FEYA 3RW9A 3WLSA 1A9XA 2ZJAA 3K72B 4KPUB 4ZYLA 1FFDA 3CXUA 4BASA 5HWSA 1ZH8A 5M04A 2KW5A 2CLKB 3MB8A 1S89A 2Y6VA 4JBIA 4KDEA 1SBYA 4L4ZA 4OH7A 3U44A 1C7EA 3ZLTA 1LK5A 3PNYA 3G8BA 2NZ8A 2PH3A 3LWBA 3VC3A 4F8JA 1X70A 3MIIA 1QZXA 1KEKA 4PQRA 2WE7A 4EHHA 2H1CA 1OTYA 5K3BA 4B33A 4MWGA 1CQWA 4BLTA 1E8MA 1S8FA 3FX2A 2QZ4A 3PP8A 3LCJA 4GF5A 2J31A 4DCUA 1OVGA 1I2CA 2O05A 4F5WA 4O59O 2PBRA 1T8YA 3I0ZA 1IULA 3ZY5A 4DIEA 2JK0A 2JPDA 4KO4S 3TJRA 2DBVO 4WUTA 4ZC8A 4C2UA 4DMHA 3MK31 1N2CA 3QQ5A 4IJQA 4MEJA 3F4BA 1HE2A 3M9LA 4KQHA 4R1LA 4M83A 4EJSB 2GX6A 2XMBA 3AUFA 3GAZA 3QPCA 2R7MA 2OORC 3NHPA 3H5OA 2ZPAA 2YWJA 5AUPB 1Q7GA 2CLHB 2OQ2A 1KEEB 1TUBA 3EVDA 3X43A 4KREA 1SXIA 1Y37A 2XPCA 4WNCA 2WHEA 1X7XB 1XC7A 2IL1A 1N5IA 3HSSA 3L93A 1NQAO 3M9XA 3RIHA 4YT2A 4TWJA 3NRBA 1DCFA 2KB0A 1NGSA 3C7TA 4P2BA 5BQ5A 2HJGA 5KQPA 3FOZA 1NYTA 3A3KA 3DBLB 1J1IA 1MQ8B 1OYYA 1XF1A 4Q4HA 3F73A 3MRTA 4MPTA 1BA2A 4YXWD 1JQKA 1DAMA 2I76A 2EERA 4O8CA 1Z07A 1C9KA 4QGSA 1CNEA 2QY9A 4PS1A 3FWYA 3VI3B 1GM5A 3TLJA 1X1BA 5HFAA 3OMWA 5EHGA 3KQKA 2XXAA 4FUQA 4MW6A 4GYYA 4UBOA 4CZ2A 1KJYA 1Q6ZA 4QWMA 5JDIA 1YU9A 4UVHA 4L4RA 2IZZA 4MYTA 1P2UA 3HADA 2O0MA 1GCGA 1TXGA 2YFQA 3K8ZA 2XOXA 3OIWA 1W96A 2WYUA 4HDSA 2ZR9A 4QQFA 3KB8A 3E18A 3EA4A 1X7WA 2MYNA 3NHZA 3HR8A 3IHLA 2IHKA 4WXMA 1RE0A 5CD9A 1J0EA 2ZPTX 2O8EB 1BRTA 1E0KA 1EWYA 3PFHA 3L7KA 5KHAA 4UFNA 4U7JA 1FDUA 1P9WA 3KFXA 1MP0A 1XLTC 3AKYA 3AJ8A 3FZEA 4Q48A 1CPYA 3E9EA 2FEPA 3BERA 1JE1A 3CG0A 3Q9SA 3QRWA 4JEMA 4WOBA 4Q9JA 5DCUA 3CQ9A 4BFSA 3S6JA 1HBJA 2O6HA 3PF9A 1WUYA 5D1HA 1G18A 1VCIA 4MNTA 2QYOA 2Z2JA 3LQYA 1WR8A 3OLQA 4TQGA 1Q7BA 4CU2A 5C8YF 1I4LD 3B3GA 4Z99A 2C0PA 4UAJA 1JH9A 5MDHA 5EJ8A 3ZXUB 1AZTA 2CW5A 1DWQA 3HLKA 2XMZA 1HEIA 3BF8A 5JUWA 1VBNA 3GGCA 2WA1A 1UK7A 1Q0TA 4M46A 2JDID 1MB9A 1ULUA 3R3HA 5J2TA 2ZYTX 4OLBA 3AM3A 2BKAA 4AT1A 2BWJA 3D43A 1TQ6A 3HY4A 4EG1A 1QIFA 2OB1A 5AJUA 2WILA 3E2IA 4F0JA 3PGMA 4NCJA 2FZLA 3PC8A 3OF3A 2MT9A 3EJWA 3GNLA 2FFQA 4FMDF 5AXCA 1JKIA 2YV3A 5EZYA 3S2EA 1PJQA 3PXCX 3ZBPA 1QCDA 1Q84A 3R5FA 2A0WA 1ZOSA 4Q00A 4F56A 4NMWA 3LP6A 1ZK3A 2SCUB 4LRYA 4QRHA 4W1RA 3TPFA 4LBZA 4W7HA 2PVCA 1E99A 4NYIQ 5A3SA 3SMVA 3TCNA 1CY1A 1XXHB 2HHAA 1LA2A 3GF4A 2DULA 2R1VB 1KNXA 3BDIA 1EE1A 4ZT4A 3WLIA 3HFGA 4E46A 5JSFA 1XMOB 3P0EA 4CV0A 5C32A 2RKBA 4KQ2A 1CW2B 2DAPA 4IIUA 1PYOA 2Z57A 1P3Y1 2O3TA 1HH4A 3DMYA 5AQ1A 2WSBA 3HWSA 1IDOA 3HB4X 1XKLA 4KAXA 5DASA 4ZKDA 3K4HA 4LYAA 1HYQA 1EJBA 2WAXA 3I9V1 3LNCA 3WGJA 1AZLA 1NBMA 2ZB7A 2BR4A 1W9HA 3PX2A 3MAGA 3DAGA 1KIFA 4Q9DA 5T8KC 5F23A 5C8XA 4G3XA 4LXGA 3HO6A 3K70C 1U0TA 2DSNA 1EIZA 2AI2A 1U1IA 2CNLA 3IE2A 4HR7A 2R9VA 1ZRHA 3ZS8A 3C3EA 5AVTA 1RC1A 1N77A 3HJRA 4J0FA 3Q8XB 5BW6B 5I9NA 3SYRA 4HAXA 3TLBA 3UKDA 3T9EA 4TTAA 3UXYA 1Z06A 1D09A 5KQGA 2CCKA 5LKAA 3D0KA 1UBMS 4NOKA 1UJ6A 5CTJA 5D01A 5T3YA 4I81A 2ZWIA 4NYJQ 3RC2A 1H2RS 3CX6A 2PZ8A 2EFJA 5LM3A 1M3SA 3HM2A 2IHYA 5KI6A 1WULS 4B32A 1NJ6A 5EXEA 3RKSA 1ETHA 5TLSA 4BO3A 5EHNA 4EAQA 3IP1A 2FW0A 3VR6H 1XTQA 3NVMB 1UKEA 5AMXA 3S2ZA 4AY3A 3PDJA 4JLAA 5AH0A 4ZYVA 3D4NA 3CN7A 4RFSA 4I3FA 4O2AB 1UBGA 4ZQBA 4DQKA 5FYDA 10MHA 1A9XB 3DDWA 4CG1A 4PRZA 2WMDA 4QPPA 2IZ1A 3VRHA 4MAFA 4UHFA 5AXBA 4AL4A 2DFKB 2GMWA 1DJLA 1J5XA 1PLJA 4RD1A 3U44B 3JQFA 5AI5A 1BHO1 1GZ3A 2W9XA 4EG5A 3HCWA 4JT8A 4AJLA 4LBVA 2FDCA 4HZUA 3A3YA 1KQPA 1E1CB 1F3OA 1CJSA 5FJJA 5KHLB 1CE8A 2QMYA 4HNUA 2QT9A 3A6GA 3ECAA 2J9FA 4HX2A 3C6YA 2NPOA 4MB6A 4DUGA 5G2OA 5B64A 1PQPA 3OU2A 4MW7A 5FBVB 3A1NA 3JYHA 4HBGA 1NRWA 1SIWA 2IHVA 3L4EA 4Q7JB 2OC4A 3DCJA 4X60A 1XA3A 1I5RA 1JUDA 2AB0A 3IQIX 1KZHA 3ITKA 5EIOA 1WPXA 1N2CB 1U3TA 2VDRB 3RTGA 3HCCA 2AVDA 2WKSA 1R0BA 3L8ZA 4ZICA 3FSGD 3FJOA 5EAIA 4UAGA 1EAMA 1VL0A 4CQLA 1G0OA 1AOXA 2XNDA 4CG2A 1PDOA 3I6YA 2OZKA 3OQPA 2C3OA 5DHAA 3BIJA 3I2HA 5I7FA 1WB6A 3P0RA 5AUNB 5LQCA 3WOHA 2XE7A 2F17A 2GNOA 1T8TA 2QP9X 5CT4A 5EFZA 3WAGA 4FJ2A 5JSYA 1K98A 4W9NA 3SK0A 1WXGA 1S96A 3AWIA 2B5VA 3L49A 4I5IA 2B7BA 4I1OA 4B3JA 2CNKA 3UJ8A 4AKEA 2B30A 4Q4HB 3JALA 3HR7A 4YJHA 5BUCA 2AWNA 2JFQA 2VBFA 4HQOA 3BHJA 1FUEA 3NHUA 5ERXA 1IY1A 3ULKA 3I72A 3A6HA 2OFXA 1EFCA 3NTUA 3QTLA 4ZRNA 5CVCA 4XOUA 5T4EA 5KKCA 2AD1A 4KYTA 5F5NA 1AKWA 3ORHA 5HQJA 2XXAB 1N2ZA 5HIKA 1KIAA 4XVQA 1N2JA 1DC4A 2J3QA 2BFBA 3GDFA 4HDSB 2G9UA 1JQBA 4LXHA 4NHOA 1X7WB 3PXXA 3TEFA 1AU9A 3L7NA 4OGLA 2QD3A 1Q7TA 3C7AA 1FDSA 3PHBE 4LI3X 4BWYA 4EAAA 5CX4A 5IU6A 1EFRA 1UBEA 3CLUD 3IP9A 2VWQA 1S5PA 4NQZA 1KXZA 3ZIAD 1QYCA 1UBLS 2J41A 4PO8A 2PZKA 4H59A 1BW9A 4TRNA 1U3WA 2VTBA 5B58T 2H63A 1VLVA 2W2XA 2NTJA 3K73O 4LVCA 4XE5A 4TXNA 4XJVA 4K6KA 1BXZA 4LY0A 2IYYA 1JR2A 5BV2P 4X66B 2PUWA 5HX7A 3WLMA 1EGVB 2ZS7A 4JB0A 2JVKA 2O5RA 4LOHA 3BFPA 4W4TA 1TYBE 2BMWA 4NMHA 4TRRA 2OK7A 3EZ9A 1PTJC 3MUEA 1PFYA 5FTKA 3W1VA 5HGJA 1A7AA 1KYXA 1EEXB 1MN6A 5E6SA 1ML4A 3V1TC 4JJKA 1G8HA 1PZFA 2A84A 3E3LA 1JKJA 4PHFA 1T36A 5EMLA 4BQQA 1HUQA 3S8EA 1TKAA 5LBIA 1ZRMA 3RJTA 3TYXA 4GM4A 4D43A 5CB4A 5FOXA 4IEEA 2LP4Y 5HIJA 1EHYA 4AZTA 2ZE5A 1YC5A 5IYZA 3U3MA 5FI1B 2XCTB 3MHPA 5I9SA 3RWOA 4GEGA 4P3XA 4YP6A 4PVDA 2MSCB 2VSXA 1BFKA 1B43A 3ERCA 4OXXA 2HB6A 5D3MA 5EZYB 2DUNA 1IBMB 4O33A 1ZIOA 4UUBA 1L4YA 3DE3X 1XXHE 3OKCA 4XKJA 4QDOA 1OH6A 5ARCA 3WL7A 2YWCA 2IZ0A 4MRSA 1ST2A 3QLTA 1QV7A 3UMMA 4RSGA 4PNEA 1PT5A 4CT0A 3MWDB 4B85A 3WISA 2VJKA 3O4FA 4Y9RA 2HR1A 3OPYA 5TT0A 2I4LA 4ZEOA 1Z36A 1JEAA 3GT4A 1QRAA 1I0ZA 3C24A 4URUR 5CT9A 5EJ4A 1L7DA 4E08A 2Z98A 3BN3A 3KQOA 2N1BA 3QEOA 1C0KA 1JIKA 5FNVF 4BJ6A 3N74A 5F52A 4D44A 3HCRA 1J25A 1N5LA 3CEJA 3HUFA 2DUMA 5JAZA 1E3SA 4URWR 3SJCA 3B3FA 1DBVO 1JDNA 1N7IA 1FYWA 3OZSA 4O2BA 3L7YA 1L5LA 4DMMA 5JFGA 2IYXA 2VH5R 1YB2A 1CEEA 1M5UA 5JBIA 4G1UC 3CF4A 3OHMA 4KFRA 4RZXA 1L2TA 5CTAA 3K35A 1I4WA 3PQ5A 3CTPA 4FHCA 2VYQA 1R4ZA 2Q3DA 4H9GA 4TM8A 4UU0A 4AROA 1KYWA 5JYEA 1DIHA 1DBQA 1AM4D 4KPFC 2DWUA 2HTFA 3L0DA 3ED5A 3S1LA 2Z30A 3A2MA 4WKPA 2FVXA 3SD7A 1O97C 4EDFA 3WBJA 2ADOA 4Y2QA 1FRNA 3TIVA 2E4YA 4WASA 2PRIA 4F5YA 3HABA 5KTSA 5EKSA 2VK4A 3PBKA 1TK9A 3PL1A 4Q39A 4R0MA 3HJGA 4K05A 4UM5A 4D56A 3NQ41 3BM5A 2GKOA 1N1GA 2FFBA 4D5GA 1ZBDA 4MV9A 1TK2A 2AUTA 3F8SA 3OZIA 4C4AA 1RLUA 2C2BA 3OLZA 4QSMA 3SMQA 2I4RA 3EVGA 1T4DA 1VBMA 3B89A 5G1PA 3UM9A 4KXLA 5JYCA 1QOQB 4RMIA 1QU3A 3G68A 1T2VA 1TM2A 4MW1A 1Y6FA 1QZ3A 1H3FA 3HYCA 2AG5A 4ACBA 1Z6XA 1QFXA 2BEVA 4IKOA 2CHFA 3ASVA 4HZUB 2PJRA 2WAYA 1OV4A 4LRTB 4L4UA 1QGUA 3L8FA 5LYJF 2OBBA 3G2PA 3HYLA 2JJ1D 4BNTA 4C4SA 8ATCA 2BFEA 3FLAA 4BAZA 5KTTA 4KE8A 3VNBA 4YX9A 1GQRA 4X6LA 4D79A 5TXGA 1E1DA 2GCOA 2KS6A 4BNLA 4E4YA 3MTIA 1WW2A 5AK0A 2PZBA 2IELA 3K2BA 1N2CE 4L3VA 3O3OB 4LOAA 1Y8ZA 3CUKA 1XALA 4FYJA 2MDTA 4XQEA 5EIWA 3EAFA 2FUEA 4HPXB 4RZ2A 4PBTA 4MYSA 1P17A 3ZWWA 1D6MA 4L0DA 3RSZA 3JU3A 4H17A 5JWOA 1EPUA 1A82A 4CQLB 4ZCQA 3WIOA 2C7RA 2IEYA 2ID4A 3BK2A 4Q9HA 2J5BA 1TMGE 5FHRA 5DTQA 2XRZA 3A14A 4PQYA 4V2UA 4HUJA 1L7PA 1B0UA 1L4MA 2D4AA 3EC2A 3KKKA 4MGYR 3AIMA 4Z53A 2PXAA 4RTQA 3P9ZA 3CMMA 2JAUA 4XDYA 4DGQA 4S04A 3ZBUA 3ACCA 3DAOA 3OT5A 4AWBA 5M7EA 2IH5A 1FFXA 2PSEA 5CT6A 5AUQA 3G2HA 4KE9A 1YGYA 2K7ZA 4IFTA 1XU7A 4EG3A 4NU6A 3JALB 4Y9SA 3WX0A 4YJHB 2DLNA 5AVOA 4M0EA 3RVJA 3CINA 2G0TA 3ZWMA 1P9OA 3D8RA 3W9BA 4ZK2A 5J23A 3IT0A 3ZK8A 4LDZA 1TVCA 9GPBA 4CCAA 3R0VA 3RE1A 1BJRE 1PJCA 2RHDA 4M9UA 4YRRA 4ZOQI 2WQZA 1YZUA 2BFBB 2HHHB 2O2HA 3E03A 1XCGB 2EL9A 4MRPA 2A1TS 2V0CA 1A5ZA 1IWOA 2XB6A 1DKUA 3CW2A 4KR0A 1ZW1A 2W22A 3RSGA 3W5JA 3U4QA 1JQEA 3DA8A 4KQFA 1F6BA 2CFRA 4FZ3A 2VP0A 4TLMB 2HK7A 3KOYA 4BKMA 3AVTA 1P61B 4H4EA 1AK9A 1S7GA 3GPIA 3OE7D 2EG9A 1ABFA 1E63A 4OHPA 4HLQB 4D8UA 2X7JA 2YFKA 2R4UA 2G72A 2VT3A 1PJBA 3BL8A 4A5OA 2GETA 3W8DA 3MLAA 1ONSA 1V9CA 3QEJA 1K75A 4QFBA 1NF8A 1NIPA 3LK7A 5JROA 3T4UA 2AG8A 3O9MA 3W7AA 1THGA 3AF4A 3GLKA 5AKJA 4XA8A 5B3JA 4WBSA 3RHFA 4AJ4A 2ZRQA 5CFNA 3IESA 5C4GB 4M1KA 2XGMA 4P84A 4XM2A 4EATA 5ERGB 4BNGA 3E3MA 4DTCA 4MW5A 3R3WA 4YV1A 1R6TA 1WVIA 4WQMA 3TZ6A 1U0BB 4D96A 5AW4A 3AW8A 3W5BA 3KVOA 3L5OA 1ZMXA 2BOVA 2X23A 3EIHA 2IU6A 3EIXA 3PHHA 3FOEC 1UPAA 4DYVA 2UXBB 4J2TA 1CUSA 2PUBA 2R66A 3K09A 1LJUA 3K7EA 3DZGA 3SEQA 2ZQZA 4PBRA 5B2ZA 2V3CC 4AF7A 1DQRA 1VZ2A 1ZICA 2GBLA 3KKOA 2X22A 4KQGA 5D3MB 4GZ6A 3FDFA 2VDKB 2OWEA 4Y0NA 3X1YA 3LQQA 4EGJA 4JN6B 1JIJA 2WYHA 2YIDA 3ZXYA 1AUXA 2QTWB 4BVHA 1N5KA 4MLDA 2GJKA 4GGOA 1Q19A 4B3XA 5DF1A 5A5DA 5C5IA 3DAHA 1TYAE 4IMJB 5LB4A 1DBIA 3EF3A 1D3AA 3CF2A 4XASA 3OPYB 3GFQA 4Y6OA 4PSAA 1E58A 1GZ7A 3GLTA 4JJGA 5JY6A 4KZKA 1Z37A 1YF3A 2XWSA 2Z2YA 2SNIE 3NUGA 2NLOA 3WIBA 1Z0KA 3R5KA 1U8EA 1NUUA 1KQGA 1QFYA 1CVLA 2ZI3A 2A88A 1LVGA 4EMTA 5ADVA 4JV5B 1SKMA 4UOZA 5I7AA 3CZ5A 4RIFA 1ZGZA 3NX4A 4L4SA 1EHCA 2FMFA 1YS4A 4O2BB 2NG1A 3DEYX 4X91A 2DUUA 3N0TA 2DWPA 3LCVB 2W58A 1Q5PA 1SQ0A 1P5HA 2G9VA 2KJQA 4KAJA 4D9EA 3HYSA 3A6EA 3LVBA 4IQ0A 4OU4A 4IS3A 3Q3GE 1T5IA 4GP6A 5J5VA 1LNSA 4MZXA 5EJFA 2NU8A 3MS7A 4HLCA 2FHPA 4M98A 2AN1A 2NU7A 1N6RA 3T41A 1TYCA 5I4IA 4BEWA 1D07A 1GLVA 3BWMA 4FYIA 1EK2A 5ITWA 2NTEA 1RRGA 3ENNA 4ROSA 4WV3A 5AQEA 4K9LA 2FG6C 4OPMA 3BB3A 1MHTA 3GQBA 4TS4A 1WG8A 1ZINA 2Z4TA 5BRAA 3ZHVA 2DFDA 2IFTA 1YNSA 2RB5A 3IA7A 5ILQA 5DWQA 2J3IA 2V7VA 2Y8EA 1E9SA 3B8EA 1YRYE 4KTTE 2HT6A 1T0HB 3D64A 3NASA 3PIDA 4DZZA 1E61A 3LGSA 3GLGA 4IXWA 5JD5A 2XKJE 3RAGA 4XD7A 4E5VA 5DYNA 2QUIA 1Y6QA 2PCJA 3CWQA 1YOBA 1U2PA 2BMFA 3Q1LA 3JZDA 4I5FA 1AC5A 1E8NA 3AP3A 4ZK6A 1NASA 2BEVB 4H60A 1EFHA 1DKLA 1K2VN 2Y66A 3IQXA 1QGUB 1E5QA 1PWEA 5FOQA 4ZFNA 4RSMA 2ZWOA 1AF4A 3K5WA 4DIUA 4KLNA 2GTPA 1II8A 2W4IA 1MEOA 3RKUA 5BUQA 3SXUB 4MA5A 2H3EA 4L8VA 2V7PA 1WNFA 5DT9A 2HBZA 4B8WA 1OWPA 5NULA 1RACA 5KWIA 1NDQA 5JS2A 1LQUA 2XD4A 3ZR4B 1IQRA 3D5QA 3FFXA 4EJMA 1JQLB 5FL3A 1GITA 3WWPA 1IC6A 4KUEA 5DHTA 3CEPB 3UOWA 3W5CA 2F2TA 1KH2A 1KI9A 2JBWA 2WRZA 1FVXA 3DL0A 3G8DA 1YVUA 3NOXA 3GFOA 4H3HB 3F4LA 3Q0EA 4OMCA 4NK5A 4PHTA 4R7TA 1M54A 3C4VA 2XCIA 4JXZA 2QX4A 2WG1A 2LPMA 4TYQA 4P98A 3TZQA 5L8VA 1KXJA 2P4QA 5C7LO 3EPJA 4LYHA 2PLWA 2OCIA 1MH9A 3D7LA 1U7HA 1V5IA 5CDFA 1Y34E 2WP8J 3CA8A 1CF9A 3UW1A 5CFQA 5DGIA 1DQYA 1FFXB 1A69A 2DKOA 4MKFA 1ZS9A 2P4EA 3IXMA 3RUFA 3NOQA 2K87A 4FGLA 5E6RA 5I8WA 3OZRA 4PG6A 4OD0A 3VUFA 1L9KA 2PZEA 3HL0A 2BZGA 1VMIA 3LO5A 3MSXA 2H65A 3KLMX 3H05A 1YUMA 3FRHA 4BWVA 3BHMA 1U7XA 2E21A 2GVZC 3LPAA 4LJ5A 3UOGA 1E32A 1U1DA 1TKCA 3O8LA 4TSKA 4ASUA 2ZS9A 4BS9A 4F8YA 1HT1E 5LL6P 2NAFA 3SICE 4N5IX 4PAQA 1PT6A 4RLHA 1U9YA 2P0YA 3IPCA 4OHWA 4KMRA 1QONA 1KFKB 4RZQA 4YCJA 5H4HA 2W6QA 3P27A 1T5BA 4LNAA 5AKKA 2ZEJA 3LL7A 3OZEA 2WIKA 4EB6A 1ESDA 2IPLA 5HSGA 5KYNA 3U39A 3PUYA 4INOA 3A6LA 1QQBA 2QZ9A 4MINA 5E9JA 1WB9A 1KEPA 3UJ6A 5JZ9A 3H6HA 5GV7A 3TDNA 4QPNA 4TTQA 1K66A 2REXB 2E4UA 3O3CA 5E7MA 2C82A 4D7AA 3Q2OA 2Q8PA 3JY6A 4FWIB 1UXKA 2IQ5A 2JLYA 2CB9A 4U7DA 2JLUA 5EJMA 5AI6A 4B45A 1JT9A 3P5SA 1RP1A 3AFHA 4I19A 3FXAA 4TVKA 1L5HA 4BFWA 3OWOA 2H9YA 4ZAXA 4CKWA 3Q3EA 3K96A 4HAWA 1Z12A 3AFOA 1U7OA 1H2YA 2A1UA 4MUBA 5I47A 3MMNA 4ZT3A 4OLHA 2VPTA 3UGJA 1PEAA 4QT4A 1MMFB 1BXGA 1G59A 2FMIA 3IIEA 4EPYA 3LT0A 4PGMA 5JNTA 1Y3IA 2CMDA 4FINA 4QWWA 4NPCA 4D5EA 1FDOA 1LU9A 2X0EA 2Z6AA 3BJZA 3K0AA 1OUMA 2QS9A 3EMDA 2D2XA 3GD5A 4JX8A 4EKGA 5KNBA 2NGRA 4QM6A 2AJTA 3PFIA 3FSRA 3VKWA 3TECE 3SHWA 5BRNA 4NCKA 4IJMA 1YZFA 3DD1A 1SQFA 1VKJA 1P4GA 4JQCA 2CLCX 2H6EA 1JWLA 3L02A 5F5XA 1DUVG 4OI4A 1SBTA 5P8WA 2KLHA 1C80A 1CUVA 1EVIA 3KUDA 3UUFA 3FR8A 3W6PA 3EQZA 1ZG3A 2O8BA 4IDFA 3BSSA 3OLVA 4IFBA 3EH1A 3KR9A 4A82A 4J90A 3P96A 5JR3A 1IVYA 3V48A 5LJIA 3G1UA 1FMJA 1OWMA 2ANBA 2O2CA 3SKXA 2NPIA 2POQX 1G9TA 1QB8A 3AI2A 3HBLA 5HK8A 3GX1A 4JFRA 4B43A 2B82A 4L9RA 3W1EA 2O0KA 4ZIRA 3FKQA 1NMQA 5JEDA 4Z4IA 2UV8A 2ZFUA 3FKSD 4HP8A 1VSUA 4D1YA 1HQCA 2NYVA 1AS3A 3MWFA 2ZZKA 3DTNA 4MLZA 4BUZA 2JATA 5FTNA 4E2YA 1BMTA 3KT0A 4YI5A 1DKQA 3IELA 1KY5A 2WJHA 5CH8A 5CX1A 2DFTA 3UPTA 4Z1MA 5FORA 1VLLA 2NYRA 1QUFA 1VIAA 3BQMB 3M6LA 4RZIA 1C7FA 1VBKA 2AOTA 5TY0A 1CEXA 1T35A 2H3HA 3FLBA 4KO2S 3IDSA 5SZKB 2XWJI 3SF8A 2I3ZA 2ERYA 1N5DA 2OFPA 3CO0S 4LWQA 1TIBA 4U6SA 3WTBA 4YMVA 1Z22A 1U0HC 3KZCA 1F2TA 1UKCA 2AEJA 3G88A 3ELYA 5ECWA 3IULA 4V0OA 2NACA 3QSGA 1MX3A 2YZ7A 4PIMA 1H4TA 1N2SA 1VE6A 2A5LA 2ZR7A 4AIRA 5BN3A 5BURA 5C8YB 5KCZA 5KBYA 3IAUA 2OT3B 2AKYA 1X39A 4HRVA 1CUZA 3OLYA 2RONA 1L5SA 3HXOA 3GLGB 1V1JA 3F7MA 1A8UA 1OX4B 2A33A 1JHUA 2R60A 2X2OA 2YWXA 2YJNA 5EMKA 1G41A 1JAIA 3FVVA 3IOEA 1GVNB 3PA8A 2KM1A 3RRZA 1F2VA 3WLOA 5K9ZA 1GKUB 1D2GA 1V8DA 3CW9A 1Y98A 2IYOA 4V0MA 5TMEA 4IH4A 1Q2UA 2X77A 4BE9A 1TCCA 1OKKA 3ESDA 3HVJA 6CHYA 4WINA 3HVHA 1R88A 3PT9A 4FMDB 4CF5A 5HZGA 1PL7A 2F7SA 2YUTA 3LT4A 5K05A 2B6NA 3GGPA 2WV7A 5AK3A 1KO7A 1D5CA 1II8B 1HWYA 3O73A 4DJDC 4F1KA 5BSVA 2P11A 5JOQA 1PO7A 3T5DA 4DPMA 1YS9A 1RRFA 1RBMA 2G36A 2P9HA 2BBSA 5IK2D 3RS0A 1KP2A 2QTNA 1JAXA 1X8LA 1QG6A 3CH6A 3V1LA 1JZQA 4C7OB 1ORIA 2IF0A 4Z8XA 3SE7A 1ACJA 3SU8A 3IB3A 4ZAZA 1Z0AA 3KC2A 4B4VA 3DXFA 1NU6A 2PVSA 2VNIA 2C00A 2APJA 4PPGA 5EOVA 1BMDA 2GYUA 2MJLA 1TEHA 3UTDA 3TKLA 3P71T 1X42A 5TARA 1M8KA 1B6SA 2YMQA 4FDMA 4FMCF 4I55A 4ZCLA 4DA4A 3QLUC 2GRUA 5COQA 2OBLA 3AVVA 4UHJA 2P2CA 3V2IA 3IR6A 4JP5A 4YREA 3P2OA 4HUQA 3GRPA 5ALSA 1L5KA 4K28A 5BSFA 4CV1A 2VF8A 5E6RB 5TRTA 2BSQA 3ETHA 1CU1A 1LWOA 4JD5A 4R2KA 4DV1B 5HFNA 4F12A 4YMTA 1U0OC 4R3NA 2OXRA 1G55A 3QENA 2GEFA 4LOKA 1J22A 1JNYA 2JGRA 3PUKA 3HUDA 2ZAIA 3N5CA 3TGWA 3OSZA 4YB8A 4D98A 4J43A 3S2YA 4B44A 2H1FA 3VZQA 1NSFA 3K0CA 4YV0A 1UOEA 1P91A 1ZNXA 2C31A 4U2CA 3IP7A 2J7PA 3BAZA 4GW3A 4AG6A 2OVFA 5FPYA 4HJXA 4Y18A 3W9YA 5B7NA 5IM4F 3CNHA 1B8UA 3D3QA 2UDPA 3WLJA 5LP1A 1X1EA 2QVZX 3IAS1 3MPUA 2FPIA 3E9YA 3KFLA 4EB6B 4RF2A 4U9UA 5E38A 3UHJA 2AT1A 1LI7A 5CB0A 1J39A 2OE2A 2IHTA 1LDMA 3OQBA 1I14A 2ZKLA 2YNMD 4U39A 3JQEA 2IYQA 4JYZA 2PRYA 4FMBB 1OD6A 3EARA 1SC3A 2QQGA 4GMFA 3WIUA 4W5OA 5CCEA 1Z74A 1B2RA 2GBPA 4R6WA 3EVCA 5KC8A 3E70C 5J9FA 5AJYA 2JIPA 3I8SA 1CUGA 3O38A 1WSDA 1QP8A 1RWQA 3CVJA 5IN5A 1AHPA 4EQZA 2ATCA 4L6AA 2EG5A 2Q6VA 3KAKA 3NDPA 1QGAA 4G63A 1WOYA 4HGOA 3ZHZA 1IOZA 3DDZX 1L5HB 3IVRA 3UF0A 2HSWA 1NN0A 1ULZA 2C92A 2PSFA 4Q66C 4TS1A 5WRFA 5BPFA 2A1UB 4AZ3A 1JR3A 1TTQB 1KSFX 1J24A 1SURA 1RBQA 2J0VA 3EA0A 3EVBA 1BXGB 3G1TA 1WU8A 3OJCA 1DRJA 3BTUA 4BMCA 1II9A 3JQPA 4NICA 4Q3LA 2Y4OA 4Y3UA 4YJDA 4DNQA 5AIBA 5KDOA 5HRUA 5F9FA 4HEQA 2XWQA 2W0MA 3R09A 2X4IA 3K0AB 3MXTA 5IG2A 1E98A 1NKTA 2NSHA 4I2NA 1UK8A 1W4BA 4RK1A 2W4MA 3IAEA 1AZWA 4RZHA 1BCSB 4BNFA 4LDNA 2IODA 4F38A 3AHJA 5ECYA 4DCSA 4EARA 1N34B 4QUKA 3TFOA 4HH3C 3L1IA 1TT7A 3OQIA 4I9UA 4L3OA 4OBBA 4NULA 2P78A 1L5MA 4LZOA 5K2OA 5FA8A 1CF2O 3IFSA 1P4JA 1V3TA 2A1TR 5A05A 1XRJA 1Y7HA 4ID9A 1C30B 5L4NA 5LZ2A 4TTSA 1VIYA 4ZQCB 1QO0A 4O1MA 4LFBB 2JCVA 4B7UA 1IM5A 1HYEA 4W1PA 5DJ5A 1KU6A 1FP4A 4WBXC 2C9YA 3AUAA 4ZI3A 4EHNA 2B6HA 1AV6A 2J3KA 1Z29A 1ONBA 3W4KA 4E14A 5J2UF 4BJHB 2XTJA 1TUIA 1M2HA 4JU9A 4L22A 4H1VA 4YMUA 1NAIA 2ATVA 4GLBA 2N46A 4KIGA 5AM2A 5EL0A 3DLCA 4RHTA 5DHRA 1RHMA 4FJ0A 4TKMA 5TEVA 4DJEC 2CWDA 4GYJA 5HKLA 2X6TA 4RTPA 1XPRA 3A26A 4WOPA 4XTCS 3VU0A 2XRYA 4QTUB 4NZZA 4ZIRB 2HIMA 4M87A 4GPIB 4ITUA 3LTNC 3PHJA 3TTUA 2QRGA 4L3WA 4RO0A 1L1FA 1JJIA 4R9SA 2Z5GA 1QQ5A 1B3RA 1QE5A 2CL5A 1JLLB 1WKBA 4LX0A 4P7GA 4ZVRA 5FBRB 1L1RA 3A9SA 4OY3A 1T4BA 5CX1B 2C2XA 4P4LA 1SHJA 1T1RA 3C0KA 4ZVTA 3IEXA 1FLNA 1E2LA 3KYDA 3NHYA 2XUIA 3WWOA 3AU8A 3GZ4A 5MF6A 2QUKA 4JJIA 2BHSA 4IQ8A 4LSZA 1FVHA 1DLIA 3KKEA 4N3BA 3R5HA 5AM0A 3CNBA 3H2HA 3GT0A 3H3XA 1NVBA 2ISCA 4Q19A 1DS6A 3NM4A 3OM8A 2GN4A 2J5RA 4HAVA 3IILA 1F2TB 3ONDA 1U94A 1KAEA 2PGIA 1SIBE 4OXQA 3DHEA 2ZSEA 2HWYA 2RJNA 3K2IA 1Z63A 3UEOA 1EM6A 4JI6B 3SSOA 4E32A 3RVKA 1A50B 5IKEA 1SBZA 1N8TA 3K9WA 5LZ4A 1T9BA 3NHKA 3PFNA 3DUFA 3IURA 2HMVA 1J0XO 2QRPA 2WFAA 3NBAA 4GVPA 1U8FO 3CUVA 4LS3A 1NNI1 1GYRA 2J87A 4EYKA 1CQXA 3G8AA 3EPKA 2ONCA 2CSXA 2HV9A 3TLZA 1GR1A 4A0QA 4RVFA 3GFPA 1LPBB 1SEVA 2AS0A 3COSA 4R01A 4HDOB 2REQA 4OAQA 4D57A 3QFTA 4KKVA 3T9FA 5A4AA 1I5EA 3IUYA 4ZOLF 3GJ5A 2IUYA 3WXBA 5JXJA 4Y0AA 4KC0A 1ZHOA 5CVVA 4OHFA 1PVDA 3OJEA 3V7WA 1K0UA 4N8EA 4AZSA 3VPGA 4XUEA 4TZTA 5C3UA 3RJ5A 4YMLA 1Q50A 3KJXA 3E05A 2MSNA 3C70A 5B58C 3DOFA 4I4TF 1Q95A 1DX4A 5LQUA 1F7VA 1E2HA 3IH5A 4ZARA 4B1FA 4K46A 1U28C 1LLFA 3I52A 5DH9A 5JD6A 2VUIB 5D84A 3U7RA 2QTRA 1Z88A 2Q9UA 3DGFC 4L15A 4DIOA 2W2PA 1SK9A 2IEZA 3KXPA 4A2CA 2JCXA 5CFMA 5I7SA 4FCTA 1P18A 1XELA 3LX5A 4KNWA 4F4CA 4V03A 4PRKA 4U8HA 3D2AA 5FNVB 4CLDA 2WYVA 4HDQB 4JJ8A 1Z45A 1F06A 3DT8A 1RFLA 3IA2A 1Q3HA 4PE5B 1DUIA 4K9RA 3KAJA 2ZYAA 2WP0A 5CXUA 2I87A