2NTBA

Crystal structure of pectin methylesterase in complex with hexasaccharide v
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
molecule keywords Pectinesterase A
molecule tags Hydrolase
source organism Erwinia chrysanthemi
total genus 124
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntbA00
2QY1A 1OFLA 3T9GA 4NK8A 3VMWA 2UVFA 2X3HA 3FY3A 1EE6A 1O8FA 1O8HA 3B4NA 1GQ8A 4W8RA 1K5CA 1AIRA 5C1CA 2VJIA 2NSTA 2Z8GA 4XL9A 2O1DA 1DBGA 2QX3A 2X6YA 2VBEA 4XLFA 1QJVA 3SUCA 1VBLA 4U49A 1O8JA 2NSPA 4Z06A 1KCDA 4URRA 1IB4A 1BHEA 4OZZA 2O17A 1OOCA 2O0VA 4NK6A 2PYHA 1KTWA 1OGOX 1PXZA 4W8QA 1OFMA 2O04A 2UVEA 1H80A 4XOTA 2NTBA 4OJ5A 4XONA 2INVA 3B90A 3GQ9A 4XR6A 4XQFA 1IDKA 1O8GA 1OGMX 2O0WA 3EQOA 4MXNA 4XOPA 4YEJA 1RWRA 3KRGA 4XMYA 4OJLA 1O8MA 4YZ0A 2PECA 1O8IA 2EWEA 1BN8A 2NT6A 2NZMA 4YZQA 3ZPPA 4Z03A 1RMGA 4YZXA 3GRHA 4XKVA 3GQ7A 3UW0A 1KCCA 4XLCA 3WWGA 4XLHA 2NTQA 2VBKA 4EW9A 5C1EA 2X6WA 1X0CA 2NT9A 2X85A 4U4BA 4YELA 4OZYA 1IA5A 1NHCA 1XG2A 1O88A 1HG8A 3VMVA 1QCXA 4OJPA 1O8EA 4YZAA 3VSUA 1JTAA 4XLAA 2VJJA 2QXZA 2PYGA 4MR0A 2INUA 5AMVA 2ODLA 4W8TA 4XNFA 4AVZA 1RU4A 4OJ6A 4XORA 1O8LA 4W8SA 2X6XA 4XN3A 2NTPA 4C2LA 1CZFA 3GQ8A 4Z05A 4XLEA 2BSPA 1PE9A 1JRGA 4PMHA 2IQ7A 4XM3A 4XKWA 1IDJA 3EQNA 1O8DA 1PLUA 1WMRA 3B8YA 4HWVA 4XN0A 3JURA 3VSTA 3LMWA 3GQAA 1DBOA 1O8KA 3VSVA 4I84A 3ZSCA 4OJOA 2VBMA
chains in the Genus database with same CATH superfamily
2QY1A 2VFNA 5DNSA 2BM4A 2XC1A 1OFLA 4OPWA 1K4ZA 4NK8A 3T9GA 2UVFA 4YDTA 3VMWA 1TYUA 2X3HA 3FY3A 2B0RA 3NAWA 3P4GA 1EE6A 1WXRA 1O8FA 1O8HA 3B4NA 1OFDA 2XTXA 1GQ8A 4W8RA 3JX8A 1K5CA 1AIRA 2YUHA 5C1CA 2VJIA 2VFPA 2NSTA 2Z8GA 4KH3A 4XL9A 2O1DA 1DBGA 2QX3A 2X6YA 2VBEA 3H09A 4XLFA 1CLWA 1QA1A 1QJVA 3SQVA 3SUCA 1VBLA 4U49A 2BM7A 1O8JA 3N90A 2NSPA 1LM1A 1DABA 4Z06A 1KCDA 2QZAA 4URRA 1IB4A 3PETA 1BHEA 1QRBA 4OZZA 2J8KA 2O17A 1KQ5A 1OFEA 1OOCA 2O0VA 4NK6A 2XTWA 2PYHA 1KTWA 1OGOX 1PXZA 4W8QA 1OFMA 2O04A 2UVEA 1H80A 1HF2A 4XOTA 2NTBA 2BX6A 4OJ5A 2IOUG 3LYCA 4XONA 2INVA 1TYWA 3B90A 3GQ9A 4XR6A 4XQFA 1IDKA 1O8GA 1OGMX 1TYXA 2O0WA 3EQOA 4MXNA 4XOPA 1EA0A 4YEJA 1RWRA 3KRGA 1QA2A 4XMYA 4OJLA 4V02C 1O8MA 1TYVA 4YZ0A 3BH6B 2PECA 1O8IA 2EWEA 2XTYA 1BN8A 2NT6A 2NZMA 4YZQA 3ZPPA 4Z03A 1RMGA 2BM6A 4YZXA 3NB2A 3GRHA 4XKVA 3GQ7A 3UW0A 1KCCA 4XLCA 3ML3A 3WWGA 2XT4A 4XLHA 2NTQA 2VBKA 2J8IA 2W7ZA 4EW9A 2V5IA 3PSSA 2X6WA 5C1EA 1QQ1A 1X0CA 2NT9A 1TSPA 2X85A 4OM9A 2VBMA 4U4BA 3PSZA 4OZYA 4YELA 1IA5A 5JMCB 1NHCA 2F3LA 1XG2A 1O88A 3SY2A 2G0YA 1HG8A 3TH0A 3SZEA 3VMVA 4YCQA 1QCXA 4OJPA 1O8EA 4YZAA 5JLVC 3VSUA 1JTAA 4XLAA 2VJJA 1QA3A 2QXZA 2PYGA 4YEIA 4MR0A 2INUA 5AMVA 2ODLA 4W8TA 4XNFA 3SYJA 4AVZA 1RU4A 4OJ6A 2BM5A 4JRAC 4XORA 1O8LA 4W8SA 2X6XA 4XN3A 2NTPA 3RIQA 3BH7B 2QYUA 2XT2A 4C2LA 2O6WA 2VFQA 3DU1X 3AK5A 1CZFA 1LLWA 3GQ8A 4Z05A 4XLEA 1QRCA 4YC5A 2BSPA 1PE9A 1JRGA 4PMHA 2IQ7A 3N6ZA 4XKWA 4XM3A 1IDJA 3EQNA 1O8DA 4YFOA 1PLUA 2VFOA 2VFMA 1WMRA 3B8YA 4HWVA 4XN0A 3JURA 3VSTA 1LLZA 3LMWA 1K8FA 3GQAA 1DBOA 1O8KA 3LJYA 3VSVA 1L1IA 4I84A 3ZSCA 4OJOA 1EZGA
chains in the Genus database with same CATH topology
2QY1A 1OFLA 3T9GA 4NK8A 3VMWA 2UVFA 2X3HA 3FY3A 1EE6A 1O8FA 1O8HA 3B4NA 1GQ8A 4W8RA 1K5CA 1AIRA 5C1CA 2VJIA 2NSTA 2Z8GA 4XL9A 2O1DA 1DBGA 2QX3A 2X6YA 2VBEA 4XLFA 1QJVA 3SUCA 1VBLA 4U49A 1O8JA 2NSPA 4Z06A 1KCDA 4URRA 1IB4A 1BHEA 4OZZA 2O17A 1OOCA 2O0VA 4NK6A 2PYHA 1KTWA 1OGOX 1PXZA 4W8QA 1OFMA 2O04A 2UVEA 1H80A 4XOTA 2NTBA 4OJ5A 4XONA 2INVA 3B90A 3GQ9A 4XR6A 4XQFA 1IDKA 1O8GA 1OGMX 2O0WA 3EQOA 4MXNA 4XOPA 4YEJA 1RWRA 3KRGA 4XMYA 4OJLA 1O8MA 4YZ0A 2PECA 1O8IA 2EWEA 1BN8A 2NT6A 2NZMA 4YZQA 3ZPPA 4Z03A 1RMGA 4YZXA 3GRHA 4XKVA 3GQ7A 3UW0A 1KCCA 4XLCA 3WWGA 4XLHA 2NTQA 2VBKA 4EW9A 5C1EA 2X6WA 1X0CA 2NT9A 2X85A 4U4BA 4YELA 4OZYA 1IA5A 1NHCA 1XG2A 1O88A 1HG8A 3VMVA 1QCXA 4OJPA 1O8EA 4YZAA 3VSUA 1JTAA 4XLAA 2VJJA 2QXZA 2PYGA 4MR0A 2INUA 5AMVA 2ODLA 4W8TA 4XNFA 4AVZA 1RU4A 4OJ6A 4XORA 1O8LA 4W8SA 2X6XA 4XN3A 2NTPA 4C2LA 1CZFA 3GQ8A 4Z05A 4XLEA 2BSPA 1PE9A 1JRGA 4PMHA 2IQ7A 4XM3A 4XKWA 1IDJA 3EQNA 1O8DA 1PLUA 1WMRA 3B8YA 4HWVA 4XN0A 3JURA 3VSTA 3LMWA 3GQAA 1DBOA 1O8KA 3VSVA 4I84A 3ZSCA 4OJOA 2VBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QY1 A;  1OFL A;  3T9G A;  4NK8 A;  3VMW A;  2UVF A;  2X3H A;  3FY3 A;  1EE6 A;  1O8F A;  1O8H A;  3B4N A;  1GQ8 A;  4W8R A;  1K5C A;  1AIR A;  5C1C A;  2VJI A;  2NST A;  2Z8G A;  4XL9 A;  2O1D A;  1DBG A;  2QX3 A;  2X6Y A;  2VBE A;  4XLF A;  1QJV A;  3SUC A;  1VBL A;  4U49 A;  1O8J A;  2NSP A;  4Z06 A;  1KCD A;  4URR A;  1IB4 A;  1BHE A;  4OZZ A;  2O17 A;  1OOC A;  2O0V A;  4NK6 A;  2PYH A;  1KTW A;  1OGO X;  1PXZ A;  4W8Q A;  1OFM A;  2O04 A;  2UVE A;  1H80 A;  4XOT A;  2NTB A;  4OJ5 A;  4XON A;  2INV A;  3B90 A;  3GQ9 A;  4XR6 A;  4XQF A;  1IDK A;  1O8G A;  1OGM X;  2O0W A;  3EQO A;  4MXN A;  4XOP A;  4YEJ A;  1RWR A;  3KRG A;  4XMY A;  4OJL A;  1O8M A;  4YZ0 A;  2PEC A;  1O8I A;  2EWE A;  1BN8 A;  2NT6 A;  2NZM A;  4YZQ A;  3ZPP A;  4Z03 A;  1RMG A;  4YZX A;  3GRH A;  4XKV A;  3GQ7 A;  3UW0 A;  1KCC A;  4XLC A;  3WWG A;  4XLH A;  2NTQ A;  2VBK A;  4EW9 A;  5C1E A;  2X6W A;  1X0C A;  2NT9 A;  2X85 A;  4U4B A;  4YEL A;  4OZY A;  1IA5 A;  1NHC A;  1XG2 A;  1O88 A;  1HG8 A;  3VMV A;  1QCX A;  4OJP A;  1O8E A;  4YZA A;  3VSU A;  1JTA A;  4XLA A;  2VJJ A;  2QXZ A;  2PYG A;  4MR0 A;  2INU A;  5AMV A;  2ODL A;  4W8T A;  4XNF A;  4AVZ A;  1RU4 A;  4OJ6 A;  4XOR A;  1O8L A;  4W8S A;  2X6X A;  4XN3 A;  2NTP A;  4C2L A;  1CZF A;  3GQ8 A;  4Z05 A;  4XLE A;  2BSP A;  1PE9 A;  1JRG A;  4PMH A;  2IQ7 A;  4XM3 A;  4XKW A;  1IDJ A;  3EQN A;  1O8D A;  1PLU A;  1WMR A;  3B8Y A;  4HWV A;  4XN0 A;  3JUR A;  3VST A;  3LMW A;  3GQA A;  1DBO A;  1O8K A;  3VSV A;  4I84 A;  3ZSC A;  4OJO A;  2VBM A; 
#chains in the Genus database with same CATH topology
 2QY1 A;  2VFN A;  5DNS A;  2BM4 A;  2XC1 A;  1OFL A;  4OPW A;  1K4Z A;  4NK8 A;  3T9G A;  2UVF A;  4YDT A;  3VMW A;  1TYU A;  2X3H A;  3FY3 A;  2B0R A;  3NAW A;  3P4G A;  1EE6 A;  1WXR A;  1O8F A;  1O8H A;  3B4N A;  1OFD A;  2XTX A;  1GQ8 A;  4W8R A;  3JX8 A;  1K5C A;  1AIR A;  2YUH A;  5C1C A;  2VJI A;  2VFP A;  2NST A;  2Z8G A;  4KH3 A;  4XL9 A;  2O1D A;  1DBG A;  2QX3 A;  2X6Y A;  2VBE A;  3H09 A;  4XLF A;  1CLW A;  1QA1 A;  1QJV A;  3SQV A;  3SUC A;  1VBL A;  4U49 A;  2BM7 A;  1O8J A;  3N90 A;  2NSP A;  1LM1 A;  1DAB A;  4Z06 A;  1KCD A;  2QZA A;  4URR A;  1IB4 A;  3PET A;  1BHE A;  1QRB A;  4OZZ A;  2J8K A;  2O17 A;  1KQ5 A;  1OFE A;  1OOC A;  2O0V A;  4NK6 A;  2XTW A;  2PYH A;  1KTW A;  1OGO X;  1PXZ A;  4W8Q A;  1OFM A;  2O04 A;  2UVE A;  1H80 A;  1HF2 A;  4XOT A;  2NTB A;  2BX6 A;  4OJ5 A;  2IOU G;  3LYC A;  4XON A;  2INV A;  1TYW A;  3B90 A;  3GQ9 A;  4XR6 A;  4XQF A;  1IDK A;  1O8G A;  1OGM X;  1TYX A;  2O0W A;  3EQO A;  4MXN A;  4XOP A;  1EA0 A;  4YEJ A;  1RWR A;  3KRG A;  1QA2 A;  4XMY A;  4OJL A;  4V02 C;  1O8M A;  1TYV A;  4YZ0 A;  3BH6 B;  2PEC A;  1O8I A;  2EWE A;  2XTY A;  1BN8 A;  2NT6 A;  2NZM A;  4YZQ A;  3ZPP A;  4Z03 A;  1RMG A;  2BM6 A;  4YZX A;  3NB2 A;  3GRH A;  4XKV A;  3GQ7 A;  3UW0 A;  1KCC A;  4XLC A;  3ML3 A;  3WWG A;  2XT4 A;  4XLH A;  2NTQ A;  2VBK A;  2J8I A;  2W7Z A;  4EW9 A;  2V5I A;  3PSS A;  2X6W A;  5C1E A;  1QQ1 A;  1X0C A;  2NT9 A;  1TSP A;  2X85 A;  4OM9 A;  2VBM A;  4U4B A;  3PSZ A;  4OZY A;  4YEL A;  1IA5 A;  5JMC B;  1NHC A;  2F3L A;  1XG2 A;  1O88 A;  3SY2 A;  2G0Y A;  1HG8 A;  3TH0 A;  3SZE A;  3VMV A;  4YCQ A;  1QCX A;  4OJP A;  1O8E A;  4YZA A;  5JLV C;  3VSU A;  1JTA A;  4XLA A;  2VJJ A;  1QA3 A;  2QXZ A;  2PYG A;  4YEI A;  4MR0 A;  2INU A;  5AMV A;  2ODL A;  4W8T A;  4XNF A;  3SYJ A;  4AVZ A;  1RU4 A;  4OJ6 A;  2BM5 A;  4JRA C;  4XOR A;  1O8L A;  4W8S A;  2X6X A;  4XN3 A;  2NTP A;  3RIQ A;  3BH7 B;  2QYU A;  2XT2 A;  4C2L A;  2O6W A;  2VFQ A;  3DU1 X;  3AK5 A;  1CZF A;  1LLW A;  3GQ8 A;  4Z05 A;  4XLE A;  1QRC A;  4YC5 A;  2BSP A;  1PE9 A;  1JRG A;  4PMH A;  2IQ7 A;  3N6Z A;  4XKW A;  4XM3 A;  1IDJ A;  3EQN A;  1O8D A;  4YFO A;  1PLU A;  2VFO A;  2VFM A;  1WMR A;  3B8Y A;  4HWV A;  4XN0 A;  3JUR A;  3VST A;  1LLZ A;  3LMW A;  1K8F A;  3GQA A;  1DBO A;  1O8K A;  3LJY A;  3VSV A;  1L1I A;  4I84 A;  3ZSC A;  4OJO A;  1EZG A; 
#chains in the Genus database with same CATH homology
 2QY1 A;  1OFL A;  3T9G A;  4NK8 A;  3VMW A;  2UVF A;  2X3H A;  3FY3 A;  1EE6 A;  1O8F A;  1O8H A;  3B4N A;  1GQ8 A;  4W8R A;  1K5C A;  1AIR A;  5C1C A;  2VJI A;  2NST A;  2Z8G A;  4XL9 A;  2O1D A;  1DBG A;  2QX3 A;  2X6Y A;  2VBE A;  4XLF A;  1QJV A;  3SUC A;  1VBL A;  4U49 A;  1O8J A;  2NSP A;  4Z06 A;  1KCD A;  4URR A;  1IB4 A;  1BHE A;  4OZZ A;  2O17 A;  1OOC A;  2O0V A;  4NK6 A;  2PYH A;  1KTW A;  1OGO X;  1PXZ A;  4W8Q A;  1OFM A;  2O04 A;  2UVE A;  1H80 A;  4XOT A;  2NTB A;  4OJ5 A;  4XON A;  2INV A;  3B90 A;  3GQ9 A;  4XR6 A;  4XQF A;  1IDK A;  1O8G A;  1OGM X;  2O0W A;  3EQO A;  4MXN A;  4XOP A;  4YEJ A;  1RWR A;  3KRG A;  4XMY A;  4OJL A;  1O8M A;  4YZ0 A;  2PEC A;  1O8I A;  2EWE A;  1BN8 A;  2NT6 A;  2NZM A;  4YZQ A;  3ZPP A;  4Z03 A;  1RMG A;  4YZX A;  3GRH A;  4XKV A;  3GQ7 A;  3UW0 A;  1KCC A;  4XLC A;  3WWG A;  4XLH A;  2NTQ A;  2VBK A;  4EW9 A;  5C1E A;  2X6W A;  1X0C A;  2NT9 A;  2X85 A;  4U4B A;  4YEL A;  4OZY A;  1IA5 A;  1NHC A;  1XG2 A;  1O88 A;  1HG8 A;  3VMV A;  1QCX A;  4OJP A;  1O8E A;  4YZA A;  3VSU A;  1JTA A;  4XLA A;  2VJJ A;  2QXZ A;  2PYG A;  4MR0 A;  2INU A;  5AMV A;  2ODL A;  4W8T A;  4XNF A;  4AVZ A;  1RU4 A;  4OJ6 A;  4XOR A;  1O8L A;  4W8S A;  2X6X A;  4XN3 A;  2NTP A;  4C2L A;  1CZF A;  3GQ8 A;  4Z05 A;  4XLE A;  2BSP A;  1PE9 A;  1JRG A;  4PMH A;  2IQ7 A;  4XM3 A;  4XKW A;  1IDJ A;  3EQN A;  1O8D A;  1PLU A;  1WMR A;  3B8Y A;  4HWV A;  4XN0 A;  3JUR A;  3VST A;  3LMW A;  3GQA A;  1DBO A;  1O8K A;  3VSV A;  4I84 A;  3ZSC A;  4OJO A;  2VBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...