2NTBA

Crystal structure of pectin methylesterase in complex with hexasaccharide v
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
342
structure length
342
Chain Sequence
b'ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 124
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2ntbA00
1O8KA 2O0WA 1RMGA 1WMRA 4OJOA 1O8DA 3KRGA 4XR6A 4XOPA 1O8EA 3VMVA 2PYGA 4XN0A 2VJJA 1IDKA 2X6WA 3VSUA 4C2LA 4W8RA 4Z05A 4AVZA 1KCCA 4Z06A 1BHEA 2X85A 2UVEA 1XG2A 1O8JA 5C1EA 4YZQA 1QJVA 2O04A 2O0VA 1O88A 2BSPA 1RU4A 2X6XA 4XKWA 4XLAA 3ZPPA 2INVA 3B90A 4W8TA 4Z03A 3UW0A 1PXZA 4XLHA 1OOCA 4XN3A 1O8MA 2O17A 4OJPA 2VBKA 4XONA 1AIRA 2QX3A 1HG8A 2NZMA 3GRHA 1X0CA 3VSTA 2NTPA 1OGMX 2QXZA 4HWVA 1KTWA 4XLEA 3LMWA 3EQNA 2X3HA 1O8FA 1DBGA 2IQ7A 4MR0A 1RWRA 2NSPA 4XM3A 1BN8A 4XQFA 1JTAA 2EWEA 4OJLA 3B4NA 2NTBA 1PE9A 1K5CA 4YEJA 4XLCA 4OZZA 4XL9A 1VBLA 2NT6A 1DBOA 2X6YA 1IB4A 4YZ0A 1QCXA 4URRA 3VSVA 1OGOX 2INUA 5AMVA 1PLUA 2VBEA 2PYHA 2NTQA 2NSTA 4U4BA 2VBMA 4YZXA 4W8QA 1OFLA 2QY1A 4NK6A 4XMYA 3WWGA 4XKVA 3T9GA 1NHCA 3EQOA 4XORA 4W8SA 2NT9A 4MXNA 3GQAA 1O8HA 1GQ8A 3GQ7A 1JRGA 1O8LA 4NK8A 4YELA 1EE6A 4OJ5A 4XOTA 2UVFA 3GQ8A 3SUCA 1CZFA 5C1CA 1H80A 4XLFA 4I84A 1IDJA 2VJIA 4PMHA 1IA5A 3B8YA 3VMWA 1OFMA 1O8GA 2ODLA 1KCDA 2O1DA 4OJ6A 3JURA 4YZAA 4XNFA 4EW9A 3GQ9A 4OZYA 4U49A 3FY3A 3ZSCA 2PECA 1O8IA 2Z8GA
chains in the Genus database with same CATH superfamily
2BM7A 3NB2A 1QQ1A 1O8KA 2O0WA 1RMGA 1WMRA 4OJOA 1O8DA 1EZGA 3JX8A 3KRGA 4XR6A 4XOPA 1O8EA 3VMVA 2PYGA 4XN0A 2VJJA 1IDKA 2X6WA 1KQ5A 2O6WA 4YCQA 3VSUA 4C2LA 4W8RA 2VFNA 4Z05A 4AVZA 1TSPA 4JRAC 1KCCA 4Z06A 1DABA 1BHEA 2X85A 1TYVA 2UVEA 1LLZA 1LM1A 1XG2A 1O8JA 5C1EA 4YDTA 4YZQA 1QA2A 1QJVA 2J8IA 2O04A 2O0VA 1O88A 4OM9A 2BSPA 1RU4A 2X6XA 4XKWA 3DU1X 4XLAA 3ZPPA 2BM4A 2INVA 3B90A 4W8TA 4Z03A 1HF2A 3LJYA 3UW0A 1PXZA 3N90A 2XTWA 4XLHA 1TYWA 1OOCA 4XN3A 1O8MA 1OFDA 3PSSA 1K4ZA 2G0YA 2O17A 4OJPA 2VBKA 4XONA 1AIRA 3PSZA 2QX3A 3NAWA 3P4GA 1HG8A 2NZMA 2XTYA 3GRHA 1X0CA 3VSTA 2BM6A 2NTPA 2IOUG 1OGMX 2QXZA 4HWVA 1KTWA 2QZAA 3LMWA 4XLEA 3EQNA 2X3HA 1O8FA 1DBGA 2IQ7A 4MR0A 1QA3A 1RWRA 2NSPA 4XM3A 4OPWA 1BN8A 3SY2A 4XQFA 1JTAA 2EWEA 2XT4A 4OJLA 3B4NA 2VFQA 2NTBA 4KH3A 1QRBA 3RIQA 1PE9A 1K5CA 4YEJA 3BH6B 4XLCA 3TH0A 4OZZA 4YEIA 4XL9A 1VBLA 2J8KA 4YC5A 1EA0A 2NT6A 1DBOA 2X6YA 2V5IA 3SQVA 4YZ0A 1QCXA 1IB4A 2QYUA 4YFOA 5JLVC 3ML3A 2VFPA 4URRA 1CLWA 3H09A 1LLWA 1OGOX 3VSVA 2INUA 5AMVA 1PLUA 5JMCB 2VBEA 2VFOA 2PYHA 2NTQA 2NSTA 4U4BA 2VBMA 4V02C 4YZXA 4W8QA 1OFLA 2BX6A 2QY1A 4NK6A 1QRCA 2B0RA 4XMYA 3WWGA 3BH7B 5DNSA 4XKVA 3T9GA 1NHCA 1TYXA 3EQOA 4XORA 4W8SA 2NT9A 4MXNA 3GQAA 1O8HA 1GQ8A 3SZEA 3GQ7A 1TYUA 1JRGA 1O8LA 4NK8A 1K8FA 2BM5A 4YELA 1EE6A 4OJ5A 1QA1A 2F3LA 1WXRA 4XOTA 3AK5A 2UVFA 2W7ZA 3GQ8A 3SUCA 1CZFA 5C1CA 1H80A 4XLFA 4I84A 1IDJA 2VJIA 2VFMA 4PMHA 2XT2A 3B8YA 1IA5A 3VMWA 1OFMA 3LYCA 2YUHA 3N6ZA 1O8GA 2ODLA 1KCDA 2O1DA 4OJ6A 3JURA 3SYJA 4YZAA 4XNFA 4EW9A 3GQ9A 4OZYA 3PETA 4U49A 3FY3A 1L1IA 3ZSCA 2XC1A 2PECA 1OFEA 1O8IA 2Z8GA 2XTXA
chains in the Genus database with same CATH topology
1O8KA 2O0WA 1RMGA 1WMRA 4OJOA 1O8DA 3KRGA 4XR6A 4XOPA 1O8EA 3VMVA 2PYGA 4XN0A 2VJJA 1IDKA 2X6WA 3VSUA 4C2LA 4W8RA 4Z05A 4AVZA 1KCCA 4Z06A 1BHEA 2X85A 2UVEA 1XG2A 1O8JA 5C1EA 4YZQA 1QJVA 2O04A 2O0VA 1O88A 2BSPA 1RU4A 2X6XA 4XKWA 4XLAA 3ZPPA 2INVA 3B90A 4W8TA 4Z03A 3UW0A 1PXZA 4XLHA 1OOCA 4XN3A 1O8MA 2O17A 4OJPA 2VBKA 4XONA 1AIRA 2QX3A 1HG8A 2NZMA 3GRHA 1X0CA 3VSTA 2NTPA 1OGMX 2QXZA 4HWVA 1KTWA 4XLEA 3LMWA 3EQNA 2X3HA 1O8FA 1DBGA 2IQ7A 4MR0A 1RWRA 2NSPA 4XM3A 1BN8A 4XQFA 1JTAA 2EWEA 4OJLA 3B4NA 2NTBA 1PE9A 1K5CA 4YEJA 4XLCA 4OZZA 4XL9A 1VBLA 2NT6A 1DBOA 2X6YA 1IB4A 4YZ0A 1QCXA 4URRA 3VSVA 1OGOX 2INUA 5AMVA 1PLUA 2VBEA 2PYHA 2NTQA 2NSTA 4U4BA 2VBMA 4YZXA 4W8QA 1OFLA 2QY1A 4NK6A 4XMYA 3WWGA 4XKVA 3T9GA 1NHCA 3EQOA 4XORA 4W8SA 2NT9A 4MXNA 3GQAA 1O8HA 1GQ8A 3GQ7A 1JRGA 1O8LA 4NK8A 4YELA 1EE6A 4OJ5A 4XOTA 2UVFA 3GQ8A 3SUCA 1CZFA 5C1CA 1H80A 4XLFA 4I84A 1IDJA 2VJIA 4PMHA 1IA5A 3B8YA 3VMWA 1OFMA 1O8GA 2ODLA 1KCDA 2O1DA 4OJ6A 3JURA 4YZAA 4XNFA 4EW9A 3GQ9A 4OZYA 4U49A 3FY3A 3ZSCA 2PECA 1O8IA 2Z8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8K A;  2O0W A;  1RMG A;  1WMR A;  4OJO A;  1O8D A;  3KRG A;  4XR6 A;  4XOP A;  1O8E A;  3VMV A;  2PYG A;  4XN0 A;  2VJJ A;  1IDK A;  2X6W A;  3VSU A;  4C2L A;  4W8R A;  4Z05 A;  4AVZ A;  1KCC A;  4Z06 A;  1BHE A;  2X85 A;  2UVE A;  1XG2 A;  1O8J A;  5C1E A;  4YZQ A;  1QJV A;  2O04 A;  2O0V A;  1O88 A;  2BSP A;  1RU4 A;  2X6X A;  4XKW A;  4XLA A;  3ZPP A;  2INV A;  3B90 A;  4W8T A;  4Z03 A;  3UW0 A;  1PXZ A;  4XLH A;  1OOC A;  4XN3 A;  1O8M A;  2O17 A;  4OJP A;  2VBK A;  4XON A;  1AIR A;  2QX3 A;  1HG8 A;  2NZM A;  3GRH A;  1X0C A;  3VST A;  2NTP A;  1OGM X;  2QXZ A;  4HWV A;  1KTW A;  4XLE A;  3LMW A;  3EQN A;  2X3H A;  1O8F A;  1DBG A;  2IQ7 A;  4MR0 A;  1RWR A;  2NSP A;  4XM3 A;  1BN8 A;  4XQF A;  1JTA A;  2EWE A;  4OJL A;  3B4N A;  2NTB A;  1PE9 A;  1K5C A;  4YEJ A;  4XLC A;  4OZZ A;  4XL9 A;  1VBL A;  2NT6 A;  1DBO A;  2X6Y A;  1IB4 A;  4YZ0 A;  1QCX A;  4URR A;  3VSV A;  1OGO X;  2INU A;  5AMV A;  1PLU A;  2VBE A;  2PYH A;  2NTQ A;  2NST A;  4U4B A;  2VBM A;  4YZX A;  4W8Q A;  1OFL A;  2QY1 A;  4NK6 A;  4XMY A;  3WWG A;  4XKV A;  3T9G A;  1NHC A;  3EQO A;  4XOR A;  4W8S A;  2NT9 A;  4MXN A;  3GQA A;  1O8H A;  1GQ8 A;  3GQ7 A;  1JRG A;  1O8L A;  4NK8 A;  4YEL A;  1EE6 A;  4OJ5 A;  4XOT A;  2UVF A;  3GQ8 A;  3SUC A;  1CZF A;  5C1C A;  1H80 A;  4XLF A;  4I84 A;  1IDJ A;  2VJI A;  4PMH A;  1IA5 A;  3B8Y A;  3VMW A;  1OFM A;  1O8G A;  2ODL A;  1KCD A;  2O1D A;  4OJ6 A;  3JUR A;  4YZA A;  4XNF A;  4EW9 A;  3GQ9 A;  4OZY A;  4U49 A;  3FY3 A;  3ZSC A;  2PEC A;  1O8I A;  2Z8G A; 
#chains in the Genus database with same CATH topology
 2BM7 A;  3NB2 A;  1QQ1 A;  1O8K A;  2O0W A;  1RMG A;  1WMR A;  4OJO A;  1O8D A;  1EZG A;  3JX8 A;  3KRG A;  4XR6 A;  4XOP A;  1O8E A;  3VMV A;  2PYG A;  4XN0 A;  2VJJ A;  1IDK A;  2X6W A;  1KQ5 A;  2O6W A;  4YCQ A;  3VSU A;  4C2L A;  4W8R A;  2VFN A;  4Z05 A;  4AVZ A;  1TSP A;  4JRA C;  1KCC A;  4Z06 A;  1DAB A;  1BHE A;  2X85 A;  1TYV A;  2UVE A;  1LLZ A;  1LM1 A;  1XG2 A;  1O8J A;  5C1E A;  4YDT A;  4YZQ A;  1QA2 A;  1QJV A;  2J8I A;  2O04 A;  2O0V A;  1O88 A;  4OM9 A;  2BSP A;  1RU4 A;  2X6X A;  4XKW A;  3DU1 X;  4XLA A;  3ZPP A;  2BM4 A;  2INV A;  3B90 A;  4W8T A;  4Z03 A;  1HF2 A;  3LJY A;  3UW0 A;  1PXZ A;  3N90 A;  2XTW A;  4XLH A;  1TYW A;  1OOC A;  4XN3 A;  1O8M A;  1OFD A;  3PSS A;  1K4Z A;  2G0Y A;  2O17 A;  4OJP A;  2VBK A;  4XON A;  1AIR A;  3PSZ A;  2QX3 A;  3NAW A;  3P4G A;  1HG8 A;  2NZM A;  2XTY A;  3GRH A;  1X0C A;  3VST A;  2BM6 A;  2NTP A;  2IOU G;  1OGM X;  2QXZ A;  4HWV A;  1KTW A;  2QZA A;  3LMW A;  4XLE A;  3EQN A;  2X3H A;  1O8F A;  1DBG A;  2IQ7 A;  4MR0 A;  1QA3 A;  1RWR A;  2NSP A;  4XM3 A;  4OPW A;  1BN8 A;  3SY2 A;  4XQF A;  1JTA A;  2EWE A;  2XT4 A;  4OJL A;  3B4N A;  2VFQ A;  2NTB A;  4KH3 A;  1QRB A;  3RIQ A;  1PE9 A;  1K5C A;  4YEJ A;  3BH6 B;  4XLC A;  3TH0 A;  4OZZ A;  4YEI A;  4XL9 A;  1VBL A;  2J8K A;  4YC5 A;  1EA0 A;  2NT6 A;  1DBO A;  2X6Y A;  2V5I A;  3SQV A;  4YZ0 A;  1QCX A;  1IB4 A;  2QYU A;  4YFO A;  5JLV C;  3ML3 A;  2VFP A;  4URR A;  1CLW A;  3H09 A;  1LLW A;  1OGO X;  3VSV A;  2INU A;  5AMV A;  1PLU A;  5JMC B;  2VBE A;  2VFO A;  2PYH A;  2NTQ A;  2NST A;  4U4B A;  2VBM A;  4V02 C;  4YZX A;  4W8Q A;  1OFL A;  2BX6 A;  2QY1 A;  4NK6 A;  1QRC A;  2B0R A;  4XMY A;  3WWG A;  3BH7 B;  5DNS A;  4XKV A;  3T9G A;  1NHC A;  1TYX A;  3EQO A;  4XOR A;  4W8S A;  2NT9 A;  4MXN A;  3GQA A;  1O8H A;  1GQ8 A;  3SZE A;  3GQ7 A;  1TYU A;  1JRG A;  1O8L A;  4NK8 A;  1K8F A;  2BM5 A;  4YEL A;  1EE6 A;  4OJ5 A;  1QA1 A;  2F3L A;  1WXR A;  4XOT A;  3AK5 A;  2UVF A;  2W7Z A;  3GQ8 A;  3SUC A;  1CZF A;  5C1C A;  1H80 A;  4XLF A;  4I84 A;  1IDJ A;  2VJI A;  2VFM A;  4PMH A;  2XT2 A;  3B8Y A;  1IA5 A;  3VMW A;  1OFM A;  3LYC A;  2YUH A;  3N6Z A;  1O8G A;  2ODL A;  1KCD A;  2O1D A;  4OJ6 A;  3JUR A;  3SYJ A;  4YZA A;  4XNF A;  4EW9 A;  3GQ9 A;  4OZY A;  3PET A;  4U49 A;  3FY3 A;  1L1I A;  3ZSC A;  2XC1 A;  2PEC A;  1OFE A;  1O8I A;  2Z8G A;  2XTX A; 
#chains in the Genus database with same CATH homology
 1O8K A;  2O0W A;  1RMG A;  1WMR A;  4OJO A;  1O8D A;  3KRG A;  4XR6 A;  4XOP A;  1O8E A;  3VMV A;  2PYG A;  4XN0 A;  2VJJ A;  1IDK A;  2X6W A;  3VSU A;  4C2L A;  4W8R A;  4Z05 A;  4AVZ A;  1KCC A;  4Z06 A;  1BHE A;  2X85 A;  2UVE A;  1XG2 A;  1O8J A;  5C1E A;  4YZQ A;  1QJV A;  2O04 A;  2O0V A;  1O88 A;  2BSP A;  1RU4 A;  2X6X A;  4XKW A;  4XLA A;  3ZPP A;  2INV A;  3B90 A;  4W8T A;  4Z03 A;  3UW0 A;  1PXZ A;  4XLH A;  1OOC A;  4XN3 A;  1O8M A;  2O17 A;  4OJP A;  2VBK A;  4XON A;  1AIR A;  2QX3 A;  1HG8 A;  2NZM A;  3GRH A;  1X0C A;  3VST A;  2NTP A;  1OGM X;  2QXZ A;  4HWV A;  1KTW A;  4XLE A;  3LMW A;  3EQN A;  2X3H A;  1O8F A;  1DBG A;  2IQ7 A;  4MR0 A;  1RWR A;  2NSP A;  4XM3 A;  1BN8 A;  4XQF A;  1JTA A;  2EWE A;  4OJL A;  3B4N A;  2NTB A;  1PE9 A;  1K5C A;  4YEJ A;  4XLC A;  4OZZ A;  4XL9 A;  1VBL A;  2NT6 A;  1DBO A;  2X6Y A;  1IB4 A;  4YZ0 A;  1QCX A;  4URR A;  3VSV A;  1OGO X;  2INU A;  5AMV A;  1PLU A;  2VBE A;  2PYH A;  2NTQ A;  2NST A;  4U4B A;  2VBM A;  4YZX A;  4W8Q A;  1OFL A;  2QY1 A;  4NK6 A;  4XMY A;  3WWG A;  4XKV A;  3T9G A;  1NHC A;  3EQO A;  4XOR A;  4W8S A;  2NT9 A;  4MXN A;  3GQA A;  1O8H A;  1GQ8 A;  3GQ7 A;  1JRG A;  1O8L A;  4NK8 A;  4YEL A;  1EE6 A;  4OJ5 A;  4XOT A;  2UVF A;  3GQ8 A;  3SUC A;  1CZF A;  5C1C A;  1H80 A;  4XLF A;  4I84 A;  1IDJ A;  2VJI A;  4PMH A;  1IA5 A;  3B8Y A;  3VMW A;  1OFM A;  1O8G A;  2ODL A;  1KCD A;  2O1D A;  4OJ6 A;  3JUR A;  4YZA A;  4XNF A;  4EW9 A;  3GQ9 A;  4OZY A;  4U49 A;  3FY3 A;  3ZSC A;  2PEC A;  1O8I A;  2Z8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...