2NTEA

Crystal structure of the bard1 brct domains
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
GPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the BARD1 BRCT domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords BRCA1-associated RING domain protein 1
total genus 65
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2nteA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2nteA02
3QVGA 3UEOA 3PC8A 3HUEA 3T1NA 1JNXX 2NTEA 3AL3A 5ECGC 3I0MA 3SHVA 1Z56C 3PXAA 2XNKA 3PXDA 4IGKA 1IN1A 1T15A 2L42A 1L0BA 2E2WA 3PC7A 1IMOA 3SHTA 3SQDA 4U4AA 2COEA 2INGX 2HTFA 2EP8A 2AZMA 4BU1A 3K15A 3PXCX 3JVEA 1OQAA 2R1ZA 2EBWA 2VXBA 1T2UA 2COUA 4XPZA 2WT8A 3T7JA 3AL2A 2ETXA 2VXCA 3K05A 4BMCA 3UENA 3PA6A 3L41A 2XNHA 1Y98A 1L7BA 3PD7A 3EF0A 3T7IA 3L40A 2K6GA 3I0NA 1T2VA 3HUFA 3K0KA 3L46A 2DUNA 2JW5A 3U3ZA 2K7FA 2D8MA 4JLUA 4XQ0A 4BU0A 3KTFA 4N40A 4Y18A 1N5OX 2ADOA 3K16A 2M2IA 4IFIA 3PC8C 3K0HA 4ID3A 1GZHB 2EBUA 1T29A 4OFBA 3SZMA 3QVGB 3PC6A 3II6X 1KZYC 3FA2A 3COJA 3OLCX 3PXEA 1CDZA 4BMDA 3EF1A 2LE0A 3T7KA 1WF6A 3PXBA 2COKA 4Y2GA
chains in the Genus database with same CATH superfamily
2ZDHA 1DCTA 4W7HA 4RTLA 1V2HE 1A9XB 2QTRA 2ZWVA 2C94A 1O03A 1H6CA 2P75A 1OYYA 1X8KA 4U2KA 3ZEIA 3PDCA 4RV4A 4EJMA 5B7GA 2QRPA 4EHAA 1THZA 1YOVB 3ZWOA 1Q1GA 2YQ5A 3EIEA 2ODNA 5DHSA 5CDUA 1Z0AA 3I1FA 2IOHA 2EYQA 1M6VA 4L3WA 2CJWB 3GJZA 6Q21A 3CVXA 4G1MB 1VLQA 4Q3LA 1JG7A 2P9EA 4GZMA 3F6BX 4PWZA 2VRNA 4LGMA 4MR8A 1AU9A 1J7JA 3L8FA 1C80A 2GCGA 4MVJD 2AYYA 2FZCA 1X80B 3H3XA 4PG8A 3FCOA 3G2LA 3E9CA 1PQWA 3HN6A 1IJEA 3I4CA 5K0SA 1PG2A 1IVNA 2FRDA 4DV0B 1GPDG 1CU1A 1Q6YA 3OJFA 3RG2A 1ARZA 3N0XA 1BDIA 2Q4BA 4YJ3B 2YVUA 3HA7A 4JI1B 1V3QE 1HE4A 2ZUUA 4JYCA 3TVDA 2QD4A 4L07A 1PV1A 4G25A 4N7MA 4QOEA 4WZAA 4J0EA 3IR5A 5ALLA 4F2GA 4KRXA 3QEMB 3DL0A 4GSKA 2C2ZA 4C21A 1WY5A 5BNIA 4TKVB 3ZVRA 3W79A 1I3KA 3DE6X 3G0CA 2F1IA 3GUYA 3I30X 2ZKIA 1RAHA 2EDCA 5FLEX 4M8SA 4N01A 3ROQA 5BN4B 3HB0A 5T57A 3SP1A 4U7DA 5BSUA 1WP9A 1EE9A 1LSJA 3CZAA 3O94A 1KO4A 4D43A 4EI9A 4DR1B 3SIRA 5B6JA 1E4OA 2Q2WA 4O4JB 1GQOA 4Q1DA 4JLKA 4EGQA 3KR9A 2A5FA 2JA2A 2ZJ3A 4DBVO 1H2AS 1X39A 3D4PA 2VPTA 1MO3A 1NATA 2Q5QA 2X22A 4NSNA 1NVVQ 3A8TA 2FSVA 3T9DA 4GBED 2FE1A 5SV2A 4G4GA 3A3PA 1MKYA 1CSEE 2GAIA 2P0AA 4YN3A 1COWA 1I2BA 3K31A 3IJRA 2JANA 2VNSA 2ID7A 3OX1A 1BHJA 1DWPA 3U4CA 2LDBA 2ZUVA 4ZAFA 4YUVA 2FK7A 5ES3A 5JTTA 3B78A 2O06A 2RJNA 3UUGA 4BE9A 4ZO4A 1G2PA 1M72A 1RQPA 2GTIA 2Q7OE 2R79A 2Q2QA 3LX5A 4GNKA 1XF9A 1Y3HA 2EQBA 4MS4B 3RGWS 1IK4A 2F17A 3JD1A 1MQSA 3ERCA 2CDCA 2IV2X 2HIMA 2K7FA 2HBYA 1PJQA 1G16A 4V02A 2C4WA 1O2DA 4B3MB 1XRMA 2JFGA 4X64B 2FETA 2XWJI 1WB9A 4ALMA 2BI7A 1KORA 1IJKA 3D8TA 4NEHB 5BXQC 3W7AA 1ESCA 1K3FA 2W6JA 3EA5A 1RWNA 5F2NA 1A5BB 1BA2A 1JLSA 2I99A 3CB2A 4KE8A 4E4RA 3HB7A 4QGBA 4Q12A 2O23A 1U9IC 5AKIA 5EWJA 5BN5A 1EK5A 1LGYA 3G3EA 3INRA 1RYYA 4GGPA 2HY7A 4PYIA 4KPUB 5K6RA 1UADA 4BB6A 1BGVA 1A04A 1H8HD 2ZRBA 3ILYA 3IP5A 3GEBA 3IUSA 1E98A 3GJ8A 5H1YA 1PVDA 3V00A 4IGEA 4QDZA 2NVUB 4GOND 4EYOA 1NUAA 4X62B 1DSSG 2M6KA 4OIFA 3TLGA 4B8ZA 5EWLB 3CFYA 5EWMA 3V6MA 2ZYIA 2QX6A 3L4BC 1T35A 4JT8A 1G1MA 2O07A 2WP0A 3ED5A 3F8SA 3M89A 5K8TA 3OZVA 3BQ9A 3WTBA 1IHYA 4U3JB 5FXMA 1USIA 2DCUA 2XB8A 1D1QA 3B82A 2QW8A 3LUKA 1ZHOA 3MAAC 5F1YA 2IUSA 2LTAA 3MHPA 4Y2VA 2VSFA 3WYNA 3RIYA 1JEJA 2YBEA 4DLKA 1XXHE 4BMPB 2RG1A 1MGPA 4KNWA 2BYTA 3LV8A 1SHLA 1II0A 2AMJA 3A10A 2V1UA 1YVPA 3H7IA 1GVNB 4LGCA 4X44A 1YA6A 4DN6A 2EFHB 4FU0A 1YDMA 5AW9A 1BFUA 1G4AE 4J2TA 4PAWA 3LTNC 1Y8RB 2RI0A 2GFQA 3GARA 5HQJA 3UGKA 3UK0A 5BV8A 2ZE8A 2BRUC 5F9FA 1DGQA 3G5MA 1T4MA 2WMOB 2HRDA 5BV7A 4FW8A 3ZY6A 1UINA 2IY7A 4HF7A 5JS8A 2AFIA 2REXB 3CUKA 2EU8A 1IY0A 3CY6A 3PEVA 4KDRA 4RLQA 1DRJA 1L0BA 4GLBA 3NDPA 2C58A 1WVIA 3NORA 4FCVA 5CIWA 1HDIA 3BRWA 3ENVA 4IO0A 3RBZA 1TMOA 4M76B 2QRUA 3IXLA 2Z95A 4TT3D 5HBRA 2DFPA 2WU1A 4F5EA 4EKYA 2O8DA 1KQ3A 16PKA 4A82A 3VNUA 5AMXA 2QTMA 5DGCA 2NU8A 2NU8B 5HR5A 4JD5A 5T3UA 1JS1X 1RMQA 4I2VA 3QEAZ 1HL7A 3IAS6 4II7A 8OHMA 3FN4A 4FQ8A 4EHKA 4K2HA 1MC4A 2C2YA 5BSWA 2NGRA 2I2CA 5CXUA 2Q4RA 1QK3A 4Q21A 3M34A 4UUAA 3BTOA 2WZQA 4NCIA 3GPLA 1YVUA 3ZWMA 2CFIA 2I3BA 1IEVA 2IFTA 1NQUA 3H1BA 4I1OA 2HMYB 1YR6A 3KYBA 3EMBA 4LMRA 1QYDA 1IXYA 3FDZB 4FR2A 2VTBB 4MQBA 4ECAA 1QJCA 4M0DA 1VECA 3GJRA 2V74B 3L6DA 4X8OA 4D9BA 1OTYA 1PCXA 4I4TB 1BO6A 2OBYA 1YBHA 4OHWA 4PBTA 1FPQA 2XXBA 4PTYA 2YV2A 3T7RA 3TEMA 5CCXA 1QG6A 1FW6A 3KVVA 1PGOA 1SXJC 5GONB 2M6LA 1NV8A 1QOQB 4GYJA 2VH5R 3C3BA 3BGVA 3CV3A 5KSPA 2BDTA 1L3IA 3L4JA 2JIOA 1JQLB 3MGAA 4RGYA 4DADA 1POXA 3ZLUA 4L6IA 2QLFA 1ZL0A 2R4UA 2D7CA 3SEQA 4E7PA 5IVPA 1CUJA 2HHJA 5U9CA 4RTPA 2QORA 4NCAA 2QF7A 3EFHA 3I42A 2B1RA 4YRTA 5BNTA 2BEWB 2ADOA 3QE0A 5L7WA 1GGMA 2JG3A 4K40A 2G76A 3KCQA 1X1TA 1YACA 5CRIA 2NLOA 3D6HA 1ODIA 3BXGA 3QU7A 5L7YA 2NUTA 1CQJA 2R85A 4YCSA 3AESA 1D09A 4Q39A 2DYKA 4EOGA 3CZ5A 4E5SA 3OQPA 1C81A 1QTRA 2E48A 4E11A 2BHLA 4OYHA 4O1HA 3TPZA 2J3LA 4FFMA 1HPLA 5IZCC 2O52A 4JZKA 4TWJA 4X8LA 4ZANA 1ZI6A 2G07A 3GWGA 2PMWB 1KWGA 4RTJA 1CEXA 5LWQA 4O3MA 1Y8AA 5GIOE 2J0VA 3E22B 3OFVA 3NP9A 3GRAA 1S96A 4BCCA 1O94A 4PVDA 3KLPX 3N28A 3OAAD 4JLSA 4RKYA 3AKEA 3SVZA 5C8ZA 3D6AA 1N36B 1EKXA 1O89A 1G291 2B8JA 3O2JA 3O38A 3Q7QA 5DBGA 3U7FB 3IMCA 2D6FA 1QP8A 3PYMA 5A3JA 2DM6A 3IAFA 4ZREA 1ZW6A 3NMUF 5FBKA 4AJJA 1QFJA 4NOJA 3CXUA 3NU1A 1JG3A 4FNGA 1I9GA 3WX0A 3I73A 1TTHA 3SHVA 2Y68A 4Z8YA 4OQNA 1GNQA 4MV7A 5ESRA 3WZMA 1IY1A 2E5LB 3CBGA 3F6RA 4UM8B 4ER5A 4MDEA 2BFCA 3OTGA 3ICEA 4D44A 1NXPA 2PUTA 4YQFA 4W8GA 4TQGA 1M1UA 1MRZA 1TGYA 2JFZA 2LW7A 3QPDA 2OO5C 5DCWA 4CCWA 5IJ0A 5IS2A 5D87A 2X9NA 4OSEA 2WJPA 1NU8A 3OSUA 5CCEA 4NYJQ 3LPAA 1FS6A 4KHPB 4LDRA 4N3CA 1HX7A 2XMZA 1VLHA 4RVUA 4EG0A 2X9VA 3P7MA 3W77A 2RAUA 2EQ5A 1KERA 3TDKA 5LQUA 1R0XA 4YYZA 2J0UB 2P68A 4MQEA 3RFFA 2HRZA 4LZLA 4QDUA 4P4GA 1OYWA 1GQFA 1B76A 3IEMA 1XB2A 1RM3A 2E82A 4OJNA 1SXGA 2CVFA 5JRJA 2VZEA 3I39X 4D0GA 1ZOIA 3EX7C 4Z9FA 4MW5A 2HWUA 5D85A 6ABPA 2VDWA 2E21A 4FQ5A 1DC5A 1B0UA 3ZQ6A 4UMDA 4EMTA 2XUGA 2I6SA 4LSZA 2EL7A 4IIJB 4RZ3A 5BWOA 5TNXA 3ZCVA 2XCTB 3AL2A 2VP5A 5FLXA 2FAXA 1MVLA 5H9WA 2ICAA 1NULA 2J3DA 4LRYA 1SBTA 1AIPA 3UF0A 4DXHA 2PL5A 1I3MA 4HG2A 1CUWA 1L1QA 4MV0A 3PFIA 4IJ5A 2ONKA 4WV3A 3SN6A 1DAHA 5AKXA 4DB2A 4RLFA 1P18A 3TQTA 1QP7A 4YCDA 3RGGA 3EIHA 3GFPA 2EL9A 1ZD2P 1UPXA 1Z7EA 4M53A 1JJAA 4N39A 5HZGA 1OPXA 3Q72A 3VJKA 3AIIA 4TLAA 4N7RA 4MKZA 5AK3A 2BGKA 3QUAA 1U7DA 3KR0A 3VR4A 2OEPA 4LOAA 3QW4B 4RHUA 1W93A 1WG8A 4EKNB 1EE2A 1HYHA 3NW9A 1IK6A 3HKDB 3W8DA 4Y9DA 2B4RO 4MUGA 1LBTA 3S44A 4C4ZA 2C99A 1WV1A 4MJXA 3RK0A 2GEJA 4J07A 5JJBA 2NU6B 2DJIA 2FG7C 4E13A 1NJSA 1X0VA 5F7JA 3T94A 2O1XA 1B00A 4WDQA 4ZYVA 3DMHA 3PICA 4MUYA 2JCVA 4XLZA 2QMZA 5HOEA 3MT9A 1CQZA 2IEBA 4UE2A 1HTBA 3EDYA 1IBMB 3IJEB 1SC4A 1LUAA 5CX1A 3H7AA 5AR1A 4YR7A 1BOOA 2H4YA 5ALYA 4JC5A 3IEPA 2GXSA 5BWCA 1Z8DA 4B7AA 1EG2A 1T2CA 2DLNA 1UJ4A 4JSTA 2DJ5A 4LIPD 1PW5A 1A0OA 2I6XA 2VA8A 2X0RA 5REQA 1B6RA 5ANRB 4ND3A 3MS7A 4BGUA 4DMUB 5J4KA 4LFAB 4CFZA 2L82A 2XOXA 3KYCB 1ND6A 3KLNA 3H11A 5D1NA 3VZRA 3SBOA 4CKCB 2GXAA 3PEYA 2AR9A 2NVUA 3IDAA 5I7UA 1XYGA 1Z8HA 2A1IA 2RMKA 3ICCA 5ALPA 5ILQA 4TKVA 5CA0F 5IK2A 5AVTA 3DWFA 1R6XA 4IHJF 2ZJ4A 2FUEA 1WSDA 2PX4A 2B4AA 2HBRA 3DMFA 1J1IA 3BG5A 1ORWA 1ZGHA 1R8SA 3IVRA 4Q4JB 2B1QA 3IELA 2RGCA 4JI8B 2G83A 3AZQA 5LZ2A 1JYFA 4PYRA 5AM5A 1LK5A 2D2IA 1V43A 2J67A 1THTA 4J03A 3AT1A 3I53A 1UWKA 3PPVA 2OLJA 4L5AA 1WUYA 3NKFA 1GVHA 3I2GA 4ZCPA 4ZJYA 1MHTA 4KYIB 4MUFA 4EVIA 1YVEI 4R98A 1QH1A 4V3CA 1KZ9A 5ENDA 1I6WA 3LXMA 4RH1A 3NANA 4NCBA 2ZROA 2X23A 1RPNA 2FF7A 2CL5A 2YZMA 4HI0E 3F0TA 3ZR4B 4F7DA 5EOVA 3HBJA 1OVMA 3C43A 2A0YA 1E2EA 3LNCA 2VAPA 1N3BA 3ODPA 4DKXA 1HTWA 1R5OA 2PSEA 3OVMA 4OYLA 4YRZA 4Z1OA 5FT9A 3ILXA 1KDYA 4IRUB 4BRSA 1FX0A 4C0AC 3MT8A 3Q1KA 4DEYA 2NYRA 5ADWA 3P26A 1ZIDA 4Q48A 2HSDA 5KYUA 1PNRA 4FHCA 1NTRA 1SQGA 2C03A 2WTEA 4ZYZA 2CHGA 2GX6A 3AYZB 3H5AA 4BNLA 2IBSA 1NUTA 1HYQA 3D3WB 3Q7IA 4AROA 4ZYYA 5M5BA 5JJKA 1XWFA 4Q1CA 2M98A 5TARA 1EVQA 2CMKA 3O8QB 5IKEA 2X40A 4JMLA 1E3SA 2FPSA 2FRDC 2CD7A 3NOXA 1U9YA 3BJRA 3KXLA 4RKWA 1J8QA 3OE5A 4IDOA 3TAUA 2JZCA 1HY3A 2HMWA 4U39A 1RP1A 3UMBA 5IYZA 1QDUA 1EP2B 4JGIA 3DEZA 2V3CC 3ORHA 2J6HA 5EZ6B 1LK7A 2XCUA 1T8UA 3C87A 1CZUA 4ZI2A 2HHHB 5DN9A 4Z4GA 2F90A 3R6GA 3UAWA 1YC2A 4CXMA 2QVGA 1MW9X 3N7TA 5SYNA 1JVSA 1QU3A 4YGYA 2PJZA 3NAZA 3O8CA 4QWWA 3TTWA 2HXSA 2A9KA 3UAOA 5F9HA 4OA5A 1YFKA 1AN9A 1EFVB 2I66A 3AJ8A 3IFSA 3IPCA 1F3LA 1NNLA 1Z5GA 4UCFA 2ZWIA 3DZGA 3FWNA 4OB8A 4AMVA 4N82A 1VYVA 4UEWA 1J21A 3A4VA 5C31A 3OESA 4CKZA 4OHOA 1R50A 3DUFB 1J00A 3ACCA 3GELA 2P9ZA 4KGZA 4UULA 1AKVA 5CDFA 2BP7A 4DDHA 4C1BA 1NG9A 1GZHB 1IOWA 1P39A 3B9PA 2PO5A 3QVMA 4KQFA 4MW9A 1T24A 3SQOA 4DMGA 2IEDA 4AF8A 1DQZA 4DLSA 5T6BA 1KE2A 4GSLA 1OFIA 3GIDA 4W4TA 5JPCA 1BWQA 3WMGA 3W3AD 4DR7B 4OFXA 3VZPA 3EBLA 1OZHA 3QPCA 1ZH4A 1GAXA 1A9QA 3QXXA 1PUXA 1C3VA 3R8XA 2JL1A 4KRYA 3TL6A 4DUGD 1V1JA 2VUIB 5LD2C 4BN4A 2J7KA 5ALOA 1EB9A 3MPUA 3D5QA 4IW3B 4QGGA 4PG7A 3T4EA 2WIJA 4ROSA 3UM9A 3H4VA 3EJ6A 3PGLA 1UK7A 1SCDA 2G0TA 2GN8A 3AF3A 3BAZA 5F1KA 1ZITA 1OBVA 5CA0A 3W5JA 2H57A 4NYJR 1F0YA 2FWJA 2XADA 3BTUA 2AQ8A 3GUVA 4H7KA 1VM6A 2XWSA 2ZIWB 1ZHFA 3MWYW 1WV0A 1D4ZA 4N0DA 1YWGO 3T61A 1AF4A 3KSZO 5E8JA 4PNEA 4GHWA 2BSAA 4DUZB 4WACA 2PXAA 2N3ZA 2QAGA 3AHJA 2TSYB 5K3AA 1CQIB 3CZPA 4HFJA 2CB0A 5FPQA 5H9VA 5LZ8A 3I61A 4LCJA 4YRFA 3GLUA 3WYFA 5KYWB 3G0HA 4ZMRA 2EG9A 4WKGA 4FUTA 3E3MA 4KN5A 1FW8A 4IIJF 1PL7A 5IVHA 2PRKA 2LGJA 4CIAA 1QFZA 1XZJA 4HZUA 5JCOA 1ISSA 4A2WA 1YJ8A 1P29A 1SC6A 5AM1A 3FWKA 4Y6QA 2I2DA 4QOJA 2JCSA 1J0DA 4X45A 1OA0A 2WYVA 1B3BA 3T3EA 4HQLA 2B20A 4Z0HO 3T7EA 2QSYA 2JARA 4F4FA 3ESQA 3EH1A 2XOKA 2EHJA 4YYEA 1E7YA 2O0KA 3U7QB 4KVZA 4H1WA 4Q9DA 1ECCA 1A2QA 1KR5A 3H0EA 1YS6A 1JDSA 2XIJA 4OHPA 3WMWA 3IAHA 5KSYA 3NBFA 4NZYA 1RIIA 2FN7A 3E3LA 3ZH2A 5L3QB 3B20A 3L9WA 2D00A 4BLQA 4JBXA 1Y3FE 1RKVA 3EAQA 1LJUA 3QTBA 5CXXA 3FVQA 3IQGX 3P2MA 2FOIA 4ESOA 3GIWA 3WIDA 3VBEA 3WRYC 2WFLB 1SQFA 1YB7A 3FZGA 4AKEA 3ZJYA 3DVQX 3RVBA 1Q7RA 1JQDA 4RPJA 5I8ZA 4RPIA 4RWEA 3DVAA 3ORYA 3JQGB 5FL7D 4TSFD 2DULA 1MORA 5EVJA 3RSGA 3WSVA 4BFTA 5ER9A 2BUAA 3NCTA 1MN6A 3AEQA 3R3YA 4MVJA 4OYRA 3BHNA 2ASEA 3QLTA 1A8PA 3VH2A 3MJCA 3R7AA 4YJDA 2QN9A 1I1NA 1Y8CA 2G3YA 3IUPA 3W2HA 2CBZA 3WB1A 1QQAA 3R7DA 5F52A 5EFOA 1HUQA 3JQ7A 5FAKA 1QDEA 1EBUA 4EEZA 3LDFA 2EJVA 1EFKA 3KDSE 4MWDA 4MVCA 1E2BA 5CH5A 4IJKA 3UJ3X 4UARA 3CW8X 1P7CA 3NIWA 3NTVA 1XZQA 3RT7A 4BJ5A 4K1XA 3UTCA 4RK6A 2ILTA 4IIUA 4LG1A 2C5BA 4GM1A 1V6SA 3OAAA 1LWNA 4X66B 3KSUA 1Z29A 1GDHA 3DDWA 3I62A 4L4XA 4O4IB 5AHWA 2ZUTA 1H2RS 5AKZA 4F9GA 3PUHA 3LOQA 3LW7A 4LY6A 1KJJA 1QKKA 1JBKA 4WFKA 4U2FA 5JQGF 5M7EA 1I1HA 4AO8A 3GDOA 4C9BA 1BJTA 1QOZA 1FLDA 5EXPA 2IH4A 4R83A 2WTXA 1LLFA 1H94A 1SOAA 1ZVQA 2IELA 4F1JA 4AY3A 1K68A 4QPJC 2PV0A 4M0FA 3V8BA 5DCUA 4AKIA 1DO2A 3PZRA 2JI8A 4UKDA 2BFAA 2V8OA 4PPFA 3ASUA 3CIFA 3BE5A 1HDEA 1EYZA 3EGXA 5IKXA 2JLWA 4UDNA 1FTNA 4MRNA 1JPNA 5KWSA 4IIFA 4XDGA 1SZDA 4FYKA 3LKDA 2I78A 3PUVA 4BB9A 3B6KA 4TMVA 5KKCA 5GM2A 2RC6A 2Y2UA 4O4LB 5AHOA 3UJ6A 1A7JA 3KELA 3GRKA 4OSPA 2DLCX 5JR3A 2PMDA 2CXNA 1Q1AA 2J3KA 3NTUA 2LWIA 4XARA 4Z0TA 1NVDA 3NWEA 1OI2A 3IVGA 3L4EA 3RG8A 5A06A 3KSAC 4JI7B 3FUXA 3TQOA 5CD9A 2SKEA 1AUXA 4OUKX 1ZFNA 3D5EA 1AMUA 3FIJA 1CF9A 2NQ2C 3EMVA 4XDYA 2O7VA 3T3PB 5REQB 2PS3A 2BF4A 5T7BA 4CUZA 1ZQ9A 4RXTA 3A36A 4U2GA 2Q5CA 3RRYA 1QGZA 1C0KA 1O8CA 1SB8A 1ZMBA 2NUAA 2ZXFA 3HU2A 4WN3A 5EP2A 3LO8A 5KNDA 2QUBA 3V34A 4BXOA 1DZ3A 4MV1A 5U1PA 3DE4X 1JYSA 3G13A 4RF2A 4QPNA 3DUWA 1UK9A 2AUNA 4DA8A 2CGEA 5JD5A 1RZRD 4N4AA 4DLXA 2OCBA 2R1ZA 3T5GA 1P7PA 2XYHA 3FYUB 5C5CA 4X8MA 3JQ8B 4IDPA 3LP8A 2B4YA 2QMYA 5KTYA 3KQVA 4IJUA 2GMWA 4JHLA 3DEYX 4MVXA 5AOVA 3FSEA 3RROA 3U40A 1QCDA 1I3OA 4LSGA 3GLFA 5DRYA 3C70A 3AIMA 1JDNA 4BKPA 1Z06A 2IV3A 2E55A 3HKDA 2DQSA 5FI5A 4WY8A 3QENA 1JH8A 4IHAA 1C30B 3K53A 2PZBA 2HDOA 4OKIA 3LUGA 3AV0B 3BA6A 1GGHA 2VAXA 4F71A 4GT1A 3W4KA 4W82A 3GMTA 3PGMA 4BMCA 4XX0B 2IGTA 3C3EA 2GM9A 4WOKA 1V5GA 2QUKA 1N77A 1Y98A 2ZSJA 4YP7A 3HJUA 2NW6A 2I1LA 4PCLA 5TMDA 4HDOB 4BNKA 3T3MB 1JSLA 3IVAA 4K1LA 2ZE6A 1V1RB 5FOVA 2R7LA 1HRKA 1RXIA 2GPYA 2CDBA 3BIXA 1SVIA 3DE1X 2QPTA 1PK9A 2E4UA 2ZU6A 2JBWA 2O50A 3PIIA 3PZBA 4CKWB 4D8XA 2ZCJA 4KWHA 1U98A 4NY1A 4X1OA 3TRFA 3BIFA 1UZLA 1Q16A 1B1AA 1W4AA 1F9AA 2FMXA 4MGIR 2QK4A 1NY6A 3PCRB 4EUSA 3JR3A 5EJ5A 4QAQA 1RPAA 2GARA 5K1ZA 5EIEA 1Y7HA 1U5AA 4FHFA 5ITSA 2Z8XA 1B0PA 3JQBA 1EWVA 3UJ7A 3WGNA 5KX5A 2PWZA 1Q1ZA 3E4DA 2KB0A 1ZINA 2IU4A 3A6FA 3R3ZA 4M9ZA 3PNSA 1HOTA 4CL3A 3NFYA 1W85A 4QQRA 1XP8A 2B34A 3DD5A 4IHJB 1Q3KA 4JN6B 5B6IA 3FZYA 3ZCSA 3PDIA 2VFAA 3WHPA 3L2OB 4BZZA 1U04A 3D8UA 3JXEA 1VJRA 3LUFA 1CJUC 3OJCA 1XTBA 3RTAA 1OJLA 3RPEA 4H7FA 2NSJA 3M4JA 4HRAA 1O6ZA 3VVCA 4AWAA 4QECA 4CKEA 1GUZA 5BVHA 1V1MA 3CRRA 4W9RA 3EDRA 4OLFA 2BZSA 2V7WA 3QU5A 4B6PA 4B3IA 4CMIA 1B6TA 2IYOA 1Y5NA 4PPNA 3FSRA 3O4IA 3QI2A 3ESBA 4K7JA 1XJCA 4LY3A 1Q44A 2AW3A 3PXXA 2GBLC 2YN4A 1C0IA 3EODA 4FSDA 2HJRA 3EQ9A 3AHIA 4MEBA 4PVCA 1LJLA 5ER6A 3O8OB 1COZA 1C9EA 1SMKA 1Z5PA 2F2TA 2H4JA 1JL3A 3JRWA 3OOHA 3T6KA 3BOSA 4OM7A 4K9RA 1YDHA 2AN4A 2Z1MA 3PG5A 4RSGA 3G68A 1Z08A 4H6WA 5DYNA 1N2JA 3GNQA 4IDFA 3EPPA 5EJMA 4OHMA 2QRMA 2FF5A 5LUBA 1KOJA 1ZUNB 4C04A 1V37A 2EP5A 3BFKA 4ENPA 2VJAA 5DSZA 4ZZ1A 2GJAA 1EFVA 4NMHA 2XXAA 4HRVA 5BUSA 1S1MA 2VI5A 4DDMA 4Y9UA 4B6JA 1A9ZA 1CWUA 2ZDQA 2NACA 4A0QA 1YRQA 1TO6A 5DHRA 1NVFA 3LPCA 1CG6A 2H7CA 3PJEA 1UMCB 5LXTA 2Z4TA 4Z49A 1KTIA 3JWGA 3ND5A 3BWEA 3PE6A 4YPFA 3JRNA 3MB5A 2PXCA 4P53A 1HT1E 2PXXA 1RZ3A 2YWBA 3G2IA 3D3JA 3IC5A 5DLQC 2VQEB 2HU2A 2JHAA 1JSXA 1G5TA 2AC4A 1WHSA 4UMEA 4L7VA 2LCIA 3CE6A 3QFTA 5J2TF 3ICPA 2XRZA 1JDZA 3ADKA 2IYUA 3H4TA 2PRIA 4IIDA 4WW0A 4PBRA 3UK7A 5HF8A 4XYMA 5A62A 2ZQZA 1LW7A 1OGYA 1N7JA 4HD8A 1P0MA 1CUGA 3LZCA 4P22A 4MR9B 1FQJA 4EGJA 3QITA 4QYXA 4F2WA 2QVZX 4G0MA 2QJTA 1UBLS 4YALA 3OZBA 1G2OA 5HQ3B 1X87A 1ZWKA 3B1FA 3EXFA 3GLQA 4M6WA 3O4HA 3WL3A 3FKSA 1T1JA 3ZCQA 3BMQB 2ZWAA 1NHWA 4PNPA 4WXMA 2JFBA 3PDUA 3QU9A 4E5MA 5A3VA 2IDZA 3DDHA 1I5EA 4P3KA 5CVUA 3ADOA 4L75A 5LFAA 2ZSHA 2P9QA 3CNBA 3ZHUA 2IXEA 3H97A 1N34B 3MILA 3NVDA 3UT5A 2HJ9A 3RYHA 1YKFA 4DV4B 3WP1B 3WNDA 3O90A 3A3KA 2KX7A 4RVOA 1XTTA 1QBKC 3COVA 3TZLA 4AIIA 4ZK2A 3ETHA 1RVV1 3R3HA 2X0DA 1YDWA 2VHXA 3OCJA 3TNJA 4PAGA 4CIBA 4GUAA 4L5CA 1S1CA 3UK6A 4EGFA 1KYYA 3D8SA 3PDJA 1KYQA 3QG5A 1HF3A 1XCJA 1C1XA 3FAZA 3JATB 3VOBA 5FEUA 4OJMX 3IR7A 4JB3A 3UJNA 1A8SA 1BG6A 3KEGA 3T7SA 1IG0A 3M49A 5DM1A 1ENOA 3IOCA 4PYMA 1SBNE 3C5EA 2FKAA 3SS9X 4PQRA 4X20A 1CUIA 2BZGA 2XYRA 3OOYA 3UCXA 1SWVA 4DV1B 2WPDD 4G26A 3VHLB 4QUJA 5AJXA 4S1WA 5A9RA 5L4NA 1BRMA 3OF5A 1PZFA 3GMDA 1ZW1A 1RSZA 1MRSA 4RPCA 3GLGB 2FE4A 4L8WB 1N8SA 2GZAA 3GBSA 2EIHA 2ERYA 1KIFA 3A9CA 3S81A 2PH3A 1NL3A 2R4TA 3LKVA 2XTNA 1L5WA 3W5SA 1ETHA 1TAQA 2KI5A 4XW2A 1MH1A 3Q3EA 3ZDZB 1ZGBA 2BBSA 1S2NA 1AUVA 1ZN8A 2B6NA 1W96A 3EXIA 1G8JA 2BGRA 1AS3A 1R6DA 4OK6A 2Z1NA 4ZN6A 3QOYA 3TIXB 3D0OA 5M34A 1CP3A 3P1JA 5GGXA 1XMPA 1P1BA 2O2YA 4JXZA 1IB0A 4BN5A 1PEKE 1PNOA 5D7NA 2A8YA 2DT8A 2WM9B 1G20B 3EPRA 4KLRA 1OYOA 1TC1A 5KSZA 3K70D 3S1AB 4O33A 3ZV5A 4IF4A 3X1ZA 2G0NA 1YE5A 2CKMA 1B8NA 5FULA 3W7BA 1NZFA 2BV3A 3U2QA 4E4TA 1L8OA 5DM4A 2YH2A 3HADA 3PUZA 1G9TA 4ZOBA 3VR1A 3TRDA 3BGOS 3N8DA 2XDYA 4I99A 2HK9A 1NNSA 4IIHA 5K0LA 5CJJA 2YFKA 2IXDA 3OPQA 1MIOA 3PFCA 3VOAA 2EDAA 2EYUA 2R7NA 4MYRA 1J24A 3FPKA 4DDVA 5IUNC 2J3HA 1KU6A 1TD1A 1TT5A 4H77A 4I1PA 3M6IA 2FPIA 1LBEA 1KAEA 1PEDA 3EE6A 1S5PA 2DWOA 1D8TA 1SU4A 2VXOA 2FX2A 1L5LA 1KC3A 1R37A 5IF9A 1XRPA 3LYUA 4BP3A 4X63A 3M4ZA 3D6JA 4CM3A 3CCBA 1FP7A 3RSOA 3VC1A 3FHJA 3AM1A 2V6MA 2VNAA 4RPHA 2JLZA 2AK3A 2O2GA 2D2VA 4YBRA 2C57A 3L43A 3OOEA 3F90A 4AJHA 2GT1A 5B5SA 1ZONA 2H92A 2FSUA 2XNHA 1N1DA 5KVVA 3ZIAA 2IODA 5THQA 4HH4A 4DIMA 3AU8A 4G1CA 4XGIA 2QS9A 3JQQA 2CNKA 2RAFA 3BFPA 5E1OA 1Q0HA 2BC9A 2V55B 2ZR7A 4PIMA 5J2UF 3GHYA 1A8QA 3B1JA 5ESXA 3RFVA 2XOEA 4B4WA 3V2HA 1U7UA 3QJ5A 2XVAA 1JEAA 3BBPA 4XFKA 4NV0A 3VAYA 1Z4PX 2AR0A 2QD5A 1UXKA 2WNSA 1AOXA 4HEQA 1ODSA 4ZZ3A 3L92A 4RD2A 2LXNA 3AVYA 4JYMA 1IE3A 3AINA 3WDSA 1F2UB 1A82A 3OQIA 2YHSA 3WK6A 3VJLA 5A9SA 1CJTC 3KC2A 5JY1A 4GRDA 3PKIA 2Z9DA 4L5JA 5KJCA 2QUAA 2BEJA 3KHUA 5B7QA 3X1KA 1KJQA 4YJ2A 5F51A 4I1IA 1VLJA 1YO6A 2QGZA 5LDHA 5TPZD 2OE2A 3PC6A 4AWBA 2WUGA 1C7FA 1UDRA 3RYIA 3EOZA 4FB5A 2Y2VA 3JASA 1UP4A 2F9LA 3GXOA 5CIYA 5EP1A 1S3FA 5DP1A 3FLMA 3HMKA 3E2IA 2OKCA 4AF7A 3ZHYA 5I4IA 4Q4HB 3R6TA 4RVFA 1ONSA 1OLSA 2VZ0A 2CF5A 3UUEA 2FN8A 1WBJB 3SX4A 2CMDA 2XITA 3E9EA 3MGGA 1CHDA 4KK3A 1OWMA 1XLTC 4BRWA 3ZXYA 1HFKA 3TG2A 2OHXA 3A1NA 4LXXA 4XGQA 1GT6A 5EJ2A 5GQSA 5BQ5A 1YA4A 1J6UA 2AG1A 2PCJA 2PM8A 4R8KA 4YNBA 4BS9A 2C7QA 2JI9A 2QN2A 5M2QA 2D2EA 2QZSA 2B8WA 2BLLA 1FY2A 1O77A 2VNJA 4LOKA 5G0SA 4M86A 4FEAA 1MOSA 1GQSA 4GOMD 3ZDEA 1NUQA 3P0HA 1JHMA 3JQ8A 2PLAA 3HZHA 3KQSA 1QMGA 2OAGA 1O5OA 1TQ6A 3RT1A 2J0SA 4EATA 4KQ9A 4RY2A 3PQEA 1RWKA 2M1ZA 1ZRHA 4ZI3A 5B1HA 3UVEA 1RRMA 2DPLA 2Q5HA 1V3UA 1HE2A 5K6TA 1VMKA 3WNZA 4JSYA 1SZCA 1BZYA 3O1HB 3VR2A 2C54A 1P7YA 1RKXA 1CDEA 3OIWA 4D6PA 5AM3A 4HMOA 2ZSEA 3CF6R 1W5AA 3NT5A 2Z8ZA 3O5AA 4N7BA 2C97A 3VR3D 4BWYA 4ZVVA 4YPOA 3ICQB 4OU4A 3AWIA 5IT5A 4P3PA 4DUGA 3ND7A 4FONA 2Q99A 4R9SA 1TO2E 2C77A 2C07A 5AXAA 5BYBA 1KVUA 3BWVA 1XA3A 2IYRA 3OZFA 3PPYA 3DLHA 4QVKA 2WTBA 5JSHA 2JB9A 4Y67A 5LQMA 2O2SA 2H1FA 1B6SA 3BB3A 2WSMA 1YR2A 2IHYA 1TX4B 3LOPA 4PCUA 2D7DA 2Y1WA 3FGZA 4L76A 1DQSA 4DMKA 5FTLA 2AG6A 4F4DA 2P40A 1EZZA 1ZEJA 2QPLA 3I9V1 1ZD1A 3EW7A 1CKEA 1GTG1 2F8TA 2NXWA 1WQ3A 4IBOA 3ZYZA 2GOYA 2A58A 2W93A 3IB6A 4G5HA 2Y1OA 4AICA 2JLBA 3BZUA 3EZ6A 1JDBB 4H2DA 3OQJA 3TGLA 2I7DA 3QE4A 1R16A 4POAA 3N1UA 1BEEA 1XA4A 4KN6A 1YAHA 2WF5A 3W2FA 1XQ6A 1KOLA 4KAJA 1ISMA 4J1SA 4UHJA 3IBFA 3KZXA 1XJ0A 3HCOA 5JSKA 4YT4A 1YJQA 4TKUA 3SQXA 2RSLA 1HGXA 1H4VB 2ZJ1A 3O9VA 1LBSA 1OFUA 4GMGA 2I6TA 3K4PA 4BZPA 2I8CA 1DP4A 5A0VA 4YRDA 3DD1A 2PNJA 1KP2A 1WMSA 3UB3A 1M2KA 1LQ2A 1Q0QA 3K0HA 3NETA 4MARA 1EJ6A 3HLKA 1ZMRA 2F6RA 3DA8A 2OZLA 1DWUA 2NPOA 4KBYA 1US8B 1UXOA 3HNPA 3U4IA 1U9CA 5CB0A 4GWLA 1BMFD 5KOIA 1KFKB 4NBUA 5KU1A 5AW5A 3OLCX 5DPMA 4YJFB 1E66A 2BHNA 1NFRA 2P3LA 2PT5A 2VIIA 2Y93A 1J97A 4M9QA 3OZIA 4F97A 1MF7A 2P2GA 2PWPA 3SJBA 5JDCA 4R84A 1HG1A 4A27A 3FOEC 5KB3A 2I9PA 2AOTA 1AKMA 3BXXA 1RAIA 1T9KA 1IYZA 1H66A 1FBTA 1AHIA 2RHMA 1QUFA 4JH0A 5DTIA 4BMZA 1QVRA 2I4TA 2QGFA 5CG1A 2H4ZA 4ZT6A 5CTJA 1BVYF 2XJ4A 4KDFA 2E9SA 1HV8A 4MGYR 2OCXA 1EUDB 1I32A 4MYCA 1O87A 1YZ3A 1V6AA 4E6PA 4ZI7A 5A5VA 4G0UA 1KTVA 5HA5A 1ID1A 1OCEA 5KJFA 3GMIA 4X6LA 3RS3A 5JZ9A 5FWYA 3GDGA 3PXDA 4TXHA 1M2NA 1D6JA 4CCYA 4G36A 2IPAB 4DLYA 1HNNA 3EG9B 5DYGA 3E5MA 2YY7A 1EI9A 1R0BA 2IYEA 4OF4A 5DHTA 4ZU3A 4C29A 2BKLA 3K8QA 1O57A 3SWWA 2O7NA 2ZAOA 3ZWYA 1CBUA 2OR3A 2RH5A 4IFEA 3WP0A 1IM5A 4QEKA 2XMDA 4HX9A 1QX4A 1DFGA 1YE8A 1LZKA 5F5LA 1Y8QB 4FYMA 2XZLA 4PQEA 3W5BA 1CJMA 1YOVA 2B99A 3NHZA 1YZYA 2HK8A 2PA3A 1U5BA 2QMUA 3D6NB 3RS8A 1H93A 1PJCA 3LUDA 4DCJA 1I8TA 2QR3A 4TRMA 3GDHA 2YJ5A 4I55B 4ND8A 4A6DA 4BQFA 2IUYA 2C2GA 4L6CA 5GAJA 3R74A 4CNQA 4BGDA 4BYMA 2OYSA 4GR4A 2H1CA 3CHYA 1AZTA 5JZBA 1WEKA 1SCUB 1NXQA 1GG2A 4AP5A 3LL4A 2POQX 4PQFA 2VQFB 3FJOA 4UHBA 1VL2A 3IQHX 4Z51A 4FZJA 5NULA 4EB0A 5SZHB 3AETA 3AHHA 3RAGA 3NDBB 5IXYA 4L8LA 5MGBA 4KQKA 4TLBA 2G09A 1CF4A 1Q17A 3RYCA 3NBAA 1WW3A 1CCWA 1SBHA 3EC7A 1Q1BA 3ZWAA 5LLSA 4G24A 5AW6A 3AUFA 4GU5A 3SIXA 3MWJA 2FUNB 4TZTA 4B6GA 2PK3A 4HQNA 3MWDB 1TUBA 4WK6A 4IAOA 1HL3A 3ZY2A 1F6BA 4EMSA 2FDCA 4LY0A 4ETWA 2PG3A 4R2HA 1X1SA 5TQJA 4HJRA 3DZFA 3UMYA 1N9GA 1OXXK 5CHYA 3IXQA 2X7JA 1QKIA 3QLUC 4D97A 3SF0A 3ND6A 4Z4CA 2JLVA 4N49A 4Y9SA 4BVLA 1P74A 1SY7A 1WUIS 2IHUA 3B70A 1P1RA 3G5LA 3I8SA 4C78A 1I6KA 4F1WA 2FZKA 3S2FA 4H4CA 4DG9A 1IN6A 4M98A 1YA8A 4XDHA 1FYWA 3FUTA 5EC8A 3UMFA 1A9XA 1USWA 4OJQA 3ASVA 3QMWA 4FYHA 3HKEA 4NI5A 4WXPA 3HL4A 4ZHQA 1U28A 5SZIA 5LYJB 4HEA6 3TNYA 3VH3A 1L5MA 1CYEA 4C4XA 2AG5A 1FS4A 5AVJA 3G6WA 3ABQB 1PT6A 2PUVA 2ZSFA 3O8DA 1G20A 1K2WA 2SKCA 2XSZD 3VR3A 1EHIA 3EMDA 4TVKA 2WD8A 3HVKA 4QLBA 3EFEA 2X86A 5FCDA 1BCRA 5BR4A 3B85A 3SDSA 4X61A 3FH0A 4FBMA 4BLUA 1XTIA 1GL3A 2A84A 2ZATA 1LX6A 4LWOA 2YJ4A 3PFWO 4OH7A 5TR9A 3MHTA 1QF6A 2NTEA 3OE1A 1DJQA 1PR2A 5FNVA 4UU1A 1XFDA 1IQRA 1JDUA 2A78A 2XQKA 4ZU1X 4HAVA 1D0VA 1B41A 1JTFA 3LHDA 4BUJA 3PFGA 2QBYA 5GJVC 1OZFA 1EAMA 2HMAA 3F98A 1IN1A 4C7OB 1NJ2A 1RD4A 3FWZA 3OFSA 5KUTA 4GI5A 3ZG6A 1OV4A 2FTKE 1X7XB 1IY9A 1Z2AA 1XAGA 3MGBA 4ZKEA 2R68A 4DXDA 2XZOA 2ZFUA 3O03A 2GTHA 1BS1A 5E2IA 2XKAA 5BOSA 4LQLA 1ISFA 4UDYX 3K15A 1XNGA 4EKDA 3EZNA 4FKMA 1ZX1A 2Q46A 3OM1A 1XR3A 2FVYA 1EZ4A 3WRYA 4KIUA 4B82A 1NPTO 2DPYA 1GEGA 3IEXA 3NLLA 3O91A 3UXHA 3N2KB 4FCCA 5ED4A 2IVFA 4M89A 1A4UA 2OPHA 3VKGA 3S5UA 4HMQA 2PYZA 1W4CA 4MVYA 2ZKLA 3C3CA 2PJUA 2HHLA 2Q4OA 4GZ3A 3D4NA 5EQTA 3ESCA 5AKEA 4KITB 1RHJA 3F97A 3KZ1E 3CBQA 5AUQA 5CA0B 5MGNA 2CUZA 2MTBA 1FDOA 3W8NA 4A16A 2DQ4A 1U0FA 3AVPA 3I6MA 3IO5A 2JCBA 1W0JD 2HF2A 2NNWB 3K6SB 1DIGA 1JILA 3MMSA 4W1SA 5AM0A 5CA1B 3SSAA 3K6RA 4PC3A 4BVHA 5WRFA 2C20A 4V0KA 1G9XA 1ORHA 2QYTA 1DV1A 2LR0A 5BMVB 3PHJA 2BRUA 1R0RE 5CGQB 1BX0A 4ZTUB 1BS2A 3TSOA 3X1JA 1KY2A 5IYZB 2IYWA 5LWHA 1QHGA 2X0EA 4DCGA 2NAFA 1I51A 1YIDA 3O93A 3ZWPA 2GBPA 1E3MA 3U1VA 2AQHA 4PGFA 3NIBA 1RLIA 3RRNA 2YWFA 3WBFA 5GMOA 3ETGA 2UYGA 2PFSA 2FH5B 1DBSA 3NHRA 1XQ1A 4NH4A 4ZU6X 3V7UA 1T0BA 2PFKA 5ULLA 4DMRA 1I7SB 3K9FC 1TCUA 3DBLB 2NOAA 3D3NA 3JVVA 3LQQA 3P45A 3RSHA 3UGTA 3PQ5A 1UPCA 3R5SA 2EOAA 3A28A 1NRIA 2WUFA 3HABA 4DLPA 1LPSA 3CMCO 3Q5DA 2VHWA 2R00A 2VZ8A 3FMVA 3Q40A 1C1DB 5GGYA 3KXDA 4BQNA 5IXSA 4DJAA 2IV7A 4IUDS 3WOVA 4HXFB 8GPBA 2BW0A 5FUQA 2WVHA 3ED1A 3THXA 4G09A 2CC2A 2ZJ7A 2AX3A 3I58A 4RVHA 2J6IA 2SECE 3ZQ4A 4C7XA 3NTQA 4JP5A 1NY5A 1N0HA 1WU7A 4MWOA 5ENZA 1ZIYA 2X8WA 4B31A 4D81A 4EEKA 4F8EA 5DHUA 1L7NA 1X42A 3PYXA 1U3FA 4RM3A 1PGNA 2EKQA 2F55A 2UU9B 3HJNA 3HO6A 3IO3A 1ML3A 4ZODA 1E0AA 5DDIP 4R7TA 3K8YA 3HCFA 1V39A 1VG0B 2W2NA 2X19A 3AEQB 4RIIA 5AVXA 1HDRA 4AI6A 2O9JA 4GQAA 4LDZA 1Y89A 1CVLA 1J9GA 2IOYA 3P0IA 3EULA 3PS9A 3PHLA 4EJSC 4F04A 5LJLA 1QR6A 4MVJM 5FTNA 2JHGA 2UZ4A 3THYA 1K66A 5JJIA 4D3DA 4H3KB 4D8WA 4ZJPA 1KI3A 1NVXQ 3X1MA 5EZYA 1QR2A 1GU7A 4DIBA 3IAEA 3SMVA 3S1SA 3AF4A 1E0KA 1NW8A 4KXYA 4OAQA 5AHXA 2VYQA 3ZWVA 5AUOB 5BVGB 5JH7F 4RZUA 2O5VA 4BX9A 5HWSA 1X94A 4UTVA 2PBRA 3IE2A 2HUNA 4KFSA 4FMCB 1Y6QA 1W34A 1WUTA 2GGSA 2WWTA 3RSZA 2J9YB 1U4SA 4TLMB 5DTRA 3B8HA 2Q3FA 5FP0A 4HAXA 3QUBA 4P0PB 4JB2A 2OGTA 3M2PA 5BN1A 1LCIA 4M4SA 3GJ5A 2N0SA 3VH4A 1CY8A 1YIOA 2J9XB 1Q3HA 2F9FA 3MC1A 4Y6SA 3ADCA 2PZKA 4MRRA 1WD7A 1WKVA 4EZEA 3Q6MA 3RLIA 1WZEA 3L8CA 2IP2A 3OZWA 1P75A 1S8AA 2N1MA 4F86A 2D1YA 2V1XA 4ALLA 2FPGA 4BBPA 2FPGB 2RI6A 3SBEA 1R74A 2I4IA 4NNPA 4CFYA 4NJMA 1ZPDA 2OENG 2MOKA 1CY4A 1TT7A 5FUBA 2AOTB 1ULHA 5BO5A 2GF2A 1Y1LA 1YDEA 2AZ4A 2YFYA 3EISA 4OQEA 3T9CA 2AF4C 4UQPA 4DGQA 4HPWA 3QV2A 1JU9A 3R24A 1E9RA 2O4CA 2P2YA 2PO7A 3ECAA 2E89A 1GXSA 4MUBA 4RJLA 3UJCA 2XDQB 3K0AA 3WKAA 4WJLA 4HNTA 2QQGA 3CKKA 2BI4A 3N6XA 5C8YF 3CVWA 4E1BA 1CNFA 2YRFA 3E3OA 4FFVA 1H2ZA 2CXQA 2VRCA 1ZN9A 3X43A 4HADA 2QP9X 4EG5A 1ESNA 3A6DA 4RVDA 4O2RA 3THRA 4CQJA 3HZZA 4I8DA 4QLAA 1KH3A 4ODIA 3MWEA 5CXQA 1UOQA 3K70B 4XX1A 4TKZA 1AH2A 5CB6A 4FGSA 1MOPA 3ZK8A 3NTOA 5DXFA 4F92B 3PU6A 1H5UA 1OTXA 3L04A 1BD3A 1L8XA 2WHPB 2XF2A 2WHPA 5CK5A 3OD5A 4JYZA 5IJ9B 2YHBA 1E9AA 3PUJA 4LHZA 1WMBA 4BMYA 4B7UA 1C9KA 2X4LA 3HEBA 2ZRDA 1CX9B 5CAEB 3NS7A 1O3YA 3DHWC 4HNSA 3E6AA 4OHUA 3KEQA 2BEUA 3FTQA 3W2IA 5FO0A 3RJ9A 3E8XA 3WL5A 2RHWA 3ZUPA 3NHYA 1IUKA 4MIKA 1QB7A 4Q47A 3E9YA 2G1UA 4G4SO 2FW0A 3KZKA 4JJAA 4WCFC 3B89A 5H7XA 4HNUA 5AK6A 3RT9A 3JVUA 2VWHA 3GLIA 4Q7QA 4KUHA 2DHQA 3GMSA 4ENUA 2X6TA 1E2MA 3M1AA 3H9UA 1C41A 5JXIA 1L5KA 4AKSA 2QY6A 3JALB 2ZYHA 2FRVA 2XUHA 2EFJA 3DMGA 3A6PC 5BSRA 4C14A 2NXNA 1RQNA 1BFDA 2CCGA 2AA3A 1HM5A 3ONNA 5F3DA 1YONA 2FXVA 1L5SA 1E3WB 4ERNA 5IJAA 3QX3A 2E18A 3GFVA 4PFKA 2CMHA 3EVBA 5I7HA 1GYPA 2IBMA 3TLXA 4CKWA 3N9IA 4HDMB 3DW3X 3H75A 1JAHA 2HRQA 5CGZA 2PL1A 1MHPA 1M6EX 3DHEA 3TLMA 3HXTA 1W36D 3UAVA 6PFKA 4R0NA 2K2QB 2AQIA 3BSWA 4BJ6A 2A1UB 1Z4OA 3AYXB 3I45A 4KTVE 1NW4A 4ZALA 4UQLA 4GOKA 3G8YA 2H9YA 4W5OA 1D5WA 1CIVA 5JLAA 1XWIA 5JDCC 4P80A 2IP4A 1PK7A 1E79A 4DDWA 2N75A 1JWLA 2B30A 1ZAKA 1S4MA 3GJ3A 3HSSA 4EDFA 4LRQA 3GL9A 4UPDA 2BDUA 2ID9A 1U90A 4CLXA 1XN4A 4QUEA 1Q92A 2ALJA 3FHCB 1DLIA 1H2FA 2CD9A 1EDZA 1T26A 4LPKA 5BSHA 1T9DA 4I1SA 5B30A 2ZIFA 1PE0A 4BLWA 2ZSKA 4LMAA 4PTZA 2Y0PA 5H3LA 3RRZA 2JAXA 3V3KA 4EO4A 5IU6A 2DXIA 5KTNA 1QQ7A 5CT6A 3CF4G 1YBAA 2UUPA 3VPGA 1NPYA 5KVAA 4Y2JA 4UNSA 1QG0A 1UM9A 2NV0A 4EUKA 4C7MA 2G9ZA 3QKIA 1OASA 3FPHA 2BTQA 5EGSA 3MEQA 4HR7A 3ZY5A 2XVZA 3EYAA 3FPLA 4FW9A 4BNXA 1PVVA 2VBGA 5K3FA 1FJGB 5EFZA 1MB9A 1DJPA 2ODWA 2ZVQX 1VB3A 1XQ9A 1H9CA 4XGRA 1C30A 2UUOA 2R8BA 2G9RA 4C6RA 2GSDA 2PWAA 2QLNA 1MX9A 4FN4A 1OGJA 1A50B 1CJCA 2OOSA 1I4LD 2B2CA 3Q2OA 4LHVA 1JXMA 4QYIB 1EDEA 4YEDA 4HAOA 1DCMA 4MZXA 4FDVA 2ZK7A 4GR9A 4L8FA 4LA4A 4PONA 2ECFA 4BAZA 1U9JA 2IOQA 1JWAB 4DSUA 2YJ6A 1Y82A 4OUDA 4BQPA 2VDMB 3S8EA 2ZT7A 1X0XA 2G82A 2HWKA 1K5PA 5HCIA 4M1KA 3GZTB 1MC5A 2I65A 1U7OA 3GB9A 3L0SA 2HU7A 1YT5A 2EKBA 2HZ7A 3I1YA 3NDJA 3T1QA 4B45A 3VTKA 2NP6A 4LUCA 3IMFA 1ZNXA 1OAOA 2IPOA 5L3ZA 3F4KA 4GKKB 2C3MA 1QSGA 4N6NA 5CX1B 5AI9A 3CNQS 1QX3A 5CURA 2PLRA 3SGLA 3PJDA 1Q0UA 2Q6OA 1I4EB 4GC5A 4L8VA 4NC9A 3LYAA 4TYPA 4ZVNA 1GL9B 3WNQA 4BE7B 4X6UA 5EPEA 4LSWA 1V0JA 4QGSA 2FG5A 2XDWA 4OKSA 5HSGA 4PPYA 2P4SA 4FJ2A 4URVR 4HDSA 1G6HA 1DX6A 3E9QA 4LSMA 4PG5A 3VYUB 4CBVA 4LQDA 3B53X 2QZJA 1PR4A 4A2PA 3TG8A 2VYFA 2W6QA 2CVOA 1ZK2A 3GJXC 4CMCA 4O1MA 1PNQA 1R4ZA 4US1R 1E8MA 1ZJJA 4P92A 3A6LA 5D2CA 4PINA 4KP7A 3CGGA 4R1TA 5CEFA 1IVYA 1CDZA 3UGJA 2IU3A 2Z58A 5IJXA 4YXWA 4JP2A 4V1CI 2FW7A 2CJYA 2H7VA 3AEXA 4G5OA 5K09A 4X3PA 3ACBA 4KR0A 1B2LA 4QC2A 2DCMA 4GVPA 3SC2A 2VHQA 1IMJA 2FJ0A 3PJGA 4YCBA 3PUYA 2QL6A 4WL0A 5FI0B 1A96A 3QSGA 2D4HA 5EGNA 4FYWA 2QG9A 1QNLA 4JVMA 5BN5B 3ZBTA 3ANLA 3L0ZA 2OFPA 3QMMA 4RQTA 3I0MA 1B26A 3WYAA 4R1MA 1G59A 4EAAA 3HN7A 2F43A 1AGXA 3MSXA 1DIHA 4YT5A 4JOSA 2BF7A 3WHKA 3ZHSA 3TO5A 4PZZA 4DQDA 5A4MS 2VDKB 2DR2A 3F3YA 1PSWA 5CLIA 3G9QA 2B25A 3PVZA 2O2XA 2YV4A 4G5YA 1AV7A 4IV8A 2HTEA 4MUEA 4K0RA 5E9AA 1Z33A 4CW7A 4E5DA 4YRAA 3H0CA 1K8XB 5DNDA 2G80A 1OR8A 2VT6A 3R0VA 4MCHA 5TDHA 2VK4A 5HCNA 3CMMA 2IWRA 2VTBA 2ZSIA 2ASVA 1ESZA 2NVOA 3AY6A 3S2IA 1OZAA 4DAOA 2G7MC 1VGRA 2Z43A 1P2UA 3O92A 4PIVA 4QHSA 2W2OA 4QYTA 5IBPA 3TRKA 4YIHA 1FRQA 1PBNA 3IVXA 1KYXA 3HR7A 3JVEA 1D1PA 2NADA 4CG2A 1ENPA 3GFBA 3T5TA 2XBLA 621PA 3AY3A 3ZQUA 1MNAA 4H35A 2BCEA 5EKXA 5EY5B 5AD1A 2D0OB 1SXIA 4WWHA 5DV9A 2EGUA 1HE8B 2YWDA 3LO5A 2GQ0A 2BMDA 3G2MA 2ZSAA 4REQB 4ZRMA 5C5DA 4IUCS 4FPXA 5DLYA 4WNAB 3DTTA 8ATCA 4J1TA 1GUFA 2WU0A 3F7NA 3JZIA 4PFSA 4H1HA 4U9UA 2PFGA 3BERA 2XUAA 1IY2A 1NOJA 2AMLA 2GBIA 3D2BA 3KYIB 3DONA 5E8RA 3GN2A 2J4FA 5GONF 5K51A 2R86A 1KR2A 4MRVA 5I7EA 4EZBA 3IB3A 4EPVA 4LX0A 3F73A 3KKNA 3P9IA 2JLRA 4HDRB 4UOZA 4TV8F 4LE1A 5JD3A 1N2ZA 2OBBA 3N53A 4M0EA 1QIHA 5SY6A 3TOXA 4PHFA 2DBRA 2BBTA 3RRMA 3O3CA 5I3ZA 3A2MA 2XLBA 2ZTUA 2BGJA 1NUUA 3D02A 4L16A 4WZBA 3V4FA 2XX3A 3S29A 5C5IA 2D8MA 2AFIE 3CEPB 4HFNA 2WIGA 5FA8A 1E6MA 5LCXA 4M0CA 3UXEA 5B12A 4G0NA 3MRXA 3QELA 1H0KA 3AWDA 2WTUA 3ZVNA 1VMIA 3R5HA 2IXTA 4MRSA 1JZQA 3F2IA 3IKLA 5CFZA 2O8NA 1E8NA 1SBQA 2AI3A 4IFIA 4M60A 4RBNA 4AWXA 4JVSB 5G3YA 2H2GA 1J1ZA 3HEMA 4DJEC 2F62A 1OAOC 2CLMB 2OCLA 2QTZA 3B3GA 3EGDB 3HKCB 5BV2P 2G36A 1NIJA 3KQOA 4XSVA 1IXRC 4EJFA 3TW4A 4G9BA 1H8HA 3IERA 3R5TA 2XE7A 4WXEA 3KQKA 2JIZD 3UAYA 3DQZA 1QKJA 3DMYA 4OD0A 2IPMA 3LJKA 4E94A 4I2NA 5HUHA 1Y6ZA 4R68A 5B3LA 2IHTA 1DEHA 4WDRA 5B6PA 1M76A 1T0IA 4G84A 4GUDA 1ZSVA 4XQ9A 3U6BA 1RQ2A 3TX6A 5FR2A 3E70C 3GJ6A 2V0CA 3HV0A 3KVOA 4L4RA 4ENQA 5HIAA 3U4QB 4W5RA 2GZRA 3HCEA 1NMSA 4MP3A 1P81A 3JQ9A 4XB6B 1VLZA 4OL9A 4V2UA 2G77B 2IZ6A 3E81A 2YHIA 4URHA 3C6QA 1DV2A 2AT1A 2V6JA 3GVXA 4F06A 4QASA 4LJ4A 1M1NB 1XG5A 1JNXX 1YMUA 2W0SA 2CXHA 2Y66A 3HFJA 4BLRA 4KLZA 2C3OA 3F5FA 4EG1A 4YAOA 3K0FB 1MJNA 4O02B 4IEEA 1Z56C 2BFBB 2HK7A 3DE2X 4P4LA 4BO0A 4Y1RB 1T6BY 5FD8A 1ESEA 5TV2A 3PXUA 1NW9B 1VSVA 2ONCA 2R8EA 4R6WA 3GDFA 1XZCA 4UAUA 1U4NA 1USVA 3BGWA 3R3VA 5GJBA 4KKVA 4H6PA 1YR9A 3ROTA 2WHQA 2ZBDA 2MR6A 2YOHA 3I6ZA 4DXAA 4YV7A 2COEA 4WECA 1C8BA 1KYWA 5DEIA 5JWHA 5JARA 1MJGA 3OJWA 2G5TA 3V8RA 3FBWA 2WF9A 3BD7A 3JD4A 4PS0A 3RYTC 2HPZA 2DY1A 4FYVA 1T8YA 1T0JB 3HHPA 1CY7A 1QO7A 3UA4A 4B6FA 4D9EA 5L51A 4ZZ0A 4RD6A 2R5WA 1CUEA 4QVGA 3A6KA 4DSAA 5K0TA 4R5MA 2ZW9A 3IMGA 4H31A 4K9OA 4HAUA 2HDWA 2H5IA 2FU5C 3DAYA 4MMXB 4MPDA 5EESA 1LPAB 2XVXA 4QTXA 4ATNA 1YI8A 2AN3A 2OZKA 1PS9A 2AMYA 3TD9A 3RWOA 3Q6IA 2FG6C 5E2AA 1XMSA 7REQB 4YCAA 4KFUA 5EIBC 3LL7A 3ZPXA 4A1OA 4AJ4A 3D7MA 2RHCA 1JAZA 3IE0A 4DLLA 3CVYA 2D13A 3R0ZA 2HH9A 1QPZA 1P5ZB 4LXHA 5IF3A 5M04A 1DOAA 5BYJA 2Q21A 1U9ZA 4WQMA 2J4CA 1Z7YA 4CI9A 5ALJA 4D26A 2FSHA 1FJXA 1A8HA 1Z4JA 1T5DX 4KN9S 3IDZA 2YC2C 3LCMA 3D6TB 1VHTA 5KTKA 1JF8A 2GHQA 3VR0A 1UBTS 4MP8A 1UBSB 1R18A 3AR4A 2J9FA 3CUVA 4PN3A 1M2GA 2CHQA 3IP6A 1LJ8A 4Z86A 3T41A 2EWVA 1IULA 1UKEA 2AKYA 3VU9A 5E9QA 1JHVA 4TTRA 3VV3A 4NFHA 4PLHA 1WXEA 1E77A 3JARA 1D2RA 3CLHA 1T8TA 2NTYC 4IXWA 1N0WA 1FLAA 3HUDA 3L06A 5ALWA 3B3AA 3UKJA 3DF7A 3IIMA 3VKVA 4EVSA 1YQ9A 2HUPA 4N5IX 3CR8A 4AG5A 3AVQA 3G5TA 2BM9A 1L4GA 4QIHA 4D9JA 3VISA 1B43A 2H11A 4CTOA 3P9ZA 5EJEA 4R81A 2GBLA 3E7FA 4OXXA 2BGLA 1DB3A 3DTYA 2WY2D 2ZB4A 2Q3HA 2ZIXB 2C4NA 1JJVA 2QRVA 2H8KA 2ZXEA 3L8ZA 1DL5A 4TX1A 5A3RA 3C8UA 3AZPA 4R0VA 5LYYA 5L9AA 1N32B 5BQ3A 3R5KA 1Z4IA 2H65A 1JHUA 3ZWBA 3IP7A 3DLIA 4NCHA 3EWAA 1FIUA 2ECQA 4Q24A 2O59A 1R8JA 4Q7MB 1UJ5A 4XM1A 1D2CA 1CJBA 1KDRA 1Q83A 2P6NA 1J1UA 3E61A 2VPXA 1QO9A 1GZ3A 1OLXA 3RJMA 3LHKA 2HXYA 3NJ8A 2F1KA 4FDTA 3UV6A 2R1TB 3OJEA 1K6XA 4HLUC 1Q2XA 3KB8A 1CRQA 1CE8B 3IEKA 3F9IA 5ECGC 2GEUA 2VSYA 2QX4A 1M8GA 1QWSA 2QVYX 2G9QA 1FVFA 5AQEA 3AUJB 3L7LA 3NEPX 3CH6A 4GAEA 1J49A 1I2ZA 2ERXA 3PFKA 2ZSBA 3CLRC 5IAGA 3KDAA 4KZPA 1QF9A 2WD7A 3M6XA 4L9SA 4C0LA 1GQQA 2O3UA 3JYPA 3DBHB 4E2WA 4ZCMA 1UODA 5LIPA 4DQVA 3RVOA 1ZXXA 5EL0A 1YQXA 3PT9A 5COAA 4A8JC 4JT4A 3RC1A 5ADVA 3IQWA 3LUPA 5THKA 5JROA 4MV5A 2YASA 5DYWA 2WJHA 1TGVA 1VE3A 4V0RA 3QBTA 5FWDA 1FLNA 3EFBA 5BSKA 2VQ3A 5CFQA 5J43A 5KNCA 1H9BA 1N9ZA 2W7TA 3GPIA 2OCPA 3QBVA 4Y6OA 1U2TA 4D56A 3RSFA 1Z74A 1T8PA 1TNDA 3VVMA 5JEEA 3FVWA 5I9IA 3LSYA 4OPMA 4CPDA 4F96A 1B2RA 2VXBA 5FL3A 3L0CA 2D1TA 1U6IA 1FX0B 1NXVA 5A4KA 3PE3A 4MV6A 3F5MA 1KL7A 4URXR 3NOQA 3SAJA 1RHRA 3GVIA 3RSCA 5K6AA 3FUVA 5EJFA 1BFKA 3K5PA 1M34A 1VSUA 3P19A 5GJWC 3TPCA 3VDRA 3IBGA 4I5GA 1C4WA 3VHRA 1SUFA 1GRVA 1D2NA 2ACKA 5C3UA 1QGED 3GRZA 2IEGA 3WAKA 4Q37A 3KVNA 121PA 4YIKA 1P1HA 3F3MA 3OZAA 1L5NA 3C4VA 4Q66C 4OH1A 1K7FB 2K6GA 4LCEA 3ZIUA 5EYPA 2WQ6A 3AGQA 4ZMBA 3QXJA 3SJ7A 4PANA 1K06A 1M2WA 1J2UA 4URYR 3E53A 3GCWA 3HVHA 1E9CA 4WCFA 4ZO6A 4B80A 3G7UA 4TV9F 5JXGA 2RC5A 4J16C 2OUIA 2R6GA 3SU8A 4U5QA 5B64A 5I4KA 4LCBA 2JH8A 2Y1FA 4NARA 1J06A 2P2NA 1VRCA 3G0GA 4M9RA 3QXGA 4P4UA 4AZSA 2OCGA 2PBLA 2NQ8A 3S2ZA 1DTEA 1L3BA 2OSVA 4F56A 4DHEA 4NK4A 5FQNA 5FADA 3V7NA 4ILEA 4D9KA 4L3VA 1ICIA 2ZBFA 3H6KA 3QX8A 4I8XA 4J7XA 3T3NA 1X1DA 3OF3A 5ELLA 5CCDA 5JJLA 1NYLA 1AKQA 1Y1KE 3Q1LA 3BMQA 4MUXA 4ZDIA 2F00A 1UKBA 5JCPA 5LBUA 4XTCS 5DIFA 3JQRA 2IYQA 4P1ZA 4C3ZA 2Y0BA 2IQ5A 2W11A 3LP6A 4ML3A 1U2RA 2WJJA 3ZXSA 2X5NA 3K9BA 3CVJA 4LZZA 4JGGA 3DVRX 2VJKA 1YZVA 4H7IA 1BXRA 1MOZA 1SCUA 3UWOA 2QP3A 5DK6A 4RX1A 4EYSA 2JGDB 3OOSA 2YVLA 3P2KA 5JAHA 4UCQA 4Y2HA 3S27A 3EGWA 3TDNA 3TAHA 1UPUA 1U2PA 5LB4A 1P0FA 5IK2D 4HXEB 3SKYA 2REOA 4MR7B 1VPTA 3W4IA 4YRPA 3RYCB 4BMNA 1NP6A 4TVOA 1Z4KA 3N70A 2Q9AA 3OIUA 4NZPA 1GTJ1 2ISSD 4GPTA 4RLSA 4QG3A 4ZJUA 4BO3A 4JX8A 4C6TA 4ZARA 1YBVA 3P4YA 2ABWA 2AJ8A 1S2GA 1Z9BA 3SKVA 2BP7B 4FFBA 4II3A 1CQIA 3IDFA 1FSZA 2JGJA 4U6QA 3A4NA 3N86A 4CMAA 3TEFA 5JMWA 2J5QA 3PGXA 4LISA 3VI3B 3GEEA 2ECKA 1QZTA 3SBXA 1E6UA 2P67A 5BW6B 1BN6A 3E15A 3SHTA 3C4JA 2Z2JA 2WJVA 3K0CA 4B4KA 1UJ2A 3IDQA 1XVAA 3UT0A 5LLDA 1OOEA 3RO7A 3KBOA 1Q1QA 2GPJA 1D2AA 3EJWA 4PG4A 3W8RA 3NYIA 4LHSA 2I7VA 2VJPA 1R0CA 2FB9A 2RG7A 3ME5A 4AN4A 1Y7IA 2AX4A 1V7ZA 1QCYA 1NLMA 1FEZA 2G9VA 4HZGA 4B3RB 4N41A 1VRVA 2Z04A 2BKUA 5LC1A 3C6KA 3OLXA 4HFMA 4CZ2A 1IOZA 5I9BA 2WU8A 4HTFA 4PXYA 1QIDA 1JI0A 1YUMA 3LXUX 4Z6KA 1PW7A 3FPJA 3OT1A 3SHFA 3T7JA 2PN1A 2GCOA 1NHGA 4NULA 3ZLVA 4ALNA 1OT3A 7YASA 5BUCA 1FCJA 2BONA 1PX0A 2CN1A 4V0NA 2CE7A 2D1SA 4PX2A 4DS3A 3RUEA 1W5FA 4PAMA 2PUJA 2W90A 2EKZA 3UGQA 4ZCQA 1SH7A 2KYRA 1ZH0A 2JJ8A 3A3NA 2HADA 4J0CA 4EQ6B 3DR3A 3LZ6A 4MUNA 3RC7A 2X0NA 4HS4A 4NCJA 3SC6A 1M1XB 4LYGA 2D2FA 3MCZA 2RONA 1JR3E 3DAOA 2DHEA 1XL1A 5GM1A 1UJMA 5BUZA 1JIJA 3GLFE 3CR7A 4IDQA 1VPWA 3EFOB 1OI7A 1HDZA 4PRLA 5AOCA 1GSHA 4BU0A 3DT8A 4BGIA 5JAIA 2PVCA 1OY1A 4E14A 4ZOQI 2RGXA 2V7QA 4DBLE 1KK3A 2HIAA 4LRWA 1DUSA 4CF5A 2VSXA 2X0JA 2HBZA 1ZLYA 4GR5A 4A5OA 1YZLA 3KR2A 3LHFA 1IN4A 4JB0A 1TD9A 2JIZA 4N9WA 1T0PA 4G8JA 4DUPA 1F7VA 5KDLA 5JY6A 3UANA 3IQDB 2F59A 4FOTA 5J59A 1WMDA 3G2QA 3JS5A 1TEZA 3DMRA 2C82A 1FFAA 4RACA 4XCVA 1N1EA 4KQCA 3SHQA 3MRTA 3OFJA 2V7EA 2FUG6 4YUYA 3MJHA 3K0FA 2GNAA 3LAWA 4R3WA 5C8YA 2GF9A 1EIZA 5HE8A 3LDAA 2C9BA 3B3JA 2A14A 3KP1A 3D8RA 1NX6A 2H18A 3RU2A 3HCBA 1G8MA 3W1VA 1H69A 4B3SB 1GKIA 2PBZA 1JHYA 1DTSA 2QD1A 1BMDA 3GD5A 3PFFA 4YRQA 4UFNA 1H6BA 5KYYA 3HB1A 4XPIA 5FTJA 4P2GA 4FFDA 1GDDA 4JBYA 3ROKA 4EL5A 3MMNA 3WLEA 2O8CA 2J3EA 4UVDA 3EHDA 2WJAA 1OJ7A 1H2WA 3CW9A 1O5IA 4NBVA 1I0IA 3NUQA 1N3YA 1JXOA 1HLFA 1PVOA 3KWJA 1Z12A 4DDKA 1NW5A 1PS0A 3IEVA 4QOFA 1R4NB 3GJ4A 3HS3A 1GPYA 3QNWA 4AZVA 1E7WA 2BFFB 3WO1A 4DM3A 3DZKA 1AQNA 3BXOA 5HIMA 3SZOA 5LLTA 4FWIB 1E1YA 1UC5B 4Y6GB 3A27A 3WLIA 1SFRA 3JQDA 2JD2A 3AKYA 4E5NA 2H16A 1GPKA 3MW8A 3KPJA 3CW2A 3TPFA 1ESDA 1ATZA 2YC4C 3JQFC 1EDDA 3CURA 3IOMA 3ZW7A 3FXAA 2ZYRA 3DGEC 4K9LA 2DWQA 4TLDA 3V4OA 1P2SA 1N6OA 3GJTA 4FHEA 2B0CA 3DV9A 2JIMA 1JFFB 4JR0A 4O2AB 3QYJA 4FHDA 3TKLA 4CNBA 3HN2A 4R7ZA 5JDIA 4RDIA 3RARA 3PWSA 5FPPA 3PNYA 2WUEA 3CZMA 3NNSA 4N1AA 4ZPJA 5EIHA 1BXGB 3QKSB 4QX6A 3MTIA 4IVQA 4BFUA 3N2KA 1YZKA 3EAFA 1VG9B 2WLSA 2Y9PB 3QE2A 3L6UA 1GGVA 5LSAA 3GLFB 1KU0A 3K9CA 1P2DA 1ZZEA 2Q2VA 4TYQA 1EXDA 2M6SA 4M9SA 2KBEA 4CF3A 4OMCA 3B6EA 1NYQA 1UFKA 1RADA 5DCLA 3IAUA 4Z7NB 4EVRA 5H82A 1GITA 1RAAA 3HGTA 1BVUA 1AQLA 4G5FA 2PSHA 4X7PA 1ENZA 1Z6GA 2JFOA 2A1TS 5M3BA 3BIWA 1I3CA 1ZD3A 1T2VA 3LIIA 5CLGA 1A2BA 3K4HA 3OQHA 5BNFA 5JECA 4V0ME 3U80A 1FC0A 1SUDA 1Z38A 4QDJA 4MX8A 1O95C 2JDIA 5BR1A 4BYGA 5DM0A 2V3VA 1KI9A 2NZXA 1A4XA 3QJGA 5EINA 1GDTA 3KTOA 4TZ6A 3UWKA 2PQ0A 3JASB 4G5XA 1ANKA 1C3LA 1QHEA 4JT2A 2VOEA 3RABA 4DCCA 3KUKA 1H22A 4O4LF 4RD1A 1N57A 4I81A 2YN0A 4MJ3A 5GWXA 1S2OA 4LV8B 1XXHB 2XUJA 3W9SA 4WLEA 2R6JA 1TJ3A 2W2QA 3MJDA 1CEEA 1R2QA 2DKNA 2DWPA 2OORA 2QQFA 3LE8A 1JPUA 4L0QA 4Q1FA 5DBEX 1FYEA 4BJ3A 1A3CA 1S8OA 1XAJA 3P0RA 1QLWA 1P6QA 4PGGA 3VKUA 4R16A 3GCZA 2RH4A 3GPCA 3HH8A 4QT4A 4ON9A 5KNLA 3E82A 1QAMA 1QZZA 4WZZA 3RH0A 3VYSB 3NKLA 3T4UA 3TLEA 2Q2NA 4BV8A 3SLRA 2OO3A 3WXBA 2HX1A 1QHIA 3SHOA 2CNWD 3KJFA 1ZGAA 3PRYA 4K03A 4KSCA 4R8LA 1WUHS 3U26A 2QX9A 1DBWA 1SU6A 4IY1A 4RK7A 5IJ0B 1E7SA 1M1YE 2TS1A 2BFDA 3FF1A 3EPHA 2H1IA 3LF1A 2JCGA 1WIWA 1WHTA 1LBQA 3W6ZA 1Y6GA 1PZHA 2VSNA 5DYYA 4ENSA 3O8OA 2OQ2A 2HMUA 2GLTA 1L7PA 2XMPA 3AEUB 2HA0A 4OAOA 2OCAA 2ZUWA 2C0CA 2H1SA 2WV9A 3WQQA 2E49A 2FHPA 3IQEA 3HXQA 1FFDA 1GRQA 3DT6A 5FWXB 1NF8A 3THYB 1QORA 3T4XA 2VT7A 4D9GA 2A0KA 4N5LA 2ROQA 4UATA 1K7EB 2Q6IA 3AR3A 3KOUA 4YBZA 2RD2A 1VCHA 1ISJA 5FYQA 5J4HA 5J1TB 2GCIA 2D06A 1X9HA 2DT5A 2BAGA 3CUEF 3BTSA 4QT0A 2GJ8A 1BWRA 3EVDA 3KT6A 5TB5A 3W5IA 3PX7A 1DBPA 3SNHA 2XYVA 5LZ4A 1LK0A 2C4UA 3NBUA 5CLQA 3RIMA 1DQRA 3EA4A 4TV8A 3UWDA 5C4IA 4M9CA 2YWGA 5TVKA 5L7TA 4LGYA 3LCVB 2BEUB 1YRLA 4A0GA 2O1WA 4FM9A 2FN9A 1XZHA 1FUIA 4KV9A 4ZC1A 4X0EA 1UM8A 2QTTA 3FYUC 4P9NA 3WHLA 1KE1A 1W7AA 1JZTA 4LOIA 5CDFE 3ACDA 2F3UA 2DC1A 3AM4A 1KZ7B 4A4DA 1IG3A 2VYND 1YE3A 1LRLA 4LQ4A 1IBCA 1PFYA 3RUHA 3TRHA 5ECDA 1TYZA 2ZYVX 5LQAA 3N2LA 3M6UA 2O7QA 3VAZA 5IVKA 2O2CA 3D4BA 2YXEA 4G0YA 2IVZA 2Q0XA 3HWWA 4QRDA 4M1QA 4XSGA 1WSWA 2EAUA 4OHBA 421PA 4R1NA 1PWXA 3CGWA 5CJ2A 1PF7E 1D0IA 1TKBA 3FBTA 1XTSA 4L57A 1O0SA 4UTRA 4B44A 4ESEA 3V3TA 4DLTA 1WDWB 1RI2A 4MVJE 1EXMA 1VL8A 2C4MA 3C8ZA 5DMXA 3D8NA 3U61B 1QIMA 2R1UA 4MR8B 2ETVA 3FZNA 2Q0HA 3IJ5A 4CODB 3V1KA 2YYSA 4ZOLA 3FTFA 4ZVQA 1BROA 5IUJC 3CH5A 3E9DA 3CZCA 1PZMA 1A69A 3AR8A 5JNLA 3OOWA 3Q9LA 1WABA 1OLUA 5IG2A 2VPYA 3GA0A 4BRZA 5CB8A 4NRDA 4E09A 3LCUA 3F9RA 4QOGA 4WH0A 5I9SA 1HC7A 1KOGA 2DPHA 1VKJA 3EC2A 1KZ4A 1NIPA 1R0WA 1YUBA 3H2BA 4LZNA 1LW6E 3VPDA 4EW6A 3N0WA 4EYEA 6AT1A 2WWFA 2J33A 1QO0D 3I12A 2XMQA 3AXSA 4MYHA 3DVLA 3P9CA 4JJ8A 4JJKA 4WHMA 3RJZA 3WWPA 3S4YA 3UB4A 2QN8A 3A1EA 3ZBPA 1LPOA 4A91A 4F93B 4YRGA 4BVBA 2OBFA 4WFIA 2GTPA 2XZTA 3LWZA 2OORC 3OH8A 1WTAA 2Z2KA 1TDJA 4GMKA 1AXEA 5EHXA 1EHYA 2Z5GA 5JNSA 1JLLA 2IS1A 3KBBA 5JJCA 3GLGA 3H04A 5CFRA 2CYBA 4I1UA 2CWWA 1U0OC 1Y4DE 3P71T 4JNCA 1N0VC 2J32A 4AYXA 2B7BA 4JJFA 4Z5XA 2IH5A 2ZJBA 2W37A 3ESRA 4P58A 1Z39A 3IOYA 4S1PA 3I32A 5EA2A 1UIMA 2O6LA 3ETJA 4W8HA 3STVA 3VR4H 4A03A 4ZCLA 1Z16A 3JAMA 3PC3A 4PLFA 3DULA 4C2BA 1Q15A 1JFTA 4Z4EA 1QAOA 3JATA 2QTVA 5EG5A 4ARZB 1KI8A 4UE3S 3EWSA 2EW8A 4D98A 1MVNA 3C3WA 3ZE8A 4EBFA 2W6OA 3N6VA 3CRVA 5LQKA 1VHQA 2BHRA 2D5AA 4KE6A 1JMVA 2WB4A 3V32A 3FOFC 3VPFA 4B40A 3AHFA 3GH3A 1W6RA 2AGVA 1FSFA 1PJ8A 3HA5A 2PV7A 5EHIA 4AN0A 4NMMA 1GUYA 2FWMX 3LGSA 4JP8A 5A5DA 1FX1A 4NVRA 4DUYB 1X80A 2G40A 1BCRB 1XDSA 2XAAA 3NWOA 2I7CA 1RXEA 3G0BA 4KFTA 3ULKA 1YL5A 3TOCA 1DARA 1HLDA 2A9OA 3OEHD 4ERXA 5AW4A 4KREA 2QT0A 1L1EA 1TIPA 1YVDA 2OO5A 3MUNA 4I19A 1WR8A 1UBHS 4MKRA 1NFQA 1SG9A 4KMMA 3ZNNA 3KQHA 3KS9A 4TRRA 1H3FA 5EWMB 1E4EA 2NV2B 3L0YA 1CQXA 1SCKA 3CUYA 1P4HA 3AUAA 5I8WA 2QBYB 2AEFA 1IU9A 3THWB 4BFWA 3RRBA 3X44A 4BO8A 3TD6A 1VQ1A 1V9SA 3LU1A 4R2JA 1M1YA 1WA5A 3QVLA 2QZ9A 2RGNA 4WNCA 2B8TA 3MB8A 4D4LA 1NQVA 2XA2A 4HTAA 1H3EA 2QE7A 2JJYA 3ET5A 3UH1A 2P79A 2IYZA 1Z0JA 2VP2A 4TXJA 1HDXA 3IEUA 1Z7GA 4OB6A 4YFVA 4AVYA 3T38A 3WK7A 2IKSA 2QENA 3NHPA 4KGVA 5J9FA 4QJ5A 1F12A 2HIHA 1RWVA 1TEHA 2XVMA 2ZYDA 3R3XA 5EPOA 4DQXA 4P2BA 5J4VA 4EHNA 3ST7A 1C14A 2FMHA 4JA0A 1Q1NA 4ZEVA 5JAZA 1OKKA 4MV3A 5AVQA 3BKXA 1EUCA 1G3UA 1SPBS 2FFQA 1PT7A 3K1YA 4QUIA 1RKQA 1GEEA 4BO4A 4RJKA 4EW2A 2R65A 1MABA 1RE1A 3KJGA 2FY8A 3WGQA 3ZHBA 2ZREA 4EM6A 1LI5A 2R8YA 3ZZUA 6REQB 2Q50A 1F2UA 2AOUA 2DTEA 3OUUA 3IAS1 1P17A 4MB0A 4RIFA 4TVSA 4LF6B 2RARA 2B37A 3JX9A 4TKMA 4TS9A 4ZEWA 5CVCA 3BH7A 2HDNB 2RHGB 3C45A 2FNAA 3RWBA 2VZLA 2ZBVA 3FCCA 2PH5A 4KX3A 5AM4A 4KQ1A 3TZ6A 5KS2A 2WKQA 1DU4A 3QVGB 4ALJA 5CYGA 1IY8A 3ZXXA 2LCQA 2BJVA 1GTVA 3KVYA 3VTFA 4D1YA 4PR3A 4BV3A 2ZRPA 4X7MA 3TCNA 3AKDA 4B1FA 2X5XA 3U6KA 4KQ6A 3AU9A 5KMGB 3EF1A 3PB3A 1E6LA 2B8EA 4TPKA 4AZWA 3EC1A 3OQ1A 1FDTA 4BPBA 2KLBA 1KI1A 1TPZA 3W9UA 4AO7A 4IQGA 1OXBB 1LI7A 4PZLA 4RCZA 5DI3B 2G5PA 4J7AA 4JU9A 3UUFA 5BPHA 5JANA 1KH2A 1ABEA 2IW3A 3OUTA 3QP9A 2Z3WA 3KJIA 2DWCA 3PR2B 1T1EA 1NC3A 2ZUSA 1E1MA 2P3QA 2C04A 4QSHA 3UMJA 2YXLA 4PYLA 3VZSA 3BDVA 3P32A 5LP6A 1VBFA 1R5NA 1DXYA 4YJHA 1CRWG 4HNVA 4KQGA 3W1WA 4OOFA 3MTBA 3QOXA 4KAFA 5ALMA 5IP5A 3V1UA 4GFDA 3UO8B 2VTVA 2FCAA 1DRVA 3CJTA 3K72B 4JWKA 2XDAA 4OSOA 3X2SA 2XT0A 4B2PA 4J1NA 2PX0A 3K0BA 4PBSA 4UVGA 2DEUA 5AVUA 1WCYA 2BKEA 2A3RA 2C92A 5CLHA 2F3SA 1M34E 2VHEA 1V5EA 2QW0X 3TB4A 1GTRA 3VR5H 4H1TA 3CPSA 3VGJA 3HR8A 3LECA 1OLSB 3SOZA 2JIBA 2C3UA 1KRXA 2CUTA 3A32A 3L49A 1E4VA 3PXCX 5JVDB 1JB9A 3PDHA 1GKYA 1Z6TA 3N0TA 4KVFA 1J09A 4Q03A 3I9FA 4MQFA 3RW9A 4CM1A 4DV6B 4TL8A 3RB8A 2CB9A 3WKEA 1D9ZA 1RC8A 3OEED 4WKBA 4D9HA 1OBHA 1KEKA 2X1LA 5I5GA 4BKRA 4X6YA 3AB7A 2PHZA 5IBCA 5ISMA 1JIQA 3K5WA 2FWRA 1VMEA 1YVRA 1Z8FA 3LRTA 1P2VA 1LF0A 3P2OA 4ND1A 5JCJA 1I6MA 4WIAA 4N6OA 4O4IA 2I2XB 4I3HA 5JS2A 1XAIA 4CDMA 4EHLA 1E1LA 4PNZA 5AVVA 1VMDA 2IZ5A 3E1KA 2PJRA 4OHFA 1J5XA 1KKMA 1TK9A 2ZANA 4F8YA 4EUNA 3HNRA 4AB1A 1V8OA 4BO1A 3FFAA 2IL1A 1QRTA 4ISCA 1JWBB 1XZ8A 1Z28A 3VNVA 3T9EA 2FWBA 1TUIA 3EGXB 1RJEA 2GETA 3C7TA 1FNMA 4MITA 4ND7A 1KQFA 1B6GA 2KPOA 3MINB 1L5YA 4YRCA 9ATCA 3PTAA 2IYTA 1G5PA 4QBHA 1A97A 1TLTA 1DMSA 1FOEB 1CC1S 1ZD4A 1CNEA 1M7BA 2W5UA 4LJSA 3NM6B 2P4EA 1OWPA 3L7AA 4HWSA 1AB5A 4R2KA 4WBSA 2ZXUA 2WKPA 4OL0A 2Y8EA 1U0GA 2J07A 3OPYA 4L9AA 4LV6A 5BQOA 4RFSA 3WGLA 3NBYC 4ZT7A 2C3PA 2BUBA 2ODTX 4XTRA 1T9BA 3L6OO 5DTQA 2PRZA 1TFRA 5AKYA 1WPXA 2ZI7A 2VZ9A 4YP1A 2G9UA 1G8AA 4Y2PA 3HKCA 2P9CA 4BNGA 4FOPA 3GUUA 4IKOA 3ZBUA 1CZKA 2NAPA 1DT5A 3PRKE 2A33A 1KAQA 2FEPA 2CWDA 3CX3A 4L5YA 4YECA 5IDVA 4CQMA 1E96A 5KQSA 4KK4A 3SEAA 3UG7A 2W6PA