2NTEA

Crystal structure of the bard1 brct domains
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
GPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BRCA1-associated RING domain protein 1
publication title Crystal structure of the BARD1 BRCT domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 65
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2nteA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2nteA02
3SHVA 5ECGC 1JNXX 4Y18A 2EBWA 2M2IA 2WT8A 3SHTA 3K0KA 3AL3A 3UEOA 3AL2A 2D8MA 1T29A 1IN1A 3PXEA 4U4AA 3OLCX 2JW5A 2K7FA 1T2VA 2VXBA 2VXCA 3COJA 4IGKA 3PC7A 3I0MA 3L40A 2E2WA 3PXBA 1KZYC 1L7BA 4BU1A 2DUNA 1T15A 2XNHA 3PA6A 2XNKA 2COKA 4XQ0A 4BMCA 2ETXA 4XPZA 3EF1A 4ID3A 3PXDA 4JLUA 3PC6A 2EP8A 3FA2A 3T7IA 1L0BA 1OQAA 2INGX 3SQDA 2COEA 3HUFA 1Z56C 2COUA 2K6GA 1N5OX 3HUEA 3T1NA 3PC8C 2NTEA 3PC8A 2LE0A 3QVGA 3L46A 1T2UA 3PXAA 3QVGB 3KTFA 3L41A 3U3ZA 2L42A 4OFBA 3JVEA 2ADOA 1GZHB 3K05A 4N40A 2HTFA 2R1ZA 1CDZA 3T7JA 4BMDA 3T7KA 1IMOA 3K0HA 3PD7A 3K15A 4Y2GA 3I0NA 1Y98A 4BU0A 2AZMA 3PXCX 3EF0A 3SZMA 3UENA 1WF6A 3II6X 4IFIA 3K16A 2EBUA
chains in the Genus database with same CATH superfamily
3NVKI 2JFUA 4G4SP 5FLYA 1BOOA 4XSGA 1NBWB 4JLDA 2WWXA 4KXWA 1IONA 1ULSA 4RGVA 1J2YA 1ZMBA 2BFFA 1F5SA 1JPUA 3ICWA 1W5AA 3OQHA 1P45A 4MVJD 3V9PA 4DMGA 2PMCA 1T0PA 2GN1A 2AQ8A 4PWYA 5C5CA 2BEKA 2QD1A 2YMQA 4GKJB 2WG0A 4IJ6A 1Y1PA 1TCUA 1DIRA 3NTVA 1X94A 4MUXA 4PEVA 3ESCA 4RJTA 4AJKA 3T7DA 3V2HA 1QQBA 4WPGA 3VMMA 2V1UA 3LQ2A 1G3RA 1K5GA 1RSZA 5H70A 1J25A 2YHUA 4CQMD 4OOEA 4QPPA 5IAEA 3VR4A 4ZAWA 5FWDA 1IHDA 2IEZA 5T8KC 1PLLA 5KNDA 2XT9A 4F5ZA 4KVAA 1V1RB 1IN6A 2ZQYA 1QTIA 3IO5A 3UJ3X 2G9NA 1DAEA 1A76A 2A58A 3OJ0A 2AQIA 4FCTA 4UZEA 3RHZA 5BN3B 5BPHA 5JVDA 4W9RA 3CH5A 4KQ9A 1N8NA 1OI4A 1BA3A 1FP4B 2VBGA 3ESRA 1P2VA 3IXLA 4HGNA 2PRIA 3PDJA 1JIQA 2IUEA 5ALMA 4MYSA 3ZDRA 4PTZA 4AD8A 5ESDA 1OLSA 3IA7A 4YAIA 4MDFA 3JATB 1H2BA 4EYSA 3MMPA 2W7TA 5CLGA 4DXHA 1H2RS 1DIOB 3IJRA 3QF4B 3KPYA 1JHOA 1OFTA 4MI3A 1A9RA 1TCAA 2UYOA 2X4LA 2Y1KA 1KS9A 5B1HA 1QRUA 3DV0B 4RTJA 4J8PA 4JFAA 5BPFA 2QBYA 4BJ5A 3C43A 5B7NA 1P4AA 3UBMA 2QG9A 5KNBD 3OU2A 3MK31 4BZWA 1C9MA 1YULA 2AUTA 3M34A 3CR7A 2QTAA 4M0KA 2OECA 4NDNE 1TUBB 3LT5A 3SXUA 2HL6A 4QWWA 4YT8A 4JLPA 4OHPA 4TWBA 4CL8A 2C0PA 1Z26A 4YA6A 5K5EA 4FINA 3HLTA 4W82A 4AX4A 4X84A 2FXVA 2GLTA 2YY6A 3EG9A 3GNTA 3OLVA 5IBRA 1FX0B 4CV3A 1X7XA 4HZUA 1KRWA 3BRWD 3CX4A 2FN8A 4BEBA 5AKEA 1P2SA 5G4KB 4D98A 1M1XB 1Y8QA 3H5RA 4RD3A 5F7OA 1XZDA 3RKSA 4BV8A 2ZJAA 3GJSA 3KZKA 1TM1E 1UZUA 2X2EA 4B31A 2W37A 1HT1E 4BMSA 3UKOA 3ZV6A 4DG9A 1GUAA 4PNHA 4A0GA 3EFOB 1QUEA 4P54A 2N46A 3RYTC 1TRHA 1XU9A 2H63A 1ST2A 3GROA 4LW8A 3NBFA 4N01A 4URHA 2YW2A 3COWA 1U65A 2HHLA 3JQRA 1P5JA 4MEJA 1GZHB 1JRLA 2ZTLA 2P7IA 4HTAA 5ENVA 2ENWA 2UZAA 1K2WA 1UDBA 4C0HA 1PEAA 2Z08A 1BCRA 2D0IA 3FSGD 1AGYA 4QSHA 1XCGB 1T8UA 2YWHA 3AEQB 3NONA 5TEWA 1N5DA 1SBTA 1TUEA 4NH0A 5HJ5A 1RWXA 1F0KA 1VOTA 3L4SO 3FROA 1CS4C 1CXZA 2VG8A 5M04A 1K86A 1QG4A 1ZH0A 2BGNA 3NFYA 4R8SA 2GAIA 4JZYA 4TRMA 4XFKA 3CNEA 4JKYA 4MUEA 1FPQA 1IYZA 3R6WA 5EEGA 3N2GA 4OH1A 2YN4A 4RK5A 1G6OA 3KOXA 4GKBA 4HWTA 2R6CA 4CTMA 5B6PA 1RQ7A 1J07A 2VF7A 5A7GA 1VRVA 4FYYA 2HA6A 1PZEA 1Q57A 3H1FA 3ODGA 3UW1A 4OAPA 5AXCA 2UUCB 1QV7A 1KEPA 3BUSA 5HKKD 3DPSA 3ZXYA 2PPLA 4R7GA 1NXOA 4I81A 1QP0A 1X1CA 1SKYE 3D1VA 4JNCA 4X8MA 3Q98A 4U6SA 3QVXA 4MUNA 5AKLA 4FFWA 1ADJA 3FHLA 3T3HA 4BBJA 2I4MA 2VQ3A 2X6RA 4PSUA 5CDYA 3ZNOA 4MHSA 2PUFA 3V1MA 2FK8A 4DV3B 1BU5A 1R6VA 2G9ZA 4ZYXA 4NCHA 1P4RA 3AI3A 3BQMB 3E2MA 1O0BA 3AVUA 1DKNA 5L45A 3E18A 1WVGA 4G1VA 4A1OA 4MCIA 4HFJA 4IJWA 3I1IA 3DG9A 2IH5A 3AXSA 1GGVA 1FP1D 2FZGA 1KJIA 2IIBA 4ZZ1A 3TPCA 1UC9A 1V2GA 2YMMA 1VJ0A 3PT5A 3TAHA 4QG7A 1Z0DA 2XDQA 4PXYA 4FR5A 2BGGA 1KXZA 5DWDA 5CBPA 2IPOA 1HZJA 3F49S 3MC1A 1I9CA 2O05A 4OQ4A 3Q3VA 2AG8A 4WINA 3EJWA 3QOXA 4E4RA 5JS6A 1E1YA 4G85A 3QPDA 3S8EA 4FHGA 3QX3A 4P7BA 2B4TO 2QLFA 4L9SA 4MI9A 2QWXA 1N34B 3IKMB 3LDHA 3OKFA 1DFIA 1Y8CA 4ZMBA 1ID8A 2IYLD 4W99A 2H1OA 5CNKA 3K5HA 4UM9B 5AVWA 3VTZA 1P0PA 2G8NA 1G9XA 1OWOA 1XFDA 2JBHA 2IYRA 3OQVA 4LYDA 4MK4A 5K3DA 4D9JA 2H3EA 3ASZA 3M70A 4DLYA 3BB4A 3M1IA 3OSZA 2CVOA 3K09C 3JWPA 2J9YB 4LYJA 2QT9A 4XGQA 3WS7A 4G84A 2VP0A 1QOQB 3MJSA 4MAAA 4W1PA 5FJIA 3L7BA 4LUCA 3E9NA 3B1VA 3HNOA 1M2KA 3NJRA 2ZT6A 4IZOA 4RYDA 3GJXC 5CG2A 1ZIPA 1U2SA 1FVOA 4H59A 2SICE 1RTTA 3S2YA 3G7SA 1DBSA 4JYCA 3PD1A 4K2AA 3VKUA 2YFYA 3EJ6A 2DPLA 3CB2A 3NBXX 2XHZA 5EZYA 3X1YA 2D2FA 3VKWA 4BNHA 4LC9A 4EOGA 3PGXA 1G4HA 5KB3A 2EYQA 3ZLJA 3CPSA 3DDZX 2A67A 4E21A 2FX3A 3L46A 4MVJF 3PYLA 1SQSA 1FCJA 4QYTA 3OCUA 3PPXA 2NU9A 4UUBA 1HDEA 3USCS 3W9YA 2VSOA 1F2VA 1GR0A 4J0JA 3NR2A 4L3OA 1M54A 1E6LA 1OIWA 5G1NA 2I3ZA 4PBTA 1VG8A 1Y42X 1T4DA 1QAMA 2V0CA 4E31A 1XYVA 3FWYA 1L7EA 4ED9A 1XMOB 2QTGA 1VB3A 4WESB 3TLEA 1SXJE 4EARA 2VJMA 2QPLA 3EHDA 4UMEA 4MKHA 1V48A 4M36A 1NBMA 1PFQA 3BSFA 2HA5A 4QOIA 2R6JA 5K1ZA 1ZIDA 2PPVA 5DI9A 1I9GA 4XVHA 5DYGA 3OCJA 5HIMA 1WXGA 2BMDA 2JLZA 1NJ2A 4RZIA 2HXGA 1IY0A 5BNWA 2Q0HA 4Q7KA 2HHHB 3JD3A 1XRPA 1JF8A 3RS0A 5BNZA 5IWCA 1ZKDA 2HRDA 5BOSA 3FCCA 4U7FA 4UAJA 3A6ZA 1AHPA 3U4QB 3LOQA 1JQEA 2HMYB 4B2YA 4GYYA 1RCTE 1QU3A 4OJMX 4R2LA 3WOVA 3ZX4A 2QQ5A 4AJ1A 4Z49A 1BS1A 5LIPA 3AESB 4I6EA 5EE9A 4LV6A 3UA4A 5T7BA 4B6SA 4ZAYA 4DV4B 3S1SA 3W6UA 1YZVA 4KITB 4RY0A 2WJPA 4F9TA 1ONNA 1KPGA 5K8IA 3C3WA 1AHHA 4Z2AA 3HKEA 4MS1A 4B33A 4N5LA 3PT9A 4LSMA 4WCVA 1GTL1 4TKZA 2XEDA 2B2NA 4HN2A 2QX9A 1M2OB 4J16A 1I0IA 3IAUA 2JHPA 2RGRA 4LRWA 2ZJ5A 2JIDA 4JYPA 1BZYA 2FFJA 2XRFA 2OHVA 2Z5FA 4HDSB 4W5JA 4D8VA 4EYEA 1T1SA 2Q49A 4R5MA 2AK3A 3RJMA 1S4QA 3WI7A 1HEYA 1DBWA 3ZLBA 4WNAB 4C7JA 5ALUA 2PUVA 3HABA 3I92A 4P38A 5JD6A 3VHXA 1BE6A 1U0BB 4C4YA 2EZTA 3OZBA 4IZIA 4E0BA 2WSIA 1OF1A 3C6XA 3DMDA 3IFSA 5FWYA 1JWBB 2RHLA 5KTRA 2V6FA 2ZGVA 2PZLA 3DFKA 3EUAA 3NH6A 3P32A 1QDEA 3QKSA 3K8ZA 1HMPA 1REQB 2IUUA 3TEMA 4OBBA 4DLBA 1Y33E 5HW0A 2H65A 4N3CA 2GJSA 1PNRA 3V4SA 3V8PA 3BWVA 1K68A 1P18A 1CNFA 1H2HA 1ZOIA 2AE1A 2QRVB 4LZNA 5CYGA 2DOKA 3CT6A 1HDIA 4URFA 1G20B 1N2OA 4KRXA 3Q3IA 3WWDA 3H8JA 4QNRA 1HNZB 1FQJA 4B81A 1NHGA 2YOFA 3GVXA 4FHCA 4PZAA 2WFZA 2X40A 3TRHA 4DMMA 2A7QA 3V1KA 4D56A 1Z6PA 2HJ9A 2PNJA 1XSEA 3ZHZA 2ACWA 4I1SA 3H9JA 3GHHA 3VGJA 4L51A 1KP3A 4KLAA 5BWOA 3EB9A 4HP8A 3OT1B 5FFFA 1K7XB 1IVNA 2CVZA 2RGEA 4F56A 1ZVJA 2Z3WA 2HMAA 3LBIA 4PNZA 4KPFC 2IOHA 4DQUA 3OUZA 4HDNB 5FRDA 2AFIB 5K4HA 1QB8A 4KSCA 4EL5A 1E0AA 2FG7C 4D9FA 1ENOA 1F2UB 2R47A 2NU8A 2GPBA 2QN7A 4XJTA 1K7FB 3ZJYA 3EBLA 2H0RA 4Q4JB 2HLDD 1E60A 3K5WA 3MB8A 5H02A 1SU7A 3VYSB 3WJ1A 2CNLA 4F6LA 4BNDA 2RMKA 2KLBA 4C0KA 4NYIQ 5JTUA 1PZNA 3OFNA 4LOAA 4YP6A 5A0VA 5HM8A 3DL7A 1BQ3A 1E32A 3NIWA 3ZDZB 2FZ5A 3LFHA 3MWLA 2PX8A 4FYMA 1WW2A 3HKDB 5AJXA 3UFXB 4RACA 3GARA 2NUBA 2FWPA 2G9RA 4ZOEA 2IDMA 4DCUA 5C80A 1GTVA 2PSDA 4K40A 1E6WA 1O5OA 3PPIA 1VZ3A 2WF6A 1J8QA 3LYUA 2VEOA 3P0IA 5EHGA 3WP1B 1PSDA 5CIQA 2P2ZA 2C2YA 2ZYWX 4NMXB 4CQMB 2C7QA 2A9VA 3IUPA 4B6GA 2ZITA 3RU7A 3AM1A 1G6Q1 1ZIXA 2PL5A 4JJ6A 4NP6A 2QX6A 3CYFA 4QYIA 4IJ5A 4ISCA 1J4AA 2IUSA 5AJVB 3PGKA 4U3JB 1PR5A 3KHUA 4BGEA 4URVR 4A2QA 1O9HA 2F3RA 4QLBA 2QRZA 1RQLA 2VPTA 1NSTA 3ZDXB 4B0OA 3P0HA 4PSAA 4FPXA 1BWSA 1QK3A 3AONB 4BRZA 4BXOB 5IDXA 4X65B 1G1MA 1E7SA 4HFRA 1ZRHA 3E4DA 5FPPA 3EZFA 1PR2A 3ILYA 2YVAA 4L6IA 3Q87B 1YS6A 2JEOA 4F84A 2AXQA 3PWTA 1XDZA 3GF4A 2ZXEA 4RD4A 4C7OB 3FOAA 4X1IB 1NBEA 5IX8A 2PLWA 1X9GA 3MJFA 2Y1OA 3QTLA 5DLPA 1O0SA 1ESNA 3ZGXA 3OIYA 4AC9A 4BV3A 2IEIA 3VYUB 4NYMQ 4P3XA 4BVFA 4DCSA 1EHCA 2IUYA 3OCZA 3B9BA 3MCAA 4RAQA 5BUSA 3E3NA 2QPOA 4LJKA 3WMEA 1OYVA 3DFMA 2WKWA 5JFOA 2C8VA 4FKZA 5LL6P 3NBAA 2G25A 4CFYA 1OAKA 2XKKA 1SVLA 4WECA 2Y1WA 2XUAA 1GY8A 4JT2A 3IEMA 1ZBQA 2HEIA 2JJ8A 1MAAA 3OFVA 2MMCA 2WYWA 4JEIA 2DH5A 2EIHA 3BJEA 4JP5A 4QBHA 1H5UA 3M0EA 3MVEA 1A88A 2C5EA 1AGNA 1G16A 2CMGA 3IAM1 4PONA 5FOTA 2KI5A 1VPDA 2UKDA 2XTAA 4GW3A 2DWUA 2BLLA 2WFAA 5I7WA 3R44A 2DERA 2OY0A 5KYNA 3A6FA 5BR1A 1U6KA 2QAGA 1IEVA 1ZOOA 3VR6A 3STUA 4DV5B 3X1KA 1WSDA 1XMVA 1QHGA 2JCYA 1CRQA 2WYVA 3P2IA 3K5PA 5JW6A 1ORTA 2H1LA 3MQFA 3G9TA 4J3JA 3V8MA 2OUKA 2ODWA 4B76A 3PGLA 5KQMA 1HL3A 2SKCA 3EGXB 2JI7A 4PC3A 1WSAA 5FTWA 1L1FA 4NS1A 3KOWA 3OLXA 1Y6JA 3GUYA 3VJMA 2J3JA 1ZOPA 3A2NA 4XGIA 2ZJFA 4JBHA 2BEUB 1XZMA 4E13A 2Q5CA 1WRBA 3L8FA 3WB9A 3QV1A 2JJ2A 3TGPA 1F60A 2Z4SA 3FVTA 2J6CA 2GASA 2C4VA 2HJWA 2PWPA 1URPA 2W2TA 4MVJM 5F73A 1P39A 1Z5OA 3RS8A 4JUFA 4AS2A 1K66A 4HJRA 2BDUA 4J4TA 2C57A 2LCQA 2FMXA 4ID9A 1KDPA 3OI7A 1IEXA 4IO0A 2VPWA 4B8ZA 3BJIC 3B1JA 3EY9A 2VF4X 1KDYA 1UR5A 2C31A 5C18A 1H0RA 3ZE0B 1E61A 3ENWA 2XZPA 1W34A 3VR5H 4PV7A 5ARCA 5D7NA 2XXJA 4C7XA 1T3TA 1P77A 3A4TA 3CEPB 3MINB 3ZG6A 3H7IA 3GGPA 5H3CA 4E2ZA 3FKQA 1CJVC 3LVFO 5ULLA 4E4TA 1Y37A 3OQMA 3R9WA 5B3JC 1DQYA 5EUMA 3RIXA 4YXWD 3LFUA 4HXGA 3PNYA 3ESXA 4R7TA 5GONB 1OLXA 4EHIA 3X1MA 4AXBA 3I83A 1Z5NA 3O8BA 1J1UA 2VSNA 1C3VA 3DSRA 3WYCA 3ECSA 3OZWA 3ONDA 3PX2A 2O2DA 3HWRA 2BC9A 3HVJA 4Z7QB 4CEIB 5IMBA 4JP8A 1PAUA 4JBLA 4V0ME 5A3SA 2E4ZA 4BU0A 4DMUB 1U8AA 3W78A 2GQ0A 2P4SA 1TZBA 1QQ5A 2UDPA 3FIUA 4V39A 3UAWA 1VHQA 4L4XA 2P90A 2WUGA 3MCUA 2BHTA 5JU6A 2GCGA 4DG5A 1E8DA 2G7ZA 4G0OA 4BQOA 3IXQA 1JLSA 1Q12A 3HCPA 4MO2A 4RY8A 3W2TA 2CCGA 5AJHA 2AJBA 3HBAA 3WB0A 4ZO9A 4KR9A 2JLCA 3QKTA 2CLEB 1D4ZA 1SVIA 2A1UB 3W6ZA 1FYVA 1TQHA 4H0FA 3K0SA 4B3MB 4UDYX 5TS2A 3A3OA 2CYAA 5IARA 5JMTA 1J1ZA 3ETJA 3G2QA 3D8TA 3WGUA 4EY8A 3V4RA 1NY6A 3VPBA 3VXKA 2JK0A 1MRSA 4C4ZA 5KOHB 4JI8B 4D9IA 4LZJA 1NJFA 1XDUA 3HXOA 2CUKA 3UY4A 5FUBA 1O4VA 4IF4A 1NVBA 2WWWA 4BLOA 2XCQA 2PA0A 3AR2A 2A9QA 1XLTA 1FMCA 3GAFA 4FCVA 1BKSB 1WXHA 1H9AA 3E22B 4ND6A 4TV8F 5U4QA 2LIVA 3P2YA 2OFOA 1CUSA 4J0EA 3RWBA 3HP1A 4UHCA 3F8SA 3ZDBA 1CUFA 4FE3A 4MA5A 3MCWA 4GICA 1DQNA 1LGYA 2QRNA 4RETA 4CCSA 2DBZA 2P3QA 3NHFA 3BB3A 3KL4A 2ZB7A 3FR7A 2B8EA 4ENTA 2BHSA 1EXDA 2C3OA 2YJGA 2DP4E 1TTHA 3N7UA 1TTQB 3GLTA 2HTEA 3HSYA 5EIBD 3O8DA 3JS5A 5EKSA 2DQZA 1RHRA 1KORA 2DTXA 2V7QD 1KU6A 1JEDA 4AZ3B 4DV6B 2YVLA 3W5DA 4YQZA 2VDNB 1FDVA 1GZSA 4KXLA 4U7GA 1GN8A 3KYCB 1NF8A 3NUGA 1UC8A 3ZZ1A 5JH7A 2W6PA 3ACDA 2PUAA 4LF9B 2H2FA 3N5CA 1G18A 4M1YA 5G0UA 4MO9A 4BX3A 1JQDA 3M1AA 4C7KA 2Z58A 1SQFA 4AZTA 1GUFA 4ZVNA 1UDWA 3NWBA 3QUBA 3TQFA 1ISSA 1M7HA 1QIIA 3O94A 4K1XA 4JT4A 3EWSA 3GQBA 3EZNA 4LY3A 3WLAA 4CL3A 4R84A 4G65A 5IAJA 3SMVA 3ZVKA 4QTZA 4BAGA 4R51A 3QKRB 4RE6A 2J4DA 4KAAA 2IY9A 4LMAA 4NS4A 1UK8A 3ORYA 1CC1S 2ZUVA 2R7MA 2I71A 3VR0A 1HK7A 3O4VA 3QE3A 1EIZA 2CY0A 3AG5A 1W36B 2OP0A 4CMJA 3DAFA 5IH3A 2D59A 3EQ7A 2VPIA 3E82A 2DPMA 2X1LA 5FUMA 1O95D 2R6FA 1WMEA 3N6VA 1MB2A 5FUYA 4NNJA 2Z2KA 3S68A 3IDFA 2IBMA 2EWVA 2PGIA 2WJ3A 3BCHA 2ZSHA 4OHOA 3EXHB 4KI7A 2C88A 1GA6A 1A5TA 2FWNA 5LKRA 4K9RA 1V4NA 5D3ZA 1ISIA 3RJ9A 3TL6A 5TGZA 3WBJA 1NI4A 3I04M 1ETHA 3WJ2A 3GLSA 2IXAA 3LUHA 4Z4HA 5DGXA 2NO6A 4HUQB 4PTLA 3KOOA 5BWBA 4HRXA 3ZWOA 2VRBA 4N8DA 4Y0NA 2VK8A 2ZUBA 1SRRA 4EHHA 1JR4A 3WYFA 3Q85A 3LX8A 4LQ4A 2WU1A 1T0BA 3K6RA 1CY2A 3DP9A 4GZ5A 2X0JA 5JYBA 3MTBA 3O8OA 1Z39A 1JN0A 5REQB 3TQCA 4YRCA 5A3VA 2GRJA 2ZAOA 3L43A 3L7YA 4MWSA 2ST1A 1VHWA 4B8WA 2E7ZA 3OFKA 2JGDB 1RMQA 1MXHA 3C70A 3L18A 1Z34A 5C31A 3KJGA 3OEEA 1PS8A 2AEMA 4QDJA 4IDCA 4NONA 2ZDGA 1ABFA 2BRUA 2HCBA 5SY9A 4QJ3A 2O2CA 5KDOA 1A8UA 5EKXA 1FF9A 2DMRA 4R98A 1JTFA 5H4GA 2K7FA 2O8BA 3NANA 1QGAA 4EO4A 1QYVA 4C1BA 3AOEA 4P5DA 2VXCA 3TCNA 3ZXSA 2NG1A 4ZMRA 2YV4A 2QTZA 5DNWA 1ZM3A 3A1FA 3L0BA 5IJAA 3DDHA 4B7AA 1YACA 2P30A 3PC4A 4L22A 2VN8A 4TL6A 2FN3A 2NNLD 1PQPA 4J29A 3WIBA 2UUBB 1LI7A 1WDWB 1HFEL 3RTGA 2FSHA 3VU1A 1B0ZA 3PFHA 1YR2A 2QUAA 5TPZA 2DHEA 1ZGBA 1CS0B 1RWBA 3CKMA 2OBXA 2NP7A 2GNOA 2HCRA 4QEZA 1DX4A 1JG6A 1TZMA 3STWA 2NSHA 2ZAMA 3G49A 4MKIA 3BREA 3G8AA 5K20A 4YFVA 4WERA 4KEAA 5K0CA 5LUAA 3SC6A 4NIMA 4G5FA 3WQSB 1O0CA 5IEJA 1UZAA 1K3FA 2P67A 3CUVA 1UDCA 3OLYA 1F8YA 6YASA 7ABPA 4JXJA 3EVFA 5CA1B 3IQWA 1RLTA 3VNBA 2W2LD 2AMFA 4XJVA 1TQ8A 1EFTA 1COZA 3S81A 3LNCA 1IHOA 1SG6A 4RVFA 2IE8A 2WINI 4P83A 4ZT6A 1WLYA 1O96B 1XVTA 1N2SA 4E5DA 2XWQA 1LDNA 2ZRHA 4H7EA 4QRDA 5AI6A 5F1YA 1U90A 3ON5A 5C32A 3QHPA 3JQFC 3UXHA 4A0SA 5A2QA 3TK1A 4CM8A 1N2ZA 5HBRA 3N05A 3V8NA 3W4IA 4RTLA 3AHDA 5HBGA 5K8JB 2IBTA 2VHXA 3ND5A 1MUUA 4UJ5A 1JT2A 5FJJA 4ZA2A 3EBPA 3L05A 4CHTA 2HK7A 4H7JA 1XX6A 2ODEA 3VR1A 2X0RA 4ZEWA 4S12A 3RRZA 1YE3A 4DCOA 4YGYA 2IYVA 2WUWE 4UTOA 5DNEA 2LBPA 1DC6A 2EW1A 3KFVA 4FWBA 5GAJA 1NUHA 4RYLA 1OI3A 2Y1FA 3GRFA 3AC0A 3EIEA 2AT1A 5AK4A 5EXSA 3IKJA 2CW5A 5ABPA 5AVQA 2HXYA 1BFUA 1LZLA 1IN4A 5DGDA 4Q37A 2WYIA 3ZWNA 1GGMA 1ZESA 3R8XA 3UV6A 1E8NA 1K8XB 2H08A 3AOGA 4IILA 2VQEB 1HOXA 1YU9A 1BO6A 2ZRDA 3ED1A 4LRUA 3T7JA 5BR7A 5LZ9A 1LK7A 2P2DA 4PM4A 1DI0A 4I4LA 1ZHFA 3QI2A 3B1FA 4P5PA 5G02A 3S2FA 1ORVA 1R8SA 1UK9A 2KB0A 3IVXA 4H31A 1O54A 1W5FA 4XPIA 4ZOQI 4GVLA 3PQ3A 5CB6A 1EFRA 2QV7A 3F4KA 4L8GA 5HIJA 5FP0A 2ZDHA 4MTLA 2QGNA 3LW7A 1XCBA 3EXAA 4JJZA 1BKDR 1T9DA 1P2GA 2AI3A 1G41A 3T52A 3MT0A 5JXWA 3N0VA 2IEAA 2HSWA 5BSKA 1UT5A 4PC6A 3TNLA 2PK3A 1X80A 2PBRA 4DARA 5EC8A 1GR1A 2V3CC 3OF5A 1RAGA 1CERA 1JS1X 5IT4A 1X92A 1WMFA 4AMZA 1R6UA 3C15C 3C6KA 3QWAA 3TFQA 1E3TA 4F4CA 2BSQA 1IZZA 1PNTA 5JROA 2JAUA 2Y2UA 3DTVD 2R7KA 5B2FA 1PF7E 4M7PA 2XQKA 3ISJA 1GPDG 4HGRA 2BBTA 1NVFA 3OO1A 2P65A 2QB5A 1AXEA 3D3KA 3DXZA 2I9PA 5DXJA 3MHPA 2DB3A 5KYUB 3NLLA 2C59A 3OJEA 1RU3A 4ZO7A 3PQCA 3CVWA 3ZHOA 4PYOA 2GEFA 2CZCA 4XQGA 3UHFA 1OFIA 2DSTA 4I5DA 2PS3A 2X77A 2I5PO 4LHVA 4Y9RA 4BWGA 3EMKA 2WC1A 6PFKA 2YWFA 3N8GA 3WHKA 4RQUA 5K0TA 2R8BA 1KH2A 4ZYZA 4OQYA 4V02A 1P1RA 1OIXA 1E6EA 2ZJ8A 2LZ0A 4NBTA 2O2SA 1RCFA 3HGQA 4L07A 3J81k 5ALZA 3MLAA 5TGDA 2R8ZA 4YLEA 1MO5A 5IU6A 1CETA 1ND5A 3KTOA 5FQNA 5J4LA 2D1SA 5LJLA 5BN4B 2PJUA 3WGQA 4DDKA 3K1JA 4TMVA 4WXMA 1W0JA 2ZSIA 5DLDA 4UNIA 3G2NA 4MIYA 4F8JA 2I7VA 2W6JD 3JALB 1KAOA 4DR7B 1QTQA 5BT8A 3W9SA 3DLBA 2A3NA 1EUDA 4FE7A 2ZB3A 2ZWPA 3MCZA 1E5DA 1IB0A 4C89A 1LY1A 2YJZA 2BR3A 3FHCB 2QX8A 4MQUA 2RHOA 3LRXA 2H1HA 3I1FA 1JJBA 1DMSA 3P5BA 4G8BA 4DTCA 3W5IA 3BMOA 3NNSA 4MMXB 1C1XA 1OR8A 2LP4Y 3NC4A 3ONVA 2K6GA 1WDKA 1BMFA 5AKKA 3WL7A 5ADUS 4DR4B 4U7HA 1JU4A 4MPDA 4KPUB 4U6NA 4CR8A 1XBTA 4HRYA 3EZ6A 1Z74A 4N82A 4M1MA 4FFVA 5K3BA 3AP3A 5A1JA 3CVJA 1E9DA 4QPZA 1KXJA 4IGIA 1W36C 3WP0A 5DX1A 3ROEA 2O54A 3CZ5A 1E7MA 4JLMA 4MPTA 1TJ3A 3H6KA 1WTCA 4US2R 2IZOA 3OHMA 1NYLA 3JCZA 2IOQA 3GVCA 1YAJA 3JVEA 3G02A 1KC3A 4LK2A 4AO7A 2NYAA 3BGIA 4I9NA 4BCCA 2O2JA 1IBLB 4CJXA 3EXHC 3MWDA 4N47A 1C29B 5I7OA 1EDOA 4H1TA 4K9MA 2VDUE 3HDQA 2FPIB 2FPMA 3GLQA 5KTNA 1E1DA 4CVNA 2HA3A 3FI9A 5IKPA 1LF0A 5AVZA 4MWOA 1QGUA 2Q99A 5C0OE 5JFTA 1MH1A 4LYEA 2W00A 2AZTA 1PWYE 1O6FA 3DEZA 3QQ5A 4RY2A 4Y2GA 4ZJPA 3WAJA 1C9EA 2MINB 4ZFNA 1UAGA 4UPEA 5BSRA 2GPSA 1D9XA 4KQ6A 3ODPA 1NBHA 2DBRA 2PD4A 1SVWA 3FLMA 4U9IS 4P0QB 1N2EA 3QX8A 2XYQA 4NCAA 2ZPUA 1LB1B 4BMYA 4WCDA 3TYXA 3P2OA 3B13B 4DCPA 4ZCRA 1YUBA 5ER6A 5T67A 2HM7A 3M3PA 2E9SA 1KY3A 2A94A 1U0TA 2PYDA 5EIAA 3NH9A 3MPOA 3UT0A 4N54A 1RQXA 3VYWA 3B3JA 1A9XA 1YKFA 5CFQA 1GFWA 2NO5A 1PNOA 1WO8A 1GCGA 3C97A 4HQNA 4IDDA 2PBFA 1SRQA 1DWUA 1XWWA 3FPAA 3OOJA 4C4SA 2RJ3A 4LXIA 1J90A 2WP0A 4IAOA 4A26A 2XY4A 1GP2A 1RLOA 1RLMA 3LT2A 4J0QA 3IT2A 2PHZA 2I7XA 4IIBA 5FULA 1Z5ZA 1ZZGA 5HUHA 5MN4A 5A0TA 5EZSA 3GZTB 4R71A 2YZ7A 4F06A 2OLKA 1LF5A 1Z68A 3BXEA 1UDXA 1ZNQO 2J59A 1Q2UA 2V7WA 4P7FA 4P2BA 3GUHA 2RIPA 3I45A 2Y0DA 2XA9A 4BGUA 4GOLD 4DRZA 2BFAA 3IDAA 1P9NA 2EAUA 2QLBA 3WLIA 4XVCA 4GP9A 1JEEA 1I3MA 1B43A 1KP2A 2YNMD 4G24A 1X7YA 2YVQA 5BWCA 2PQ6A 2X58A 4YCBA 4DQXA 3JASB 2P9YA 4EFMA 3CZCA 3KU4A 1E2NA 1U1FA 2QZ9A 3THYB 4IVNA 3RHSA 1YIOA 2GPAA 2GPWA 3OPYB 4ZDJA 2VLIA 2OOSA 4MWBA 1K3UB 4PZ9A 2BGWA 3MILA 4RH3A 4C0SA 5LWQA 5G53C 4ND1A 5LQMA 2BGJA 5DWQA 1S8OA 3OUUA 4MLCA 1XTRA 2OOKA 3ZU4A 3OD5A 4KDFA 3DNFA 1W59A 4MDHA 4B82A 2Z6AA 3ETCA 1E9VA 4KTTE 4AJIA 1EH5A 1ORWA 3TUJC 5FEUA 2J6HA 2XVMA 3KDSE 4GU5A 4P92A 4PNPA 4TUYB 1UQTA 2QYSA 5IKMA 3WNZA 2GCOB 1PWHA 4Y9SA 1A71A 1EK2A 1H8HA 2R2AA 1IK6A 1OREA 4JBNA 4XYBA 2A6PA 3HHPA 3KNZA 1D1PA 2FDRA 2Q3CA 4MICA 4F8EA 3KKMA 1XEFA 4M88A 4JUAA 3NV9A 5B57C 4A6XA 1H9CA 1R5NA 1M72A 3NG1A 4YGXB 4W8GA 2H31A 2MYUA 2PU5A 1QV9A 3OZEA 4DY6A 5GV8A 1MMFB 2GS9A 3SHOA 1W0KA 4XD7A 3RO7A 3JAKB 3TS1A 1QHSA 5C7YA 1P72A 1K6IA 1TVEA 1MJGM 5CVUA 4MKRA 4AI6A 3BGDA 3GXOA 1XL0A 2GD1O 2HGSA 3N0XA 4QFBA 5I8WA 5IULC 4BFWA 4L4UA 5IC4A 4YACA 4GX5A 4ZXPA 1C4KA 4CR7A 1C80A 4FDAA 1CULC 1DCKA 3HXPA 3OHSX 2G36A 3HG7A 4BFCA 4EDFA 2QLLA 4FHFA 1P9LA 1ZCFA 4QUDA 3R5FA 1IMOA 2B98A 1Y1KE 2ODNA 3NFRA 4W8HA 3RYIB 3TQRA 4D5GA 1E98A 3TLKA 2G9UA 4QXAA 3N8IA 2Y71A 1E0SA 1KI1A 4HAYA 4JQYA 3G0CA 1XZFA 3IIJA 5DBIA 3RIMA 3UT5A 4E2YA 3MGAA 4IXMA 3SNHA 2CLKB 3DVAA 2EBUA 3K9NA 4TTAA 4YASA 3K1AA 3SHVA 5LQUA 4E3WA 1UQRA 1CY8A 2OCLA 2P5SA 4E14A 2R65A 3DYVA 4D6YA 1LLFA 2P3SA 2VK4A 1RI5A 2NQ8A 3KJIA 4B0PA 2VTBB 1AQ6A 1BD3A 2EL9A 1BHJA 2FH5B 2KBFA 5A4MS 5A5GA 1OD6A 5LP1A 1Q7TA 1J09A 3OCYA 1P2BA 4B9EA 5ALRA 1DG3A 4MRRA 3G1WA 1NQAO 3VA7A 1XCJA 2R4UA 4OQZA 5FAKA 3DOOA 4KNYA 1EE1A 4L15A 1V41E 2AFHB 4R3NA 1WZUA 4P8RA 2EKLA 4UE6A 5EYPA 3VH4A 5JHHB 1A9QA 4BVBA 5BQ3A 1UBNA 3A1EA 4H7DA 1YBHA 1FYWA 2FN7A 1XZQA 2B36A 4PHCA 2ENUA 4CCYB 1GO2A 5BNTA 3KR0A 3CSDA 2OORC 3AF1A 4FYWA 3RAEC 2PXXA 3TW8A 1MIOB 2M6KA 2F00A 4FYIA 5JPCA 1RR6A 1KTIA 2CD7A 3A9WA 3RK1A 1FYXA 3WK6A 1EVJA 2G88A 1NVAA 5F52A 2I62A 5BO5A 3SZLA 3WL3A 1OTHA 1ITZA 2R44A 2P6UA 2IYZA 1XO1A 1SXIA 4M0MA 2EG5A 1GV1A 1K4KA 1NURA 4RKQA 2P9EA 4KB5A 2GK4A 4DG8A 4ZI7A 8OHMA 1Z0AA 1ZFNA 3FTDA 4WK0B 1IY8A 3GJ7A 1WG8A 2CLFB 3DL2A 4HLNA 4L5IA 3KKQA 3U2QA 1R5OA 1QIHA 2FEWB 5CP8A 5ERGB 1KAMA 3I4LA 4WK4B 3U4IA 3WSWA 2JI4A 2YBEA 5BN5B 4MYHA 2FW8A 4R16A 1RZVA 2FWMX 2WW8A 2ZQZA 3D0QA 5B55A 3DMPA 3MWEA 2CLOB 1YR1A 2C94A 3GCZA 3VI4B 1J20A 2MIIA 4KWCA 4I36A 4EK9A 3TSZA 5AUOB 1W52X 2CBZA 2WMDA 5TS3A 4EY7A 3G5UA 3VBEA 3WHPA 1A7AA 1WP4A 4OYLA 3O3OB 1KJJA 4IIJF 1Q3KA 3OTHA 2Q5HA 3ZDDA 1X15A 1USIA 4N8SA 1BNCA 1YQWA 1UWCA 4F11A 3Q7EA 2C96A 5JQGF 2WEKA 1U7DA 1XR3A 2REOA 4GS5A 4ZPXA 4J6EA 1HKUA 2WUFA 1SZDA 1VIYA 2AZ4A 1UM8A 1TAHA 2CHUA 2YWGA 4G6ZA 3UJPA 4F4HA 1AK9A 1X8JA 4M6WB 1YZLA 1J0XO 2QL6A 1VG0B 4PHGA 3TLMA 3WO0A 5EMHA 1TMOA 1RFGE 2JEYA 1PW7A 4J2OA 4NSNA 4DNQA 3W3AA 4L8VA 1W4BA 2BFCA 3T5MA 3AF2A 3GB9A 4YDSA 3EX7C 5DGCA 2BUBA 2WZQA 1U3VA 1MN6A 2J41A 2YH2A 3A27A 3VZBA 5KWJA 3AIIA 4DJJA 3QXXA 1Q19A 2OCAA 3U44A 4GE0A 4BMDA 1SQ0A 4TWJA 4GLJA 3TD9A 2P69A 1R00A 4LK3A 5IH7A 3LZ6A 2CVHA 4XXHA 4TZKA 2ZE8A 3LZDA 5KEIA 2PLFA 1XZCA 1T3ZA 4KMSA 3BYZA 3HV2A 3RSCA 4QREA 4TMFA 3RRBA 4CGZA 2E48A 5IHXA 5DH9A 3ZW9A 4U5QA 1RRGA 1SY7A 3A28A 3N2KB 2GSWA 4J0CA 4GR9A 3T9DA 3O4GA 2H9IA 2NZYA 5NULA 1E7YA 3L5KA 5CCEA 4PPNA 2E4WA 1PYGA 2EKDA 2Q3BA 3FPLA 1AKWA 2XA2A 3A0UA 3V7UA 2QU8A 2Z0MA 2VQDA 4DNFA 4WY5A 1UMDA 1T2AA 1QRSA 4AIIA 4H18A 2FAXA 4IEIA 4QEKA 3RTBA 5CDUA 2KM1A 3LHSA 5LA6B 3WMGA 3ABOB 1W6RA 1RCUA 5HSGA 3NVDA 2JCXA 3HRKA 3PGVA 3QVJA 4FQ5A 2ZRQA 1TXGA 3BBPA 3IRVA 4MV6A 4Q02A 5LYJB 3I5YA 5EIBC 4UVHA 2JZCA 1UDAA 1W75A 1N2BA 2Q9AA 1BGVA 3VC2A 5I7UA 3AUAA 2V6MA 2OWEA 2V3WA 3G5AA 3MBIA 1TLLA 3NTQA 4JMLA 4GPTA 4EUFA 1RM4A 2LGJA 4HDMA 2ZRLA 1XOIA 4OBXA 4PQFA 3NDIA 2L82A 4RVGA 4U2FA 3OQIA 5BVHA 1KI2A 1ZOSA 5KX5A 2YHIB 2HX1A 2O1EA 1D03A 4WZBE 4QDKA 3F6YA 2XOKD 3PUVA 3FMIA 4CIWA 2QBYB 3UAYA 4Q4AA 3UUWA 3KQQA 3GFTA 3HXTA 3RB8A 1E9FA 1R0WA 1TPYA 1Y3DE 3ZY3A 1E7RA 3SE7A 1UOQA 2A0FA 4EA9A 1X13A 3RREA 1CZUA 1XZIA 2HJVA 2QRUA 2R7LA 5DEIA 4J9VA 4DLLA 3GDGA 3N8DA 2Q4DA 3CG0A 4KIJA 4CM4A 2IS2A 4JP2A 3LCVB 4OUDA 1HG1A 3G8BA 2HF8A 1YBAA 4C4TA 3CR3C 3ZHCA 2XNKA 1ZCZA 2VK2A 2RHJA 3V46A 3OF2A 4BJ3A 3ZDCA 3CWZA 4RS4A 5DSXA 3ROTA 3D1JA 1B16A 3DWIA 1QOPB 3H1TA 1JFVA 1WB5A 3GEIA 3NHJA 1R0SA 2CC2A 2QQFA 3D6HA 4XW2A 2UYYA 3GLGB 5C8DA 1QHFA 4A36A 2XF2A 4L8FA 3EQZA 4X1KA 1QVZA 1VKNA 3FUTA 2HA0A 3G0IA 4EUSA 4DRXA 2YXNA 2BF4A 1UMKA 4I7EA 4LHXA 3MB5A 4Q7LA 2CL0X 3A4NA 4RM2A 3RC7A 1LVUA 1CDEA 2QTMA 1J0BA 1NA5A 5J59A 6REQA 2Z3VA 1E1CB 3TW0A 2BFBB 1NW6A 4L6AA 2HQRA 2OE2A 5JS2A 3FRIA 2UVDA 3QJGA 2P1RA 4D9CA 4EPYA 4QOJA 5JJ5A 4C2AA 3DR5A 2JD0A 1HZZA 2NZ8A 2NUPA 3NHWA 5DW3A 1JG2A 1U2PA 4MJ7A 5KIAA 4U9HS 3CH4B 4MW0A 3GLFB 3UG6A 3IE0A 4PSKA 2GF0A 3BXPA 4JQZA 1R15A 3JQ7B 2ZYIA 1PR3A 4Y2SA 3L7NA 1WB6A 3VVLA 1I5OA 1D6JA 1V5GA 3BTSA 5ITZA 1N0WA 3C5HA 1RHJA 3W9BA 3KAPA 4AXXA 1U3DA 4MS4A 4IS2A 1E3QA 2BMVA 4KI0A 3ZK8A 1GDDA 1LPOA 4FQ7A 1IN5A 1R0RE 2E6UX 2YVUA 3CZ4A 3R0JA 3R3YA 3ZDEA 1UPTA 2R1VA 7GPBA 4PR3A 3CX6A 1Z8FA 3I09A 2QENA 4KO8A 2D4HA 3JQGB 2PX0A 5A6SB 1OXKB 4YUXA 2JBAB 4QA9A 4FYJA 1WF6A 4QQFA 4Q9HA 5KKNB 3ZVRA 1TVKB 4H4CA 4KN8A 4MGIR 3G7UA 2WUVA 4WZ6A 4ZVPA 2VP5A 3LBHA 2RB5A 3WWZA 4IICA 3TEFA 4AKEA 4INPA 3N74A 4G2TA 1ZMXA 3GA5A 4Y18A 1KBZA 1W85B 2IW1A 2II6A 1IEQA 3B7WA 2LXNA 4C1NA 3GEMA 3VU9B 1OOEA 1GNQA 1N75A 1XV5A 3QFRA 1ZIYA 4LFBB 1O1YA 4B6QA 2PVSA 2OC9A 2BV3A 2G17A 4OH7A 3OOSA 4E46A 4EHJA 3B78A 3FPCA 1TEHA 4KR6A 2H29A 1BIFA 3BZUA 1M1YE 2XTMA 2GKSA 2FX2A 2OYSA 2C2OA 3PC7A 4MUAA 1EB9A 3C45A 2FZCA 1INLA 1SUCA 4Q9KA 3AEXA 3O1HB 5FL3A 1IUPA 1R9NA 1KFBB 4E2WA 5KMGA 2JLXA 2FQYA 1IJKA 1V3VA 2W2KB 3EXG2 3KLPX 2UZ1B 2XV1A 3DT8A 3OJFA 1BMDA 2VHVA 1ZITA 1MCZA 3P97A 1G291 1QG0A 3PLRA 1JG1A 3ROFA 3C1UA 1P1BA 4G5QA 1M6EX 4QASA 3GPCA 1WXDA 4DA8A 3N59A 4M9QA 5I48A 1QO7A 4W5OA 1OAOC 1T2FA 1WHTA 4OHRA 1DL5A 1YJ8A 4MRPA 1G2IA 4P3KA 2RGDA 3CX8A 1J0AA 1QGED 1ECCA 3PICA 4HK4A 5B37A 3GGSA 1D1SA 1OBOA 2ADMA 1H2EA 1TYBE 3WWOA 5L8VA 3WFZA 1MO4A 1JBKA 4IDFA 1CY6A 3QK7A 4RA9A 1A72A 5AW9A 2IP2A 2BKAA 3PC6A 4PCVA 3O4IA 4YMSA 3CJQA 1ZD8A 2O7SA 3A2MA 4I8DA 4N6NA 4NZ9A 5AOVA 2G0TA 1JALA 1ENPA 4PLVA 3L6UA 5F64A 2ZM6B 1E4OA 3A2KA 2Q8NA 1LDEA 4JL5A 2O6LA 1LS6A 3DBLA 5DNAA 4ZT2A 1IIRA 4JQCA 4OA5A 5JNVA 1ZI8A 2OV8A 5E38A 1S3FA 3HL0A 4Q00A 3W8FA 4IQFA 3U7QB 1FRFS 1QTRA 1HNXB 4LF5B 3CRZA 2FWBA 3H5OA 2BYTA 3AUSA 1MOQA 3D1LA 4XSVA 1KQPA 3CR8A 4DWJA 3RLIA 3KT0A 5NLLA 1IN8A 3U5TA 4XQCA 3M9XA 3BGVA 4CIXA 3EVTA 4G1UC 1T8RA 4X7PA 4AG5A 1FSPA 2FPPA 3QFTA 1Z0ZA 5C7IO 4HFNA 4FE4A 3LX5A 2WA2A 4JBGA 4LWZA 4RBNA 5LP6B 1C30B 3PFCA 1CEQA 2JH3A 4X91A 3CNQS 4QARA 3QFCA 3HUTA 4XDHA 3BHMA 4J90A 4ECAA 1YJAA 4I19A 3MELA 1Z5GA 1GCAA 5IXYA 3VNVA 4YTEA 3JYLA 2R1UA 3L8DA 3S29A 4LA4A 2QM3A 2YXEA 2B2XA 4HMOA 1JJAA 2IX9A 1ZD4A 3OE7A 4NV3A 4BQEA 5JMOA 1I8TA 2C3YA 1KK3A 3C1AA 3OQBA 1YFLA 2JGKA 3EFHA 4QTXA 4PGMA 5D6NA 1JFRA 1Y89A 4RJKA 1ESDA 1SXJA 2H0QA 3EVCA 4NOLA 3RT9A 3TR6A 3DV9A 3KVOA 2WF7A 1SFRA 1C0KA 4L4RA 1CF2O 3V8QA 1M0EA 3FETA 6ABPA 5HQ3B 3T9CA 4XWWA 1Z15A 2AYXA 2I33A 4EB8A 5HIKA 2KJQA 1QYRA 3ZC3A 2UYCA 1RZRA 4MI1A 3IP8A 2RDMA 3N7TA 4UBJA 3BCUA 2DT8A 4IHAA 4V3CA 3NETA 4F96A 2EQ5A 4DQDA 1LBQA 1L7MA 3ZCPA 2CDRA 4LYFA 1SJ9A 4KXXA 5EIFA 5FQOA 1OILA 2C4NA 1ISGA 1MJ5A 1OASA 1PR1A 4CKCB 4LXYA 4FOPA 2WTEA 1TK9A 3B7PA 2RKOA 1JDBB 2Q2WA 5KYKA 4CMEC 2GN0A 2Y1LA 1NXQA 3T5CA 1FLDA 5DNDA 3L9WA 5JBNA 3EIWA 3TLAA 3OFSA 4G4IA 2BONA 1U04A 2OHJA 1Z5PA 2ECFA 3H9QA 4FNOA 1O97D 1HDOA 4LHZA 4RTNA 1VLVA 1RI2A 4IQ8A 1SR8A 2YIVX 4UBNA 4DCGA 5FPQA 1Z8NA 3ADCA 3IT3A 2YFKA 4ZGWA 5CFRA 4GWLA 4RKFA 1GHTA 2UXBB 2ZE7A 3MMSA 4NCJA 1Q7CA 2RHGB 2I6GA 1EP9A 1ESCA 1UXIA 1AQLA 2QRHA 3N58A 2Q41A 4XJXA 1U7HA 3WSTA 4FR2A 1SA0A 2OP1A 2BISA 3ZHQA 2FOIA 4MQEA 3LT4A 1U2QA 4RIHA 1XQ6A 5DSTA 3WK4A 4BNZA 1NJGA 4BN4A 1CQWA 2GF2A 2X13A 2FEMA 2WHRA 5D1NA 4J1TC 3NUQA 1GEGA 1AKNA 3TPZA 1OQAA 3D5QA 3DBVO 5IC6A 3JZFA 4HOYA 1TTPB 4DQVA 3U7RA 1PGNA 2XIQA 5HX7A 5BWMA 4FFDA 2W2NA 1US8B 2BFEA 1E0JA 1XAJA 1B8PA 2Q1XA 5I7RA 5CLLA 3UFBA 2FPLA 3FUWA 1DE0A 1XLVA 4GH5A 3SEFA 1I2MA 1B0UA 1GITA 3JARA 5DU2A 3QU2A 2WQZA 3ESQA 1DLIA 3MYYA 3EOAI 4BYGA 3LYHA 2PH1A 4DFDA 3NX4A 4KVZA 1HH4A 3FFBA 1LEHA 3SR0A 3ZHUA 3G2IA 1DUIA 1AUPA 2B4AA 3FUCA 4I4CA 1B93A 2Z83A 5T4BA 3C7CB 5BYBA 1SUAA 2R6ZA 2DWOA 2AGVA 2XKAA 1V11A 3BWCA 4FFSA 1LNSA 2UUOA 4WCFB 4DLPA 1KS2A 2I3BA 4DMRA 3ZHSA 4Z4EA 1JG7A 3VDMA 3FYDA 4S1VA 2Q6VA 4YJFB 1XZJA 4GOKA 2O57A 1DEKA 2JLUA 4N4AA 4NKRA 3DE6X 3THXB 1FSZA 1VP3A 1OCEA 2QUBA 4I6GA 1TLFA 1H93A 3A3KA 4KG7A 3CUWA 4HXFB 1VCHA 1DSSG 5FOQA 4MWZA 3W6OA 5CLFA 4Z4QA 4I4IA 2VS1A 3LUGA 3A9UA 3UK6A 4KV9A 3TE7A 4RSRA 4G0UA 1JBQA 1R88A 2NV6A 3C6QA 4OK5A 5IG2A 1X2EA 1XD8A 5L3SB 5LQRA 1YC2A 3T15A 1PDWA 1HNNA 3H6HA 4MVJA 4H15A 1CZKA 5DULA 3V2IA 5KWVA 2P2CA 2V6GA 2D7JA 1SQ5A 4RAOA 2ZLBA 1PR6A 3L8CA 5IABA 1OGIA 2H2GA 4C5CA 3L8GA 1JHXA 1ZK3A 2AS0A 4U2EA 3SJZA 1IK4A 121PA 1VE7A 3HJBA 3AY0A 2BAGA 4WOCA 4EY6A 2GOYA 4YUYA 1P3Y1 4Y1EA 3ZVNA 2P5YA 3BHIA 4M9RA 1VKZA 1RM5A 2ZRCA 3LY5A 3ND6A 3TNDA 3UK1A 4TTSA 1J56A 4R9UC 1E2EA 2X3FA 2ZBRA 4NL4H 4BAUA 4BFZA 4COKA 3O03A 3H8VA 4BLUA 5JZMA 1GPYA 3KHTA 5LZ8A 3L6CA 4ZVSA 5B1SA 4KR2A 1L3CA 3U61B 1HLFA 1Z7BA 1V9SA 2DKFA 1B7GO 1GGKA 2WD7B 2ATVA 3AI2A 2JCSA 2O0JA 3K73O 4NBNA 2HZ7A 5DSZA 3WK5A 4A0HA 4JXKA 2B8WA 4LI3X 4DDMA 5LMCA 1MABB 5MN6A 3HZZA 1DQSA 4CNBA 3QEBZ 1NG9A 1XQ1A 2VF5X 3DAHA 3GU3A 1QX4A 4RGYA 1GFZA 4ZT4A 2NW6A 2Q9BA 2R86A 5AK5A 3TVTA 3TXYA 3HXLA 1L8AA 2RFLA 4FFBA 4C20A 4EM6A 2JFWA 3HDJA 1D4AA 4PWZA 1KE1A 3Q2OA 1KQOA 5I9NA 2UVPB 2Y05A 1QKJA 2E0IA 1XRMA 1AS2A 1A2BA 2LUOA 5L4NA 3OZRA 5EY5B 5HYVA 2ZATA 3AHJA 4MUIA 5KNBA 4RMGA 4TPKA 3VZQA 2RHHA 2OMEA 3TMYA 5BN3A 1HOTA 3HFSA 2CLHB 3Q15C 4R1NA 3GRZA 3UG7A 1UBJS 2E4UA 5HS4A 1G21E 2Q07A 2H1SA 1QQAA 2KMLA 2QUZA 3BFXA 3L1HA 2X5JO 3P26A 4RL6A 4E08A 4OUKX 4QBIA 2GERA 5CIYA 3G9QA 3B7GA 1ILEA 1JR3D 4CLDA 2FB9A 2HJGA 4HV4A 2NZUG 3IERA 1AUVA 1P80A 2AOTB 2FSFA 3AU8A 2FK7A 3RSHA 1JA9A 3O8QA 2PG3A 2IDZA 5KUTA 2F3UA 2GLXA 3IAEA 4LZPA 3SBEA 3TIGA 4P4NA 5HF9A 3TOXA 1F4LA 4CM9D 5KSZA 1UT6A 3GRYA 1KZ7B 5FOVA 4IWXA 3OMWA 3HKBA 1HX7A 4M8IA 4HAVA 3GUVA 1SM4A 1V4VA 2QVLA 2Z98A 3ZHXA 4HB0A 3OPQA 1PT6A 2YRXA 1M7GA 2C4UA 4XTRA 2J07A 4F46A 2LDBA 1VHTA 3AEUB 3LVRE 1D6MA 2PL3A 1I4DD 4M7WA 4IKEA 1KFJB 3EF3A 1XAHA 4R9VA 4X6LA 3SZOA 1QIMA 4EVRA 3BE6A 1P3JA 2YL2A 1MU0A 3FLBA 3FSGA 2AX3A 3B6KA 4PZ0A 1MQSA 3H1GA 3RSLA 4EUKA 2J6IA 3HYNA 3A1VA 1FRQA 3QUTA 5LB2A 3T7CA 1LA2A 1G4AE 3G0OA 1JGTA 1OKKD 2AFRA 3FGPA 2DZDA 3O93A 3QEMB 4IHJF 4BIIA 4QYMA 4FOOA 4UDNA 5JI2E 1RACA 4BP9A 3KSDO 4B87A 3WADA 1U63A 3HCRA 3KWFA 1HZZC 3UYLA 2JD1A 2BSAA 3CLTD 4B3IA 1IY9A 1TI7A 2AL7A 1QQ6A 4E6EA 2RC6A 4GT1A 3HXMA 2MYTA 3NHZA 5BQ5A 1NLMA 4O6VA 3FFWA 4BN5A 1QZ3A 5JNTA 1A9OA 1DJLA 1G9TA 3M7IA 4JK3A 4TMYA 3ESAA 3WGZA 5HKKA 1QDLB 5HRUA 1DKOA 2G77B 4PVCA 5TVGA 3SJUA 3TAXA 1QF9A 2Y76A 4FMCF 2UUAB 2VC2B 3ZGVA 4ARCA 1HBJA 3M9WA 4WI1A 2QN3A 4V0MA 1GGFA 1Z0IA 1RHMA 2OCYC 3WB2A 3TH5A 1O7JA 1ISHA 3VKFA 2QMEA 4KMRA 1RJDA 1VXRA 3F5DA 4CQLB 3W5SA 2FPSA 4WADA 1SC1A 3EGCA 4M0DA 2EXXA 3LOUA 1J8DA 3EC1A 1ZH8A 3KD3A 3V55A 5E95A 1YQEA 3GDOA 1TJ5A 5JDCA 1CZLA 1JHYA 5ALVA 1YRLA 4LFCB 3OIFA 3TZ6A 1QCCA 1L5YA 3NDBB 3ABIA 4R8KA 5TF0A 2WJYA 4BPRA 2J0VA 2JLRA 3OHPA 3TB4A 4YAUA 2BP7B 3I04A 3IMEA 2WJGA 4FGZA 4NU6A 1YR3A 4QKQA 5HA5A 4GP7A 4DCCA 3GRUA 5GZ1A 3HEBA 1IXYA 1M2WA 1KEWA 5HG0A 4DWVA 1Y9DA 1FDUA 4L74A 1KA9H 1NTRA 1TKRA 2HK6A 3LSYA 4QC2A 2H8GA 4X7BA 4XEUA 2X0DA 1BW9A 3T38A 4PZUA 5HNKA 4ZYWA 4FKMA 3F9CA 4RUKA 5AWFC 3RS9A 5E0KB 3VQTA 4ALLA 2GI4A 4NE9A 3NKVA 5BSUA 3F8WA 2PZJA 2Y0CA 1ZX1A 1DXOA 3NRCA 1XG5A 4EFNA 2FRXA 3HFGA 1USGA 4UZSA 3WSVA 4NZPA 2D7DA 1PWEA 2ZK7A 1AO0A 4LGMA 1J2EA 1NUSA 5JAUA 5JOQA 2P2LA 4TTQA 4C0BA 2OBMA 2O2XA 1ADBA 4JUIA 3Q0EA 3TG2A 1Z82A 4V0QA 1PT9A 3KOMA 3VHRA 1V7CA 3OC6A 5KREA 4B3SB 1TMYA 1IUOA 3CLKA 1JFFB 3C7AA 3MAAC 4RADA 1XTIA 1H3FA 5THQA 1DO2A 3HGMA 4PPGA 5ER9A 4AY4A 4CM3A 2QI9F 3INYA 2Q3EA 1E4EA 1RXVA 1G5PA 3T5PA 1LLDA 2QA5A 4QAQA 4Y1FA 1KOLA 3RGGA 4AWBA 5EIXA 1VB5A 4ENVA 1IQ0A 4UXIA 4R2IA 3L4EA 2OVBA 3R1IA 5DBFA 4BNGA 5KYXA 2PXAA 3QEAZ 4JI6B 1A2OA 2IYQA 5KJFA 1RJWA 1CUXA 1EUQA 3KTFA 4RNCA 5FCDA 3JQ6A 4N6GA 1G64A 5DHQA 1HYQA 1P7VA 4WCFC 1Z3CA 3AQ4A 1GPWB 2HBQA 3U80A 3X1DA 3TE6A 1S2LA 5ENZA 4ZKDA 3D8SA 4BZQA 5IJ0B 3T1OA 4KQEA 4CEHB 3WJ7A 5LZ5A 2GD2A 4FLMA 1X0VA 1TFUA 1BGXT 3Q5GA 2IPLA 3EC7A 3S2SA 3AT1A 5EP3A 1W88B 1UANA 2ID8A 3WL8A 1F48A 2EFJA 1UAYA 2VYVD 3GNSA 4CR6A 3JD0A 4HWPA 5BMVA 4TXLA 4FDVA 4I1UA 1X1AA 4TRJA 1NW9B 2ERCA 1QNLA 3GWGA 4GQBA 3K0CC 3R6DA 1ZSNA 4KAJA 4RPKA 1OGYA 1JKXA 1GPLA 1ZD2P 3R24A 1WD5A 2ONCA 1O57A 1CSEE 1KARA 2W4IA 4ZAGA 4I50B 2G04A 2QRKA 3ETNA 1M9NA 2XXBA 5HOEA 1ZIOA 3G79A 2JARA 1V1MB 2Z2YA 3U5ZB 2Z4TA 4YJ2F 4UHKA 4CG3A 4BWYA 2ET6A 1U1GA 5IEBA 3CURA 1FUEA 1T29A 3SS7X 1GTG1 4HTFA 2IHNA 1MA0A 2V3VA 1TYZA 2FP3A 2Y1EA 4AN4A 1P6XA 1A9PA 4BFLA 5C51B 1G8KA 3QSGA 4N5MA 2BMJA 3DQQA 3JQ8A 5IM5A 3DOIA 2EC5A 2OG1A 4HB2A 4FMCB 1JJIA 1PHRA 2VIIA 1J2UA 1XNHA 3FPJA 4GMHA 4TWRA 3KOZA 2IIVA 3L4BA 2NM0A 3QYAA 3AK4A 3W2EA 2G83A 2OHIA 3L04A 2QK4A 2PLNA 5ALOA 4L6CA 3W77A 2IH2A 1UFRA 2OQIA 4EMTA 1JVBA 5CYOA 5LC1A 2MHCA 1GV0A 1QHHB 3ZGLA 2XR1A 1MZVA 1P0MA 1XNRB 3LW8A 1EX1A 3QW2A 5AVKA 2FDCA 4ZZ0A 1XL1A 5AJUA 2R6R1 3SC4A 3HJCA 5EPEA 1SBCA 3BMNA 3ETDA 3FWZA 4GD3Q 4R2KA 3UUEA 4M9CA 5JT1A 1G0NA 3JV7A 4QOEA 2YDXA 5LOVF 5KYTA 1NXSA 3FPKA 1L7DA 1T9ZA 3B1ZA 1JTVA 1JKJB 2EZ9A 4EI8A 2Y77A 3GPLA 1OBCA 2QTLA 2Q1TA 3CINA 1DDIA 1OLOA 3O4RA 4POAA 5CX4A 4K9SA 3JQAD 4HH3C 1H2ZA 3KC2A 1N2XA 4BO7A 1Y4SA 3GAMA 1QQTA 2VUIB 1FTQA 4YPOA 4BZPA 3HN7A 3AB3A 3E5RA 3DE0X 4PBSA 4XARA 3CVXA 2TMDA 1YGPA 4PHFA 4D99A 1YI8A 1ZI6A 1FS5A 4JBYA 5G4LA 3AR5A 4NXNB 1B6RA 1Z62A 3PVZA 5JO9A 5L3ZA 1I6KA 1MH9A 1PT5A 1EFPB 5DOZA 3UWKA 1UP4A 1USKA 1VDMA 2QM8A 3DTYA 3T7RA 2QN2A 3WRWA 1A5SB 4PO9A 4PYMA 1F0NA 4M0CA 4QUHA 4AROA 5DHTA 1YE5A 5CIWA 3Q12A 4MKGA 4B43A 4PAGA 3I2FA 3L0PA 3HMQA 4I55F 2XMCA 4ASUD 4NK5A 4TV8A 1N1DA 3I9MA 4DT1A 3GI1A 3RARA 3ZCTA 4CLOA 1TM7E 3BRSA 3DBIA 3FKSA 2HBRA 1PG2A 1ULUA 2HLDA 3JWHA 3PXAA 4FSDA 2SECE 2BN4A 4Q82A 3SU8A 2CNBA 5B3AA 3N9IA 3R40A 3H0CA 2OXEA 3TJMA 3A37A 2EX1A 2NPOA 5FH9A 3RR2A 2REQB 1SIBE 3PX7A 4LHYA 2PN1A 5KOJA 5FUXA 5ELXA 1MLDA 4GBED 2B78A 4RVHA 5FHRA 2ZR9A 2AD1A 3Q72A 2O59A 4FLEA 1K88A 5EZ5A 4GWKA 4KQGA 2CUTA 4IM7A 4WZAB 5FWAA 4UTPA 1EGQA 2ZT5A 4GC5A 1VIMA 1A8QA 2JI8A 1GGJA 4Y2HA 4E22A 2A1TR 3LQQA 2WWGA 5TMEA 5LBIA 3CRW1 2W93A 4OXIA 2C2ZA 4EJSB 5EHZA 3RS7A 1W93A 2JI9A 3U56A 5ILGA 3WGKA 3X2EA 3GRKA 3CEMA 3A06A 5LBUA 1KYQA 4YONB 4B2LA 4U39A 2CV0A 1KFEB 2BM8A 4KWEA 4N0PA 4LIPD 3FZGA 1VIAA 3I01M 1DWPA 3D0RA 3K1ZA 4OHXA 3R76A 2AHRA 2JFGA 3FPFA 4Z0NA 3Q6NA 3RSFA 3ILHA 1WHSA 5CITA 2JKYA 3BWMA 1H0HA 3MUNA 1FIUA 1SVOA 1YB7A 1HI9A 4P86A 2G82A 3FWHA 3PNKA 4L7VA 3UJ7A 1JLLA 1K9SA 3DEAA 5JLJA 2EGUA 3VDNB 3TN7A 1X7HA 2GR9A 3ZYCA 3JXEA 2ZYSA 5ALQA 3KZVA 4M0EA 5FTKA 1LV8A 5HK9A 3COJA 5CT9A 4YJ2B 2GD6A 4XOUA 1NNI1 4F7DA 4PQRA 4I9UA 4MI6A 3FCOA 5AHKA 4BNUA 4ALMA 2I22A 4KQKA 1V25A 2HF7A 2BEVA 1QOZA 1QC5B 1X1QA 3A3YA 3CRRA 4QTTB 5DT9A 1EGMB 1YZNA 1U2DC 3TD2A 1FJ2A 4AMGA 2CLIB 3H1BA 4BMNA 1KIAA 4E03A 2YMPA 1Z22A 3DBOB 4DPLA 1Q77A 1TIPA 3HA5A 4LOKA 2WTBA 2O1XA 3QLUA 3K70B 1G9SA 2PRYA 3A9SA 3FLAA 1E2KA 4N7BA 5CG1A 4AKIA 2DQKA 1VHLA 4L1KA 5IJ9B 3MRTA 2Q1WA 5CGQB 1HDZA 5DX8A 2J67A 1FZTA 5C46F 1FPMA 1GU7A 4PGGA 2Z04A 3PE4A 4FDTA 4JJAA 5KTYA 1THTA 3DAPA 3EWAA 5B4VA 4PGAA 2VYQA 3DKKA 2VDLB 4FDMA 1A27A 1ULHA 1AHIA 3PV0A 2FMUA 4M4SA 1OW3B 3UB3A 5C34B 2BEWA 2XRZA 4BNNA 8ABPA 4WK2B 4LJYA 4LJAA 4BMPB 4UAVA 4HDKB 1CQIA 3E8SA 4CMIA 4PX3A 3CLRC 3UW3A 1L5WA 1IBSA 4HYTA 2OZEA 3P0JA 5DYWA 1Z18A 1V96A 1Z29A 4MGEA 5KYYB 2ZVQX 4R3UC 2BZ1A 3H8SA 3SJCA 4TSRA 4AYXA 4JL6A 2PGNA 3H05A 3H9EO 3R3WA 3TW6A 4HADA 2C5HA 2DRIA 4RTMA 3BL6A 2AOXA 1YR9A 1D0VA 2JCVA 2MSEB 1NR7A 4RVUA 1ISFA 2NACA 3KYBA 5FADA 5JNLA 3PR2B 1TJ4A 4G3XA 4UTZA 3TZHA 1CTQA 1T36B 1XCLA 5A9SB 1YS4A 3U9LA 3CRQA 4AUNA 1KSHA 1FLNA 1HORA 5J5CA 2HADA 3NKLA 2OO5A 4PR0A 3GLHB 3MIIA 2W6IA 4QBTA 1YR7A 2EKZA 2P4UA 1XPJA 5C37A 4D3YA 2VAVA 4I66A 1XU4A 5EP1A 4YRDA 1GL9B 4WOBA 4YRQA 3KKLA 1DADA 1SOWA 4UCQA 1R3UA 4MXDA 4G9BA 1E2PA 5BT9A 5I3CA 3LGXA 5LU8A 3R7BA 4AICA 4AURA 3IQGX 5ARBA 4ABTA 3SM3A 5THKA 2GEVA 5ECDA 4OP2A 1G3MA 2W70A 2Q4TA 1UODA 2WFLA 2ZAIA 3WG9A 4Z2YA 2H4YA 2C42A 2ZTHA 2AEEA 3GLUA 3HCFA 3WHLA 3M4JA 4E4YA 2ZT8A 3ANLA 4FGWA 3ZCXA 4MZXA 2JFZA 3I1JA 3ME5A 5CB4F 3E53A 3NVMB 1BFDA 3CVYA 5KKCA 2HY7A 1C14A 2VUTA 4K1LA 1OZAA 2GEJA 3ZCRA 4CF3A 3S44A 2VWPA 4D0GA 5IVHA 1Q7GA 4HB3A 4TRRA 2ANBA 1UBOS 1USVA 4U0JA 4CMAA 3K8YA 1SVNA 3D54D 5D3MB 2ZJ0A 3RM3A 1FQOA 2JC3A 3QUQA 4URZR 1XEAA 2QV0A 3QVKA 5F9FA 4ND3A 3A32A 3ZU2A 3TM4A 3ZWMA 2W2OA 2DFKB 5A4FS 1NW8A 3RUHA 5EQTA 2C98A 2OLEA 3LVBA 2FOXA 3R3HA 2ZULA 3CHYA 4C4PA 1J9EA 3S1LA 1MJGA 1M8PA 3RRYA 2EKPA 4LXTA 5AW6A 4OYYA 4XFDA 4ND4A 1NM5C 2VRCD 2WR8A 1J9ZA 4NPAA 4ZK6A 2CCKA 3W8DA 1MIHA 4JUCA 1RRPA 1VSVA 3K2IA 3KZMA 1SCUB 3LK6A 1GZ6A 1SHJA 1DBRA 3K92A 3PDWA 4G1FA 4ZDWA 2BFOA 1NVUQ 2DKNA 1WIWA 2J3QA 3LF2A 3LXRA 5T4HA 1N5JA 1TMGE 2BY4A 3C6ZA 2AW3A 3Q40A 2V9CA 4TL8A 3TR0A 1UJ4A 5CEJA 1P0FA 4F8YA 2B4RO 3BH0A 5IUKC 1N6PA 1N6RA 3F9RA 1BTOA 1DKUA 2Z6UA 1W4LA 4EF5A 1F3OA 3NALA 4OHFA 2XUJA 2D1TA 4A6EA 1PS0A 3C8ZA 1JEYA 3I5AA 2FFRA 5DCUA 3IODA 1P5RA 1G3QA 1G66A 4DCTA 4OFXA 4ECEA 2YJ4A 5JO0A 1VJTA 1QS0A 1IHXA 2LCFA 3PEFA 4IIVA 1T9CA 4ODIA 2MWMA 3MTGA 1R5BA 3WAGA 2OHFA 1S2NA 2V7QA 4C08A 2DH6A 1LCIA 2EFYA 1LPNA 1T26A 1JDVA 2XB8A 2ZOSA 3NHBA 4G5GA 4I4TB 3BAZA 3MA0A 2I6FA 3AKDA 3PNPA 2WM8A 2J0UB 2QQEA 1AMOA 1NLYA 2CBGA 2G1PA 3UK2A 3PDIB 4D7AA 4RY9A 3Q8KA 4JI7B 4EW6A 3I6ZA 2A35A 3MTJA 4DA6A 4EPWA 2F90A 3UAZA 3EWIA 1EJ2A 4RGBA 1R0CA 1JYEA 1WW3A 2QMQA 3AETB 4A16A 3KV3O 1NW3A 2QVGA 4EG0A 1P3DA 5FWNA 2BGMA 3JZAA 1ZC4A 1MGPA 4N76A 1EUCB 1IPFA 3CLSD 4TKMA 3ABRB 2DY0A 4MR9A 4BATA 3HJTA 2QI9C 4GMDA 4Q12A 5EMJA 4NX2A 4ZHQB 1M76A 2E5WA 3DAGA 1A97A 2JHFA 3OP1A 4UVDA 5B36A 1A9SA 1DWOA 1ZEJA 1CJUC 1C1DB 3HQ4O 5E3IA 3GDWA 4A23A 4E2FA 2XCSB 3AR8A 4J4BA 2OPHA 2EJBA 3NOVA 1LXCA 1O95A 1NQTA 3DHNA 1B23P 3O21A 1ADCA 4JZKA 1XCPA 1Q7BA 4O4HF 1UKVY 1NYRA 3UXYA 4AKHA 4QM6A 1TA4A 1W6UA 4FEAA 4RFSB 1UPBA 4ZEOA 4EO9A 4COOA 5FTMA 2E1RA 2BVNA 4FHDA 1WCYA 4MV4A 5FTNA 1QH1A 4UHJA 3NM5A 3T1YB 1P5ZB 2GHRA 3D3NA 4MRMB 2BKUA 4QNNA 3DMHA 4W9NA 1JH9A 2PUBA 5ALLA 2WT4A 1KO7A 2QDXA 2KPOA 3VISA 4C22A 1OH8A 4NZOA 1ZZEA 5F1OA 1ANKA 4DJFC 4WEOA 4QFDA 5SYAA 4ARAA 4TV9B 3CLUD 3OMXA 3SF8A 1I4WA 5DLYA 2E4AA 5ETJA 1YQUA 3SOPA 4CBVA 2H2AA 1F8UA 3DZGA 1WABA 2BSXA 1ZJ5A 4EJSC 2F3QA 3BM5A 2G4CA 1VLQA 4P0TA 5MGBA 1Y1TA 3PHIA 3LLMA 4JJ4A 1TO6A 2PWAA 4ZVQA 4HZGA 4OGKA 1I3KA 2DUJA 1AF7A 2BW0A 1DNPA 2ZI7A 2OFWA 3OZVA 1JE1A 3LSTA 4PZZA 5CB4B 3D6VA 5LQAA 4ANFA 5HFNA 5K8LA 3TMAA 2WQ6A 1XALA 3OEHD 2V55B 3CW2A 4QICA 2QKYA 1DIHA 3ZWYA 4B85A 5JZSA 3LO5A 2NTNA 1BFKA 2GDJA 3OWXA 4DDUA 4LTDA 3AV3A 3KOYA 4QM7A 1EPUA 3ZIDA 3GC6A 1JDUA 2MDTA 4PG6A 1QPBA 3DZIA 4MGHA 1VBKA 1DBIA 2ZIFA 3JQAB 2A3RA 4OKIA 2EFDB 4RH0A 4UVGA 2AC7A 1NIPA 1DO0A 2HK9A 1O77A 5AXDA 3IUNA 3WGLA 1PX2A 1OHHD 4OVKA 3Q7TA 4E5PA 3LU1A 3GJ6A 1NMZA 4P81A 1HF3A 4AJ4A 1D2EA 2UZ3A 2X7XA 2PAFA 4JAVC 3K70C 1CY0A 1GIAA 2AOUB 2C3PA 3ANYB 4HGQA 3ITNA 2JZNA 4Y2JA 3T9BA 4BKPA 4EYKA 1N6OA 3EH1A 2BCEA 2FQQA 1S96A 3V80A 3EPLA 1QRRA 5A5EA 4U2KA 3AIKA 1W96A 4PAQA 3PFKA 5DIZA 2BL4A 1QZUA 2WVGA 4ZD6A 2A5JA 3B8EA 1HPLA 3GJ8A 4GI7A 4M86A 1PYDA 3L6BA 4Q21A 1FUUA 4ZU1X 4A8TA 5ESRA 4CCYA 4LQLA 3IIIA 5K3OA 3HU1A 2I55A 2JGMA 2IIPA 2W2LA 5EE5B 3K8OE 3BJZA 1KQFA 1UKAA 3ND8A 1R6BX 2R11A 3IVMA 2JGAA 3PXUA 3WYBA 2XOXA 4EB6B 3NDJA 1NG1A 2V97A 1RC0A 2A7XA 4BFYA 2DR2A 2G06A 1ZLYA 1BN7A 2NU7A 4OM8A 5FNVB 5KNCD 1TE2A 2WBLC 4MWGA 3EDRA 1DJQA 4QHSA 3I3SR 4U2GA 4DMHA 5DHFA 3JQDA 4DZTA 5AHOA 5K7SA 4QGHA 2BF7A 1CFZA 1G8HA 1DAHA 1EM8B 4KQFA 4Q3CA 4BHTA 3WGVA 4E15A 3REGA 3F4LA 4LJ7A 1AUOA 1WB9A 1CQJB 3PVSA 1Y1LA 4FP9A 2W0SA 3L8MA 4Q03A 3S1AA 3IUSA 3RK4A 2PTGA 3HWSA 3ASYA 5IBPA 4X66B 2OTCA 1PG5A 3WC4A 3HPQA 5TEVA 4AMUA 3SZGA 1OC4A 1Y9ZA 3CLTC 3IOEA 5AVYA 5LNK1 3S8YA 2CV1A 5LQSA 5J2UF 4J49A 1DB3A 1L8LA 3LAWA 4DEVA 2E6KA 1VE1A 2QNBA 1ACMA 4EJMA 3TGWA 3DBHA 3NCTA 3S5JA 1GKLA 1ZONA 4ZN6A 4O3MA 1EGVB 1VI2A 1CRWG 2EARA 2JGLA 1XU7A 3LUDA 1S9DA 1XZ8A 2V45A 2VWGA 4URYR 3UHOA 1A1VA 2R6DA 2R1ZA 4TQUS 1ZCAA 2J31A 4XM0A 1LBHA 5HZKA 1RYNA 4MVYA 4KE9A 3I4CA 4P3OA 4RIEA 3T7KA 3LKZA 2ZIXA 2HMTA 1BXRA 1UBLS 4ND8A 1MQ9A 2HQSA 3MJVA 2Z30A 4WWHA 4QHYA 5DM70 1M3SA 1DP4A 4GFDA 2XCRB 4UBLA 5CCXA 1BDIA 2NT4A 3GMDA 3TSCA 3RADC 1NUQA 4I3FA 2Q2VA 2X15A 2OK7A 3FYUA 1EDEA 3M5WA 4OAQA 3WLSA 4BTLA 4F71A 1HT3A 3OZXA 3R4VA 4C04A 1QCDA 1U6JA 1N9GB 1KK2A 3TRKA 1VLJA 1D5WA 1H0SA 2WOJA 3CN9A 1ZK0A 2D0DA 3CEHA 3IPLA 4OMDA 3GP8A 2IF0A 2C4TA 1J8MF 4QBGB 5FHQA 4EMBA 1O5TA 1XZLA 2I65A 5IRCD 4PBRA 3CUUA 3MMZA 1O89A 3E58A 3WGJA 1S89A 2PZKA 1V5WA 2C0CA 2W43A 3CXUA 2JRCA 4O59O 2FSVA 3WGGA 2RGYA 2OXRA 3WYGA 3DTVA 4FB5A 2A0XA 1ZH4A 2PRZA 3GOQA 4MVJI 2EZUA 5K4AA 4A0FA 4ZI2A 1VKHA 2VVTA 1L1RA 1M5UA 3EMBA 3H2YA 3UIEA 1DDOA 1V5FA 3I0MA 3MG9A 1UZMA 3UXEA 2O8DB 2R3SA 1B6GA 5B4TA 1KY2A 4J1NA 3ZI0A 3F1LA 2ZWMA 5EN4A 1UJ5A 3BWYA 5I9LA 1PT7A 1AU9A 3TIXB 4TROA 5AFSA 1QAOA 1ZAKA 1N9KA 1UBSB 2XSZA 3SY8A 1M6HA 1G59A 1RWKA 4M83A 1RAAA 1SOAA 1XTQA 3L8YA 5DNCA 2B69A 4C7VA 1IWOA 2G76A 2NVBA 4WZBA 4X6YA 4MRNA 3T4UA 3LWNA 5BW5A 1KWGA 1T0UA 1K6JA 1KFKB 3AW8A 4GZMA 4R8VA 5IS2A 2Y93A 1LUAA 2D5BA 2I9KA 2YR0A 2V58A 2W6JA 3Q5DA 1K7YA 1WDTA 4ID3A 1J0EA 3PNBA 5E3JA 2J08A 4YQEA 3H9BA 4OU4A 4EMUA 5IFLA 2UAGA 2K87A 1HTBA 3C3KA 3RC9A 1Y9EA 1JP7A 1ZMOA 2IYOA 1JEQB 3LLVA 1Y9AA 3EMDA 4GZLA 1NU8A 4NQZA 2OHOA 4E5MA 3T3DA 1GOTA 3TVYA 4KACA 4RF5A 1UEJA 3NIDB 1J39A 4JIGA 1HDCA 1O3YA 1E7QA 1BCSB 2ACEA 1A5AB 1EP3B 1P61B 3BSSA 2FR8C 1S3SA 4RZSA 4UBOA 4HT3B 1RNLA 2PSFA 2Q5EA 4WE3A 2QZPA 4TT3D 3O8RA 1MHPA 1WL8A 3GIDA 1V8FA 5JS1A 2XPCA 3IEPA 2IYNA 3MGCA 1ZR2A 1EVZA 4R6WA 3HR4A 5DMHA 1J1IA 4CM5A 4L5CA 3PEVA 3PC3A 3MXTA 4HEHA 4LMBA 4TS3A 3H0EA 1C1HA 4LOHA 3WDMA 3ESZA 2Z56A 2XW6A 4FFOA 4IPTA 3KFXA 3CBQA 4ZAVA 4DIEA 1NAIA 2VI5A 4H27A 1CDZA 1XZBA 2VOEA 2HKIA 2LCIA 3UUFA 4Q1VA 1HQCA 1O87A 1J5XA 1FB5A 1XQVA 1Y7LA 1G6HA 2B30A 4Q39A 4UM8B 3AX6A 3TTWA 4C05A 2AKEA 1D6SA 4KXFB 1W73A 3QVUA 2R96A 1U0JA 2WNSA 1KNQA 4D96A 4PYRA 4CNQA 5J5VA 3GVIA 4DMKA 4EMSA 4RM3A 1AV7A 2H4FA 3HYRA 2WILA 3R5XA 1NWHA 4IIJA 5D87A 3UQYS 3ZE9A 3FNQA 3IPCA 1MOZA 2WD8A 4RDCA 4AUMA 3AUKA 2D3TA 3OQJA 4GE3A 5EERA 4YMLA 2B1QA 2ZCVA 5JQGA 3A4MA 3GPIA 4PZEA 5JEEA 4M76B 4Y2YA 1CZRA 2PV7A 2AKYA 3GW8A 3H13A 5EFOA 3UH1A 1FP2A 4H7IA 4K03A 4Q1AA 5KCZA 3D81A 4WJZA 2IZ6A 3G9XA 1WBBA 1N6KA 4D43A 4LECA 3T5TA 2HGZA 3CNLA 3S7TA 4Z3DA 2X9QA 1WCIA 3KYDA 1II8A 2AH5A 1TM4E 3L7JA 3LD9A 2NO7A 4GWGA 1ID1A 2VATA 1XQYA 1CT9A 1AUQA 1J5PA 1GPMA 1I1HA 1M2NA 1TNDA 2G4VA 2ILTA 3EH2A 3O9MA 4IUYA 2DJ5A 3ZH2A 4XWOA 3E7PA 1LPSA 4HN4B 4D3ZA 2VPZA 4F12A 2GTHA 1L4HA 1ECBA 4HYQA 5JADA 1JQKA 5A0FA 2O48X 5JUWA 1KEEB 4IH9A 2JCBA 3K31A 3RYCB 4JYAB 3OTOB 2E18A 2W71A 2XT0A 1DC5A 3ZZTA 3OY7A 2CJWB 2XAAA 4HB4A 1M1YA 1DAKA 2A5DA 2RARA 3CW8X 2YNMA 4XTCS 3WKEA 3H5WA 1XTKA 2QRMA 1M34B 2YY5A 1LPMA 1QCYA 2XCUA 4YWHA 3ZHVA 4KWTA 1T8SA 5B12A 4R9SA 2WMOB 3QTTA 1FDIA 5D5HA 2WTAA 3RT7A 5KO2A 2I99A 5AH0A 3HKCB 4YMIA 3WGTA 1S6YA 5AI0A 4L27A 1Y3BE 2O52A 3R3XA 1ZBDA 3RUCA 4B8YA 1AHNA 1EA7A 3X1ZA 4UMVA 3RVPA 1QG6A 2BI8A 2AKAB 4O29A 3BORA 4UUPA 4A03A 5C1BA 3F3YA 5K01A 3MNFA 3FPSA 4BQSA 4U7DA 2IHUA 3KU1A 4CU5A 3IR7A 4EJ2A 1WUYA 5FUVA 2O3JA 4GR4A 2JI6A 3U39A 3DOJA 3MRXA 1UEXC 2X4DA 4XA8A 1AGXA 5ADHA 1DEAA 3AJRA 3BXFA 2XUPA 1AF4A 4NC9A 5J23A 1AH2A 4MVXA 2EX0A 3QELB 2D13A 4QPNA 3RNLA 1KH3A 4RK0A 2SHKA 2F1OA 1DX9A 1OY1A 1TAQA 1GGNA 1W5EA 1YB1A 4PGFA 4YREA 1SQGA 4DMCA 3CE9A 1II0A 4G1EB 5KDDA 1UOEA 1T2UA 4GMXA 1K7EB 2GILA 4KDRA 2Q0XA 2ZANA 4UDXX 5AESA 1XEXA 3F74A 3PNVA 4HJXA 4ZAZA 3HSKA 5FBHA 4IEFB 4B47A 1I4OA 4CKBA 5M3BA 4EKGA 3FDIA 3MS2A 4HATA 4KPGA 1AB5A 3UAGA 4EKYA 3D3WB 3K9FC 1AQJA 4RTOA 2W8ZA 2Q2OA 3EVBA 4F1KA 2X8LA 4J7AA 1RTKA 4BJ6A 4FEYA 1BS2A 4J75A 3VPHA 1M8GA 3QBDA 1KRXA 3H83A 3LCMA 4BEJA 4Y6QA 1EEXB 4FYXA 5TT1A 4D0LB 2DYKA 3SDZA 1B74A 4WASA 5IKOA 1EFKA 5L7WA 1JHDA 3UMSA 1HTTA 2FRDC 3ELWA 1EFDN 2WF9A 3KYJB 1QU2A 2FUCA 3SZMA 3UENA 5A4AA 1WCXA 4FT2A 5KVAA 1U5BB 3II6X 4IQGA 2C4WA 3U1VA 5LMNB 3F47A 4FGUA 4V0LA 3ZVLA 2F1JA 4IUDS 3D6NB 4DSAA 1EE9A 4YAFA 5HP4A 1WV1A 3EOBI 2VLBA 3IMGA 4LEIA 1CIVA 2WT8A 4HG2A 1LD3A 5HIIA 4UNPA 5JCOA 3D6TB 4F1WA 2IX3A 3HBMA 3U62A 3PTLA 1E2UA 3RHFA 4MIOA 4B35A 5SZJA 3U4GA 1WEHA 3R0IA 2EEZA 1F51E 4QXPA 3WNQA 5EJ6A 1KR2A 5KTSA 3PXEA 1UOPA 1R9GA 1KI6B 2RG7A 4LV8B 1N2CB 3N2IA 4YPVA 2RGBA 5JSZB 1E1RD 2EFEB 4A27A 3BBLA 5I9TA 3NHRA 3H2HA 3ZY4A 2HLHA 5BVGA 5JISA 1HYGA 4AY2A 1Z12A 2JZOA 2R60A 3FUUA 4EYQA 4QECA 4ENPA 5IT9A 1JR2A 3KQYA 2CHGA 2R5WA 1E2FA 1YZUA 2KX7A 5E6SB 3C7DB 2E89A 4F5WA 2CSUA 2AMYA 3T3EA 4ARZB 4FI3C 4MUGA 5F9HA 2FWJA 1EZ4A 4ETMA 2O3TA 5B53A 1NBOA 2K7ZA 3ONNA 3ROKA 4W9MC 1XPOA 3NAQA 2AE2A 4P4SB 1FYDA 3NYIA 4K6MA 5IJ9A 3K6SB 4F4FA 4JI5B 1GTZA 1YTLA 3B36A 3B9PA 2VQ6A 3NAGA 1JAXA 3COPA 1H9BA 4JSYA 4QYSA 2Z8ZA 4Q15A 5FPTA 4ZTBA 4LY6A 2G6TA 4R0NA 1DJPA 2QORA 1QBKC 2NQTA 3MOSA 3MEQA 4G9GA 4IEEA <