2NTNA

Crystal structure of maba-c60v/g139a/s144l
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
237
structure length
218
Chain Sequence
AKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVEVDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIASVQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lack of dynamics in the MabA active site kills the enzyme activity: practical consequences for drug-design studies
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 73
structure length 218
sequence length 237
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ntnA00
3AI2A 3FWNA 2YDYA 3BXXA 5ICSA 4BNLA 2OHXA 3ZWAA 2IZZA 5TGDA 2NACA 1DJNA 2YDXA 4RV9A 5COBA 3BA1A 1MFZA 3GF4A 4AJJA 4L8VA 4CPDA 4CQLB 4YAJA 2HKIA 5KKAA 2OOSA 2HDHA 1XU7A 3DTYA 4N5LA 1GZ6A 1H9AA 5IZCA 1KIFA 3DZJA 3H5AA 1X7DA 2VHWA 2DPHA 4LSWA 3MOIA 1ZK4A 1ZSVA 4GSKA 3ZWMA 3LK7A 2CDAA 1A4IA 1S7CA 4I5DA 3DAGA 3UH1A 2UUOA 3V1TC 1H2BA 4ALJA 1JW9B 3AM3A 1T24A 3AY3A 2AHRA 2YFQA 1KETA 4OXYA 3Q9NA 3FTNA 4HFNA 3VPHA 3MWDB 4MVJH 1LNQA 2XPCA 5ENDA 5C7LO 4ZQBA 2FSVA 2EIHA 2YV1A 3W8EA 5CDSA 3G17A 5EMHA 3O03A 2VZ9A 2X0IA 3FNFA 4R9SA 1YBAA 5ICMA 1ONOA 1ZCJA 3CUKA 3QHAA 1UP7A 3ANMA 1LJ8A 3ZH2A 2ZTVA 4F46A 4KWIA 3WYEA 8ADHA 1UXJA 2OFPA 4Q3BA 4XQEA 1EBUA 2ZYAA 4YPOA 3I9JA 2NNLD 4CLXA 3M1AA 1SOVA 1YS4A 1GU7A 3WGQA 1ZIDA 4HX5A 3SJ7A 4QECA 1BXKA 4MO2A 1KVQA 3A06A 1B8PA 4WE3A 3WBBA 2CFCA 3DEYX 2GRAA 2VTEA 4CM7A 3VH2A 3N7UA 3AOEA 5J23A 1N9GB 1A5ZA 4A27A 2JL1A 3V2GA 2DFVA 4R1SA 3PZRA 2P5UA 1XYGA 4GAEA 5JYDA 2X5OA 3GVIA 2B5VA 5DOZA 4IUYA 3AI1A 1B14A 4WOJA 3VPFA 3CZRA 4DMLA 1E7SA 1SOWA 3PDJA 1D4FA 4BNVA 4ZA2A 5G4KA 1UP4A 3HQ4O 1EK5A 1ZO8A 4J1QA 4MP3A 1PS9A 1VL0A 2JKVA 4BNNA 2Y1DA 2P68A 3D5QA 1I32A 1B3RA 4WLEA 3PJDA 4XQCA 5F5NA 4LMRA 2IZ0A 4KUEA 2WYVA 3H9JA 3RFTA 2WD7A 2ZB4A 1C1XB 1E3WB 1P0CA 1H0KA 2JD1A 5JAQA 3GEGA 4BNWA 4N7RA 1V0JA 3GRPA 4WOKA 1K3TA 3GC6A 2VQ3A 4PCVA 1JAXA 1T2EA 2NU8A 5C7IO 4BKRA 1QORA 1HLPA 3HADA 3MJCA 5A5EA 2X9GA 3PFWO 5EIOA 5HBRA 2NU9A 3TZHA 1IPFA 3MJVA 4B79A 4CODB 3GAFA 3GVXA 2C0CA 2YJZA 1H5QA 1EFLA 2VOJA 3WYCA 3IAHA 3LZ6A 4DLLA 4MKRA 1B26A 2CF6A 4BNYA 3ZU3A 3HZZA 1SCUA 2F1KA 4BO3A 2J5QA 3DMTA 3D5TA 4IBOA 5CEEA 4KTVE 3WR5A 1NYTA 3WX0A 5EL0A 2NUAA 4D0SA 3DZGA 1WNTA 5L3ZA 2PGJA 4BV8A 4CJXA 3CSDA 1U9JA 4RVHA 3Q1LA 1JN0A 3OJLA 4FFMA 3IUPA 4I5FA 1I3NA 4IXWA 3GLQA 4C4OA 1DC3A 1E77A 1ZUD1 4WLOA 4QO7A 4J91A 3DFUA 1ISMA 4MKXA 3RQSA 3GUYA 1NR1A 2B0JA 2PV7A 1DC6A 1QYCA 1I01A 3QA9A 1LDMA 4G5HA 4OXNA 2QRKA 2PH5A 4DIOA 1JA9A 1Q2XA 2FOIA 3BTVA 4PLPA 1KEPA 3ETEA 3BHMA 4E33A 4JN6B 1YB4A 5A9SA 4GMFA 1HRDA 5KWEA 3OF2A 3KLMX 2EGGA 1BGVA 5G0UA 1ZVMA 4R5HA 5I7EA 5JCJD 3FBGA 1MB4A 3H9QA 4IS3A 3H2ZA 2I6TA 2D59A 1WVGA 4XZ3A 3AUSA 3Q2KA 1WDMA 1EBFA 3KVOA 4Y98A 5T64A 2WE8A 1K0UA 2ZTUA 3RJ5A 4GX1A 3BMQB 4WCFA 2GN4A 3WGZA 4TSKA 3O26A 1CERA 3HHPA 2A94A 5TJHA 1ZBQA 4XYBA 4J6FA 1DC4A 1X0VA 4HBGA 2GYYA 1B2LA 2E49A 1ZZEA 2AXQA 3DO5A 3GDFA 1ENPA 5JPIA 1Y8QA 5GZ1A 1WWKA 5BQFA 4RPHA 4TRNA 4GGOA 1M66A 1DFGA 1PQWA 3FBTA 4OO3A 2O2SA 1G0OA 1W0CA 2EW8A 3TWOA 2YHIA 3I6IA 3CKYA 4M55A 1EZ4A 3KSZO 5IDWA 1IZ0A 1NPYA 1R6DA 2AEJA 4WNCA 3L6EA 4IY1A 4Y67A 4XQGA 4OYRA 1E1NA 1CJCA 4RF2A 2Y0EA 3JD2A 3VTZA 2ZTLA 1SB8A 3ITKA 1I8TA 1NNUA 5U4QA 3MJSA 2WE7A 4IPTA 5G2OA 3I9NA 5DZSA 2HAEA 4RVGA 1CWUA 2OZPA 1E5QA 4FR5A 4UEOA 5L51A 1G6KA 2O7SA 2CDCA 1EFKA 1EVZA 1MC4A 2NVBA 3WGIA 5DCUA 4BNTA 4OL9A 1PZEA 3GK3A 1QR6A 1DOHA 3F5SA 1FJHA 1ADGA 2PKRA 2W98A 3QWAA 2D3TA 5L45A 5ILOA 2B5WA 3WWYA 5HWSA 1VJTA 2O3JA 1PIWA 2I67A 1LRJA 1T2DA 2CSUA 5TC4A 1PJLA 1GFSA 3OETA 4R1UA 2A4KA 3TL3A 1DSSG 1FF9A 3ANLA 3JQ8B 4R5MA 1NQAO 4YRBA 4F45A 2JD0A 5TSDA 1F0YA 3E5MA 1LC3A 4DQXA 4EJ6A 3RUAA 4EUEA 4XWYA 4CMEC 3PHHA 5JC8A 4HWKA 4XJTA 4E31A 2JD2A 1J49A 5T5QA 3DBLB 5F1KA 1LSJA 1A4UA 1U7HA 2EWMA 1AHHA 3WGTA 3T4EA 3DXFA 2ZKLA 3WGYA 3DONA 3ZI0A 2AEFA 3PHGA 3ASUA 4QT0A 4BQPA 2GZ1A 1V3TA 4BKPA 1I10A 3NGLA 3V5NA 3ZU2A 4QTZA 4W7HA 5BT9A 3DZKA 1F14A 3WGOA 2P2SA 2EJWA 3OECA 5KJFA 4JCOA 3H9UA 3TZ6A 3IMFA 3ETDA 5IDYA 1RPNA 2P5YA 3DOCA 3GPIA 4PIVA 1E7YA 1DRWA 2Z1MA 1IYZA 1UDCA 4B8WA 4YA6A 2QZ9A 4ZU3A 1GQYA 4BO7A 4PG5A 3WNVA 4PRLA 1UXHA 2GR9A 5JY1A 3QWFA 2Y0CA 1LC0A 3JD0A 4WPGA 4EGFA 3QVWA 2G76A 3K2EA 3LSYA 4W4TA 1C1XA 1E3WA 2IXAA 3BTSA 5JNLA 1KC1A 5ITWA 3ON5A 1EVIA 5JDIA 3S55A 2AEMA 5JYEA 5DDIP 4E5KA 4YBZA 1CYDA 4ZQHA 4FIZA 4C7KA 1FDWA 2BI8A 2XOXA 4WEOA 1BW9B 1VLLA 4P22A 4WK6A 4PVDA 2P9EA 3L4BA 4I5EA 2EHDA 3L6OO 1N9GA 3FD8A 3JQGA 3ZGYA 5C3MA 2FWMX 1R0LA 1VL8A 3IQDB 2O2YA 5FFFA 1VE9A 4DLBA 4BS9A 1TT5B 4YT8A 3U09A 3E9NA 3K9QO 5BSFA 1N8KA 3TFQA 1DIGA 3TZCA 1K89A 4N54A 3ZV4A 3ZV3A 2I9PA 3NV9A 3TZKA 2PZKA 3I23A 3VZSA 1GDHA 4C7JA 1OFGA 4BNFA 3QWIA 4F6LA 1JAYA 3GPDG 1PJCA 3K8ZA 5G0WA 3WIDA 3WQRA 3KZVA 1YVEI 3LT0A 5FEUA 5CDTA 3X2FA 3AJRA 1SBYA 4B8ZA 3QW2A 4KTTE 2V65A 8LDHA 2UVDA 4BB5A 1B7GO 1NHWA 1PL8A 2PFGA 3HFSA 4R4JA 1SC6A 4LVUA 2HK8A 1LDYA 3KBOA 3NX4A 2J3JA 2PH3A 4CM1A 2OL4A 4D3SA 4IGEA 4BNIA 1Q0LA 2Q99A 1V9LA 2IODA 4IDCA 1MXHA 4CMGA 1PJTA 3ITDA 4J0FA 4JP2A 3S8MA 4RVSA 5L4LA 1UP6A 3OJEA 2HK9A 5EERA 1XA0A 5G0SA 2Y93A 1U3TA 5IDXA 4F6CA 2IZ1A 3PJFA 3RBXA 3AUAA 4HFMA 3PI7A 4DRYA 2YW9A 4KQWA 3C7CB 4Y6PA 4FJ1A 4AJHA 3GNTA 4E2XA 4HFRA 4MIEA 4I9UA 1FXSA 4ZGWA 5MGBA 3HUDA 4TZKA 2PD4A 3ETGA 1BG6A 1SNYA 5AVOA 3A4VA 1QYXA 1MA0A 3PXXA 1KY5A 3UAGA 1WXDA 1U3UA 1PZFA 4FSHA 4D3DA 1HT0A 2V6BA 2FR1A 4MP8A 3JQ7B 3TN7A 1I2BA 4O5OA 4ZQEA 5IJZA 3INRA 4AJEA 4WJZA 5AXDA 3ZWBA 4PLZA 3PQFA 4NNJA 3F4LA 5JMWA 4BO8A 3CMCO 4YJFA 2VUSA 2VN8A 3PVZA 3VH3A 4PGFA 3E18A 1KY4A 3GR6A 1KEVA 4L4RA 9LDTA 4UUMA 2G82A 3GH3A 4PG8A 4KDEA 1JWBB 4RDIA 4IIVA 2HRZA 3GZNB 4L9RA 4RF4A 1X0XA 3NDIA 4QQRA 4B4UA 5FF9A 4E4YA 3PFFA 3JCZA 4E21A 2DTEA 3ZNOA 3FI9A 1NQTA 4KUGA 2BFAA 3ULKA 4AJKA 5FYDA 2QZZA 4CUKA 1NFRA 3ASVA 1HE4A 2X5KO 3RVDA 3NDJA 4Q3CA 4TRJA 4PN3A 3B70A 1MLDA 1DB3A 2DTDA 3OFSA 4BUCA 1UAGA 4DVJA 4J16A 2POQX 4FPXA 4XDYA 4EUFA 5G0VA 4E5PA 3JQFA 4OOFA 1T25A 4LSMA 4GSLA 1V3VA 2XAAA 1Q1NA 3S2IA 4UUPA 4NBTA 3VVCA 1H93A 4AJ4A 1E3LA 3AM5A 4RPJA 1WP4A 2RBEA 4J7XA 4QSMA 4RORA 1H6BA 1F8GA 4OMUA 3LU1A 1HWYA 3O4RA 2IXBA 2I99A 3P19A 4YVFA 2YZ7A 4MOWA 5JXWA 2FZEA 1HDCA 3CINA 3OHSX 3ZHXA 3DBVO 5FI3A 5F21A 1AXEA 5ER9A 1DHTA 4DWVA 1HDZA 2G1UA 2X6TA 4G65A 4M49A 1U4SA 4CV3A 3AY7A 2OBYA 4WCDA 2V6MA 4CM8A 4RLSA 1DO8A 3BTOA 4D44A 3NKLA 4Z6KA 2GPTA 3GAZA 3PWZA 1AGNA 4M86A 5DCWA 5CDGA 2X1HA 4O6VA 5B4UA 4XQ9A 2PKQP 3VOSA 3BHJA 3E82A 4XX0A 1I5RA 2D5CA 2AW5A 1BMDA 4P38A 3JYLA 1LTHR 4OHUA 5KVQA 1M6WA 1SAYA 4TWRA 1PR9A 3G49A 3WFIA 5CDYA 3UCEA 5DN9A 3GHHA 5A03A 4CLRA 2W8ZA 1PS0A 2GF2A 4J7CA 4Z0HO 1H2HA 1N92A 5JE8A 3ZNNA 4DTIA 2A35A 3SXPA 2Q4EA 2GGSA 7ADHA 1PJQA 3IKVA 1N1GA 3KSUA 2B4TO 2X5JO 3S2EA 4RVDA 4N5NA 4JBHA 5G4LA 1D1TA 3ZNQA 2DQ4A 3Q2IA 2H5LA 5CPFA 5A04A 3RKRA 2HJRA 2VHVA 1E3IA 5KJ6A 4U7WA 3LF1A 1E3SA 3L07A 5DT9A 3W4JA 2Y05A 4J9VA 5MDHA 2YYYA 4BNUA 3DBRA 1XIVA 2QRJA 2GZ2A 1H9BA 3HDHA 4X54A 1L7EA 1BWSA 4YR9A 1R15A 4JXKA 1Y5MA 2QIOA 2C54A 3COSA 5TS3A 3WGGA 5JCJA 1GPJA 1R37A 4EW6A 5K0ZA 2VT3A 1P33A 3QY9A 4M8SA 5DNAA 5JDCA 1W6UA 3KSDO 1BVUA 1DXYA 1BXGB 1H94A 2VHZA 3LC1O 1TVEA 3JD4A 1E1MA 4MIOA 5BNFA 4B7UA 4Y9DA 3T7CA 1A9YA 1BXGA 4BO5A 3F1KA 4HV4A 2HMUA 4DUPA 4JROA 1AXGA 1DIHA 4HP8A 4CMAA 1C14A 1GUZA 5H82A 1XWFA 4ZQFA 1ZW1A 3OJOA 1YQDA 3MOGA 1V8BA 4PLYA 3DZBA 2NV6A 4W9NA 4J43A 4CLDA 1K6IA 2GD1O 3UCFA 4CLEA 2J3KA 4GWKA 3F4BA 4BKOA 3BIOA 4L73A 4IJKA 4IMPA 2IRWA 3GGGA 1LLUA 2X9NA 3VHRA 1KBZA 3B1FA 5CFZA 3PGJA 4D3FA 4YT2A 2VWPA 1LSUA 1I33A 2Q45A 3WSWA 1BHSA 3A28A 4LVCA 1KEWA 4OJNA 2D4AA 3DL2A 3GGPA 5F3RA 4BGEA 4EZBA 5I7FA 2BI7A 5BNTA 2YHUA 1T1SA 1YDWA 1YL7A 3ZNPA 4Q9NA 4QFDA 2Y99A 5LCXA 1R4MA 3AWDA 4GL4A 1UZMA 2CUKA 1NVGA 1Q7BA 4E30A 3OQBA 3DHEA 3H2SA 3D3WA 4GVLA 4YXFA 5CDUA 3WG9A 3ABIA 3GEDA 4R16A 3HNPA 3QVTA 2LDXA 2E4AA 1FDUA 3O8QA 1EQUA 2BRUA 2HK7A 3G79A 4QXMA 4JX8A 4R3NA 1HF3A 1OC4A 2H9IA 4YJHA 2WD7B 5L95A 5I9LA 4CV1A 3ADPA 4D7AA 2NADA 1GTMA 3WNQA 2C07A 1Q0QA 3QSGA 1IB6A 2WD8A 1XU9A 3NT4A 1ZXBA 2O50A 3EUWA 3JQDA 1LSSA 1VC2A 4IQ0A 4DXHA 1YO6A 1K2WA 1OOEA 4UVHA 1AUPA 2B69A 1P3DA 2EP5A 3C8MA 4LMPA 4UEJA 3KHUA 4FC7A 1GQQA 5LDGA 4DBVO 5A5FA 2DUUA 1MGOA 2Q2WA 3VC7A 1NP3A 1XQ6A 3SJUA 1TA4A 2YV2A 5IXSA 3GUCA 5ADHA 2DBRA 1Y5RA 2E6UX 4YDRA 3KYDB 3D3WB 3JYOA 3GVCA 2PZMA 3ZU4A 3FHLA 1GYRA 3NJ4A 4UVIA 1DIAA 1BSVA 1PTJA 3CIFA 3JYPA 4N18A 2Y1EA 1GZ3A 1H6CA 4XRGA 3EZLA 3TDKA 1E6EA 4WUVA 1E7WA 3JTMA 2FR0A 4O1MA 3WQQA 1SMKA 1B0AA 3UOGA 3DR3A 2AQHA 4PLFA 1EE2A 1JKJA 1D7OA 4M1QA 4RCVA 3GEMA 3AU8A 5CP8A 2WYUA 5H83A 4F3YA 5JAZA 1BXZA 4OQZA 1QRRA 3NUGA 1LXCA 1ADFA 2ZJ0A 1ULUA 4YAGA 2O4CA 3IL2A 4YCAA 3E48A 5TIIA 5JO0A 1ISGA 1TLTA 4OH1A 1SB9A 3IC5A 1Z45A 3DBHB 1O9BA 2RAFA 3RWBA 4XA8A 1VPDA 4DA9A 2P4QA 4BGIA 1PSDA 3NDRA 5GZ3A 2FN7A 4L76A 3KB6A 3SLKA 3ZWYA 1ULSA 4RPLA 3ZV6A 5EQFA 1F8FA 4INAA 2PLAA 2PNFA 5AXAA 5L9AA 3P5SA 1DFIA 3OQ6A 1E1LA 3ONFA 3HDJA 1PJ2A 3RBZA 2OUIA 1LDNA 4BNXA 1Y1PA 3C1AA 3RUDA 5U9CA 4PG4A 1YB1A 1Z73A 3NTQA 4JJFA 1NPTO 1U5CA 2VRCD 5HS4A 1YDEA 4DYDA 4UVEA 4L4XA 3DOOA 2D1YA 4DQUA 2OP1A 1CRWG 3PK0A 1ZH8A 2EW2A 3M1LA 3UXYA 1NQOA 3PYMA 1P9LA 1YB5A 4IGFA 3KETA 3CXRA 1GZ4A 1YQGA 3GA0A 4RZIA 3OH8A 2HMWA 4OXKA 1NFQA 3QWBA 1Y7TA 1P1HA 2UDPA 3UICA 1YOVA 3OEWA 1LA2A 2ILTA 1GR0A 2VOEA 4U0JA 3ZHZA 4FOOA 3HFGA 1DLJA 1P1JA 1HXHA 3U3XA 2DBVO 4ND1A 1ZXLA 4CLRB 3CTMA 4TQGA 3LVFO 2BGLA 2X23A 4QX6A 2JAPA 9LDBA 3NGXA 1RYDA 3U9LA 2X0JA 3KXDA 1PZHA 1GUYA 4XCVA 4CL8A 3SX2A 3OP4A 2ZYDA 5BNIA 4XEHA 4S1VA 3WQSB 4A26A 4I8XA 4HFJA 2O3SA 4RZHA 4JP3A 1WZIA 2ZCVA 4CQLA 4ID9A 1DRUA 4GVXA 1DHRA 2OXIA 4RJTA 5ITVA 2J6IA 3RSHA 1EDZA 1U7TA 2NQ8A 2HRBA 2NTNA 4FGSA 5LDHA 2J8ZA 4CMCA 3DC2A 1LLQA 2X9VA 3L4SO 2Y68A 3LC7O 2RIRA 3INGA 4NBUA 3VH1A 2ZATA 5TT1A 2FP4A 4Z3KA 3EVNA 3QWHA 4YRAA 2E48A 4XB1A 1CETA 2OMEA 4J0EA 4XDZA 2NVUB 4OKIA 1IL0A 2Q2VA 3WS7A 3OIGA 1VJ0A 4AJ2A 5JAMA 3NYWA 2X86A 5CHEA 2PZJA 3D4PA 2H6EA 1PX0A 4Z0PA 5DP2A 1ISIA 4D43A 3OEYA 3FNEA 2EKPA 3PHIA 3NJ8A 1A72A 2UUPA 4FFLA 4NZ9A 2H1SA 3ROQA 4ILKA 3DZHA 4BO2A 2OGUA 4OIMA 1I2ZA 4RPKA 5ENVA 2Q1WA 4ALIA 1QV6A 4CMIB 3I1JA 1LDEA 3GY0A 4Q3AA 4J90A 3U4DA 5DF1A 1DDOA 3WLFA 3ROMA 4PLHA 3SLGA 3L6DA 1NWHA 4Z3DA 4G2NA 4OM8A 1KVRA 1IHXA 4NR0A 2W90A 1HKUA 1XELA 4Q3NA 2WMDA 4WEQA 3BAZA 1LBEA 3PHJA 3HJAA 2X4GA 3W4KA 5I8WA 4Z0TA 1NHGA 5B12A 3HSKA 5CAEA 2CY0A 2IEDA 3V2UA 1QLJA 1W8DA 3VZQA 4CQMD 1YL6A 3I9KA 2DC1A 3QQPA 1KS9A 3PJEA 2CNBA 3RROA 5ER6A 1NPDA 1YQXA 1IY8A 3BYZA 2P91A 4BVAA 3H9EO 2AMFA 3LLSA 1OI7A 4O0LA 4FFNA 4RDHA 4PLWA 1WDKA 2NSDA 4RLHA 2A92A 4LISA 1VL6A 2HMVA 4Y8VA 2P9CA 5K9ZA 3KRTA 1LRLA 2WEKA 3GZNA 3WOHA 5BSHA 4FCCA 5IXYA 4NQZA 4R41A 4E5MA 1EVYA 3CMMA 2RH4A 1FMCA 3L77A 4CM4A 4YAIA 2QX7A 3AU9A 5L40A 2B4QA 4JBGA 4HXYA 3UW3A 1PZGA 2VRBA 3JQAD 5TLSA 3UN1A 3MJEA 3P7MA 4ITUA 4NHEA 4IJVA 1YH3A 1YJQA 1UAYA 1ZFNA 3JQ8A 4GKBA 4K28A 3PIIA 4IDAA 3RC2A 3EGOA 4PLGA 4D79A 2ZCUA 3RASA 3R3JA 3EY4A 4NFSA 1Z7BA 2EJVA 1O89A 3AM4A 5CEJA 1UDBA 3E6AA 5JDCC 3RCBA 3EHEA 1ORRA 2CVQA 3I3OA 3OMLA 1DRVA 2AQIA 2EP7A 4MVJA 4A2CA 5B4TA 2JFHA 4PLCA 4FFOA 5THKA 3JD1A 1R4NB 3WICA 2I76A 5JLAA 5KOIA 4FB5A 3H4VA 3PLRA 1HLDA 1SPXA 4LN1A 5HM8A 2YV3A 1Y8QB 2YQ5A 4TKLA 4DQVA 1PJ3A 3G3EA 3HE3A 3I9MA 4NDNE 1DBVO 5BSEA 1HDYA 1LUAA 2IE0A 3VAZA 3ICPA 1QXSA 1F12A 2Q49A 4WKGA 1GUFA 1HETA 3DZFA 4DPKA 4J7UA 2R00C 2PD6A 3FWZA 3FSRA 2J5KA 2JFFA 4DLAA 3PYXA 4WASA 4LGVA 1WMAA 1RM3A 4FOSA 2ZQZA 1NVMB 1OC2A 1AN9A 3P2YA 5GY7A 3KO8A 3PDUA 4UVGA 5GZ6A 2VUTA 3S2FA 2X22A 3K92A 4B4WA 2GASA 3ZV5A 2NTVA 4J3FA 2PKQO 1GY8A 1PU2A 5L7YA 4FFRA 2JFGA 2JHGA 3JQGB 4MPDA 2AQKA 4UULA 2BKAA 2EEZA 1OAAA 4KQXA 4EJMA 4DPLA 2D2IA 1J6UA 2FR8A 3ENNA 4BKQA 2AE1A 3B6ZA 5FWNA 6ADHA 4ROSA 1IUKA 3FR7A 3KM0A 1BW9A 1T2AA 4TKMA 2V7PA 5IN4A 1T2FA 2VWGA 2ZYGA 4IJUA 4OKNA 1GL3A 2WYWA 4R3WA 2EG9A 2JCXA 3P2OA 2GN6A 3L9XA 4GLLA 4CMEA 2YFHA 1JVBA 3PTZA 3AW9A 3CH6A 4MVJF 3ZU5A 1XLTA 3K6JA 3R1IA 5A05A 1YKFA 3IS3A 4AL4A 3UKOA 3X2EA 1MUUA 4FC6A 1I3LA 1ONPA 2O3RA 4B4OA 5JBIA 4NBVA 2Q1UA 4R1NA 1HTBA 2I5PO 1QMGA 2C82A 3C3XA 4LCJA 2VHYA 1NX6A 5DP1A 1D3AA 2A9FA 3M2TA 5HRUA 2VTDA 5IZ4A 3GFBA 4TVBA 3FRJA 2DU8A 4GKVA 4CQMB 1E7RA 1IE3A 2B4RO 3U62A 2Q1TA 2UAGA 3MEQA 3NT2A 2Q46A 1ZSNA 1QLHA 1E6WA 3IJPA 4A7PA 4BL5A 3D0OA 1OBFO 2LDBA 4TZTA 2W2LD 3BMCB 4GH5A 3TSCA 2G17A 4AJPA 5JDIC 4BNHA 3D3EA 4CM8B 4MVJE 4I1IA 1E3EA 5JO9A 1LRKA 1M76A 4ZQGA 4O63O 4MIYA 3PIDA 4NBWA 1QKIA 4XIYA 5KJCA 1FK8A 1J5PA 4JGBA 4UVDA 1DEHA 3IP3A 3EW7A 3ADOA 1GCUA 4DC0A 5B1YA 4KWHA 4MVJG 4KOAA 5GMOA 4GMGA 4IXTA 4E2YA 1GV1A 1PGJA 3RI3A 4KUHA 3JQFC 4TVOA 4A0SA 4QEDA 3RIHA 1ZMTA 3DMYA 5KIAA 4K6CA 1NR7A 1CF2O 3TFOA 3ZWOA 2I66A 3VPGA 3S2GA 3GQVA 4FJ0A 1GADO 4EITA 4B7XA 4IDDA 1O8CA 3E03A 4P4NA 5I7SA 3SVTA 1MG5A 1VJ1A 1Y9AA 3NAQA 1ZK2A 4TROA 2BELA 3CZMA 3HB4X 5F1OA 2BFPA 5T8KC 5HA5A 2ZK7A 1E92A 2IDZA 4H16A 1DJQA 5JW6A 1CIVA 5A1TA 3D4NA 2GLXA 2EKLA 2HLPA 4AFNA 1PQPA 2NU7A 3JQBA 4EDFA 2GCGA 5T57A 3Q0EA 1LQTA 4URFA 2C5EA 5I7VA 2WJPA 3ZWWA 3EAGA 3C7DB 3JD3A 2O3UA 5JFOA 5C5IA 4J2OA 4IM7A 4NJOA 2EERA 2DPGA 3JQ9A 1QSGA 4RL6A 3BMQA 4WCFB 4HY3A 1RM5A 2I65A 1KVUA 5I9NA 1F17A 4CMKA 3A1NA 1XKQA 3E5RA 1M2WA 1WZEA 3DAPA 1ISFA 5TRTA 1UUFA 3AUUA 5TQVA 4W99A 3PZBA 3QLJA 1BRMA 3VTFA 1J0XO 3ICCA 3UVEA 1OMOA 1HDXA 3TRIA 1A27A 3Q6IA 3KOUA 2PTGA 3RC1A 4ND5A 5A3VA 1NTOA 3H3FA 3LC2O 3RUCA 3DB2A 1YL5A 4NK5A 1PL7A 5DBFA 3V2HA 3VPXA 1J4AA 1M6HA 1L1FA 3ZZNA 4CV2A 4EUHA 2ET6A 4PVCA 1VSVA 4XIJA 4ZICA 2X0RA 5HTOA 1O6ZA 3GT0A 3KYBA 5JS6A 1FDSA 5CEFA 3SC4A 5L53A 3PJGA 3GRKA 3LQFA 3DTTA 4J4BA 2XF8A 3GZ4A 2D8AA 3PHLA 3GOHA 5JC1A 5A4DA 2YY7A 1EUDA 1IULA 3I4CA 2D0IA 5COAA 1VKOA 1O94A 4Q3DA 1I24A 3F46A 3BMOA 3FPCA 1CQJA 4ZJUA 1A71A 3H8VA 4NFYA 1MG0A 1NM5A 4MVJM 4XGNA 5ES3A 3VKUA 1KEUA 2V6GA 3GVHA 5CPBA 2PK3A 1HYHA 1SEVA 4CR6A 3U0BA 5K6AA 2VWQA 5KNLA 3WYBA 1HEUA 4N5MA 1Z82A 4OSPA 4GX2A 3KV3O 1F06A 1XCBA 3EK2A 3UCXA 1Q7CA 3JQEA 5LC1A 3AFNA 4B7CA 1H6AA 1LDBA 2C2YA 3BMCA 2G5CA 3UGKA 2W4QA 4YT4A 1T4BA 5A3JA 4XGKA 4CV0A 1WAMA 2QYTA 4MP6A 1BDBA 4W7IA 1P0FA 4S3MA 1VM6A 1X1EA 2VHXA 3GMDA 4LRTB 2DBZA 3UHAA 1P1RA 4NG5A 2NU6A 4RQTA 1T4DA 4L4SA 2RH8A 3VDRA 4CQMA 4DBZA 5B4VA 4YYZA 2NVWA 3AFMA 4R01A 1R4MB 1ZEMA 2WTBA 3C1TA 4E3ZA 3D1LA 1N7HA 2W2KB 4FJ2A 4FS3A 2XXJA 1KERA 5F1PA 5T6BA 5A02A 1P44A 4L75A 1EUCA 1DFHA 3QE3A 3RAJA 1QP8A 5AYVA 5BSGA 4NU5A 1KVTA 3JQAA 4EYEA 2O23A 2Z95A 4AJNA 3RUFA 4NIMA 2RHRA 2GZ3A 2BGKA 3VKVA 3AOGA 1E7MA 4LRSB 1E0DA 4U6QA 3LLVA 1X7GA 3AI3A 2G0TA 1WMBA 1N5DA 2ZB8A 1SO8A 3LDHA 3PYLA 3WTCA 4XYGA 4CR7A 5EINA 4Z9XA 4MVJI 4O59O 3D4OA 3EZYA 5C7OO 4DPMA 3PQDA 3TZQA 4ND3A 2C2XA 4BB6A 4U8GA 3DQPA 1U28A 1B8VA 3JQCA 5I9MA 3JV7A 4NPCA 4R1TA 1DIRA 2O7QA 3RJ9A 1I0ZA 3EYWA 1EMDA 3EVTA 4AJLA 2VT2A 2X8LA 4BNMA 3AY6A 4OQYA 1D1SA 1AHIA 4RPGA 5L4SA 1AE1A 4FD3A 2FMUA 3KYCB 4MJLA 2ZQYA 1K5HA 4A5OA 3PWSA 2FZWA 4BGUA 1U8FO 1UJMA 1R66A 5KJEA 4U6SA 2FPIA 4NJMB 1PJSA 4BNKA 4YTEA 5EJ2A 4RO0A 5H81A 5A9TA 4GWGA 1M67A 4CLOA 5JAIA 1PWZA 4YEDA 2R6JA 3DBRB 4YRDA 3EDMA 2CVZA 1VKNA 4DREA 2DAPA 2AG5A 3RFVA 3TOZA 4IQ8A 2PWZA 2X58A 1UDAA 3DDNA 4R54A 2PGLA 3TPCA 3DWFA 4BNGA 4BNJA 4JJIA 1MX3A 2Y1CA 3I52A 2B37A 2GO1A 1JU9A 2B83A 3RKUA 1JKFA 4BMSA 3QJ5A 1R4NA 4CLHA 4B4VA 3K5PA 3QVXA 2NQTA 3W6ZA 1N7GA 3BMOB 4ALKA 1U5AA 3ONDA 4BO1A 1U3VA 2JHFA 2HO5A 2C7VA 3OIDA 1H6DA 1Y81A 2CD9A 3K73O 2Y1OA 1PGPA 1YWGO 5JCXA 3E9MA 1B15A 4PZCA 3JYNA 4XR9A 4E0BA 1BVRA 4CL3A 3BTUA 3M6IA 1P45A 2NTJA 3PWKA 2Y0DA 4K1LA 4ZVVA 1RJWA 2FPGA 3OM9A 5HS6A 4MVJP 1HSZA 4IDEA 1GEGA 4RVFA 2EV9A 4NH4A 3FN4A 1EVJA 1FDVA 3NTRA 3ZW9A 1NXQA 2I3AA 3R3SA 4GX5A 1E5LA 3ROKA 1ONNA 3RFXA 3H9GA 1XHLA 1ENZA 5K6AC 3WFJA 3DOJA 2RCYA 1RKXA 1YBVA 4FGWA 1KOLA 3CEAA 2YHIB 1UXIA 3NEPX 5EN4A 3OICA 3RC9A 4B3IA 3INTA 4E2WA 4RF5A 4II2A 3HDQA 4Q39A 4DL9A 4D0RA 3JQ6A 1WW8A 3PLNA 4KDFA 5FI5A 2DVMA 2GN9A 2WWRA 3EC7A 1EDOA 3QP9A 1R0KA 4KZPA 1M75A 3H3JA 1KVSA 4BKUA 4NFHA 1D8AA 1GEEA 2OORA 3T4XA 3U4IA 1A7AA 3VVBA 2C59A 4AVYA 1IZ9A 5KKCA 1HDOA 4YJGA 4A03A 1HE2A 4PLTA 2XXBA 4MKZA 4CMJA 2W2KA 1U2GA 3IUSA 4CR8A 1MC5A 1FDTA 3K96A 2PD3A 3PRJA 5DCYA 2ZTMA 4CLOB 1UR5A 1EEHA 1MP0A 3GVPA 1C0IA 1NAHA 1NQ5A 1OZAA 1Q7GA 1TEHA 4UUNA 1JTVA 2QRLA 3K2BA 1DLIA 3GHYA 4Z9FA 3UUWA 1UZNA 2JJYA 3FNHA 2GDZA 3AK4A 3ZWCA 4Z9YA 1I2CA 3WTBA 3GNQA 3PGXA 4CM9D 3F47A 3FPLA 3DHYA 1PS8A 4BQRA 3QIVA 5KVCA 4RQUA 2HMTA 1C1DB 4H7PA 5DBGA 4XB2A 1CDOA 5T67A 4BO4A 4WECA 2DKNA 4RF3A 1EK6A 1YBMA 4YACA 4YJFB 3U4CA 2P9GA 1L7DA 4WGGA 3RD5A 5EPOA 4EJ0A 7MDHA 1Q0HA 1NFFA 3LT2A 1DC5A 2UV8A 3WGHA 3RU9A 2P4HX 4HUJA 1HDRA 2JAHA 2PY6A 3MZ0A 5IN5A 1PJ4A 1HDGO 1XR3A 3I83A 4J4HA 3TNLA 4CMIA 4PG7A 1ZEJA 4YQYA 4ONEA 5TF4A 1ISJA 3L0DA 5TT0A 3LT1A 4GQAA 3DFZA 4I9HA 4J1SA 3FTPA 2IYPA 5DULA 4CM3A 1LU9A 4XGIA 3Q3CA 1X7HA 4EBFA 4JBIA 3H5NA 2AQ8A 2RHCA 4ALLA 3D64A 3I5MA 2VYNA 5JY6A 3PP8A 3I9LA 1Y8RB 3HG7A 3RU7A 1SZJG 1O0SA 2QG4A 2QYSA 2HJSA 2HSDA 4WLUA 3I4FA 2HCTA 4FQ8A 1SEPA 1E1KA 3WMWA 4D41A 5CG1A 3TOXA 1R16A 4FN4A 2SCUA 2Q50A 4G81A 4YB8A 1S6YA 5ILGA 2YUTA 3NTOA 2Y1FA 1PJBA 5JMPA 4AJOA 1JKIA 3DBLA 4BGVA 3A14A 1YONA 3OBBA 1ENYA 4FW8A 2Y1GA 4ND4A 4TRMA 3JQ9C 4ALNA 4CUZA 1LSOA 3I9OA 3WBFA 3W8DA 3ZWXA 3W8FA 1JWAB 1ZMOA 3V1YA 3LT4A 4YWJA 3M2PA 2VYND 1O95A 3ZHYA 5COQA 2BLLA 4DC1A 1QYDA 3KTDA 4NU6A 3WJAA 4JQCA 3ZN2A 4LK3A 1G0NA 1JQBA 5KVSA 4A73A 4XKJA 1HE3A 1Z75A 4IJWA 2FPPA 4YT5A 4YAEA 1N2SA 2FSSA 3G0OA 1NBOA 4R68A 4ESOA 1GAEO 4RVUA 3F3SA 3C24A 1JDJA 1C0KA 1ZK3A 4UREA 3RUEA 1XQ1A 4H15A 1MV8A 4OSOA 2PR2A 2ZJ1A 4M54A 2TMDA 3OSUA 5CG2A 4GPD1 4BOYA 1DPGA 2VRCA 4L0QA 5KJ1A 1T26A 2BFOA 2VZ0A 1Z7EA 1B16A 1GPDG 1RWBA 1UZLA 4AICA 2F00A 4EI2A 3VDQA 4DYVA 2CMDA 4FFPA 3W4IA 1ZNQO 2O3TA 2TMGA 3DZIA 3B20A 4DMMA 5IZCC 1N1EA 4IINA 3K31A 4B3HA 1LLDA 2QHXA 1EE9A 2WSBA 4HKTA 3WB9A 3E9QA 3IP1A 4XJSA 3IKTA 1C0PA 6LDHA 3PPIA 1QYWA 5DBIA 4K9DA 3TL2A 2QQ5A 3D7LA 4J4TA 3JQAB 4GX0A 3Q9UA 5AOVA 3UFXA 2EF1A 3GMSA 2DM6A 2X0NA 1WLYA 1NASA 4PFJA 5F5LA 2R2GA 4E2ZA 1ZSYA 2PA3A 2HU2A 1MXFA 1I36A 1ZJZA 3F6YA 1GV0A 1WPQA 3RUIA 3OA2A 3S1LA 3UF0A 1P74A 2NLOA 4WLNA 4CMBA 4E5NA 4M87A 1XDWA 1YRLA 1HYGA 2X7HA 4JIGA 3KYDA 1B3BA 3A9WA 3MTGA 5EQDA 3R0IA 1DIBA 5A9SB 1QYVA 3N74A 3BZUA 1UXGA 2GNAA 2DFDA 3GDGA 3H5RA 4IS2A 1PGNA 5A06A 3GG2A 1XEAA 2B36A 1HSOA 3OJ0A 2V6FA 4M89A 1Y8RA 1WDLA 1DAPA 2JCVA 1Y9EA 3AOEC 1XGKA 5G4KB 1HZZA 3OJFA 4PLVA 3ZHBA 1P1IA 3F1LA 1HE5A 4CM4B 1W4ZA 3E1KA 4ZRNA 1GQ2A 4XR4A 1T2CA 1C1DA 3VZRA 4E13A 1QG6A 2FY8A 2GN8A 1NVTA 1VI2A 4UEKA 1UH5A 2FRDA 1P1FA 3W1VA 3BMNA 4GGPA 1E7QA 3WXBA 1RM0A 3RUHA 4Y6SA 3IIEA 4R69A 1GCOA 1LLCA 3WIEA 3MJ4A 4DIFA 3DMTC 3IOYA 3GG9A 4J49A 2C5AA 3NRCA 2ZB7A 5G0TA 4CMHA 4XYLA 1YJ8A 2UYYA 2PZLA 4J2HA 2C20A 4EEXA 3VZPA 3SEFA 4E5YA 4BV9A 1CEQA 3KLPX 3CPSA 1TXGA 1U4OA 2GSDA 1UXKA 4YJGB 1U2DA 4YJHB 1X14A 2E37A 5AXBA 3F9IA 3WMXA 4D42A 3H65A 1E6UA 2H63A 4J9UE 3GNSA 2BFMA 4R9RA 4KMSA 4ZRMA 2VWHA 3L9WA 5AXCA 4ZD6A 5TX7A 3DAFA 2CDBA 3FCOA 1GYQA 4I9NA 3MTJA 1HL3A 3RBVA 2FHSA 3HDYA 1PEDA 3AUTA 2BD0A 1ID1A 3W6UA 3ZWNA 2GERA 1Z6ZA 4EEZA 3JSAA 2OP0A 2R00A 4JJGA 3ROPA 1EQ2A 4B3JA 3U4HA 2NWQA 4BMVA 2AE2A 4IDBA 3V8BA 2Y67A 1ZK1A 4GLOA 1DAOA 3WSVA 1XSEA 3C85A 5B37A 4IMRA 3HN7A 2EGHA 1YXMA 2C29D 3B1JA 1A7KA 2O48X 2VNAA 4W6ZA 4YAKA 3SBOA 1YE3A 2BH9A 2BMAA 1Z74A 1ADBA 4BNZA 4WCFC 1PL6A 3MCVA 3O38A 1U3WA 3FNGA 4TMFA 2C7GA 5C37A 3ORFA 1Y6JA 1IPEA 4MVJD 4OAQA 1GYPA 5KCZA 4JLWA 1PGQA 3NT5A 3C1OA 2NVUA 4IIUA 5BR7A 3SC6A 5A9RA 1LX6A 1C0LA 3QVSA 4P4LA 5U1PA 3KEQA 2OBNA 2Q3EA 4JK3A 4P8RA 1TI7A 2VUUA 1VRWA 4I5GA 4ZHSA 3ANNA 1LDGA 5IF3A 4AG3A 2CVOA 3RC7A 3HN2A 4IZHA 4KP7A 1P1KA 1QV7A 3H6KA 3F5QA 1NAIA 1T1RA 2VYVA 4W82A 5T8KA 1PR3A 3O9ZA 3V1UA 2VYVD 3WDSA 3ENKA 2AA3A 1P31A 5KTKA 2EXXA 4YJDA 2JCYA 3JQBC 2WM3A 2O4UX 4R51A 1CQIA 5L7TA 1ZJYA 3OA0A 4XYEA 4H3VA 1KYQA 2ZIZA 4PG6A 4ZN6A 2DTXA 4Q3EA 3VPSA 3WLEA 2J3IA 4K26A 1P77A 3TF5A 4NJMA 1U8XX 3DHNA 1TT5A 4CM6A 2ZB3A 2I3GA 4OOEA 2BF7A 4JNKA 5KVVA 3T7EA 4IDFA 3KYCA 4GBJA 5L7WA 4WLVA 3KEOA 3OQ1A 3ZW8A 2Q1SA 2YQ4A 3PQEA 3JYQA 5AQ1A 4WLFA 1ISHA 4II3A 1V3UA 4I08A 4XD2A 4E32A 4FDAA 5JSFA 2CZCA 4K6FA 3GN2A 3H7AA 3ONEA 4LCEA 4Y6RA 5I8ZA 3KUXA 2BGMA 1V35A 3HWRA 2Q4BA 2AG8A 2O3QA 3PEFA 2DUWA 4BO6A 4E12A 2WDZA 4FBGA 3ZWVA 4A10A 1EUZA 2Q2QA 1X15A 1A9ZA 1IHYA 2VCYA 1K6JA 3CE6A 2DLDA 3IJRA 4NMHA 5TNXA 4CUJA 1TB4A 4PZEA 3G1UA 4P4GA 3QRWA 3MJTA 4CM9A 2IYOA 3Q11A 1BDMA 3U49A 4DGSA 2W2LA 1HYEA 4HADA 4BHTA 4W9NC 1RYEA 4NI5A 4IQGA 1X1TA 3FF4A 5IAAA 2VNSA 3STHA 1PQUA 4BIIA 5L4NA 1KC3A 4J1TA 4CM5A 2BHLA 2J5RA 4OGWA 2QW8A 3DBHA 1BTOA 2HQ1A 5EESA 5THQA 4GI2A 4UAGA 4QUKA 1MFPA 1VSUA 4HNGA 3LYLA 3QVOA 1IOLA 3TQHA 4IDGA 1RM4A 2DBQA 3WJ7A 4E6PA 5IFLA 4YQZA 4AJIA 4BO0A 4QFCA 4XYMA 4UUOA 2NM0A 4MINA 1I3KA 2E82A 1GD1O 4AJ1A 3ZCXA 3N58A 4ND2A 4BO9A 3GFGA 2HMSA 1ARZA 3BHIA 4HNHA 4DIBA 1K6XA 3GGOA 2IEBA 3FR8A 1HZJA 4U5QA 3HB5X 2VZ8A 2D5AA 4MDHA 2OO5A 5TJ9A 1PGOA 1C3VA 1I30A 5IG2A 1ZKMA 4RGBA 1ADCA 1O5IA 3JQ7A 2HUNA 3GN1A 3ZDFA 1V6AA 3WWZA 1R12A 1ML3A 3BMNB 4PRKA 3I6QA 1LI4A 4WNIA 1XG5A 4ALMA 1LQUA 2CF5A 5IDQA 1B8UA 3GDOA 4PZDA 4NK4A 1LEHA 1ZK0A 3R6DA 2DT5A 1TT7A 5DOVA 1U1IA 1W73A 3OIFA 4BMNA 1NWCA 3VH4A 3G1TA 2Z1NA 4XRRA 4LW8A 1ENOA 4U0KA 3E8XA 1JVSA 3U5TA 1YOVB 2Y66A 3QV1A 2B35A 2PGDA 3MWEB 1JLLA 3ZWPA 4D45A 3L4BC 1I3MA 3B1KA 1R0SA 3LF2A 2Z5LA 3ST7A 3IDSA 4J1NA 4D46A 3O8QB 2J3HA 1YGYA 4IZIA 2EKQA 1E3JA 4L74A 4QO8A 4TRRA 3EMKA 1G1AA 1PWXA 3TJRA 3K30A 4NBRA 2GUGA 1X13A 3C7AA
chains in the Genus database with same CATH superfamily
3WISA 4JXZA 1DOZA 1USIA 2WC1A 4N9QA 2ETXA 4G1VA 4LI3X 1O95C 1QH8B 3VNQA 1KQFA 1VPWA 1AB5A 2HI0A 3ECCA 2F55A 4H1HA 2NACA 2BHNA 4QUGA 1F8UA 3L04A 4X44A 4CN9A 4POOA 4DLUA 3BKWA 4L7QA 5AK6A 4AJJA 3PQ7A 1LCIA 1WZNA 4OLAA 1UT6A 2HKIA 4YH1A 1GSAA 3H17A 3DTYA 4YJKA 2WWWA 1HDIA 1H9AA 3P9RA 5IZCA 1KH3A 3H5AA 3NPMA 4S0XA 5JCPA 5FTJA 1CRPA 1V8DA 3K0CA 4JUDX 2I4LA 2J9YB 1ULZA 4GSKA 2FMKA 1L7VC 2O54A 2ZBPA 1PK9A 2CDAA 1A4IA 4Q0MA 4X85A 5DBEX 5EFOA 1S7CA 1ZD5A 4I5DA 3GP8A 1TM2A 2E6KA 2UUOA 5EP1A 5BVHA 3R5TA 1FW6A 3ZQUA 1XZKA 3EVGA 5BRJA 5IPFA 3NKFA 5EIBC 1QONA 2GS9A 1VMIA 4EG6A 2HA4A 4W63A 3HXMA 4O4IA 2K2WA 3Q9NA 3FTNA 1WCYA 5ENDA 1LNQA 2XPCA 3BUSA 3ETCA 3NM5A 3QVGB 5I9TA 4AU1A 1G5QA 2QPLA 2EIHA 3BXFA 4PQRA 2HU8A 3M5PA 3JALA 5C51B 3G17A 5EMHA 4QYIB 1XVAA 1FL9A 4E88A 2JAOA 5BT8A 4C4YA 2HHHB 2VZ9A 2X0IA 4Z4IA 1NJ2A 4G97A 4I50B 4ZHQF 3Q98A 3FNQA 1NVDA 4BV3A 5IT5A 5ICMA 4PW0A 3CUKA 3IPAA 1FFEA 1OZFA 3QHAA 1Z4JA 4X94A 3O3MB 5E0OA 5HKBA 1IBRA 1RHKA 1Z39A 1VGVA 2QN8A 3PD0A 4EMTA 4RJIA 4J75A 3NOQA 3UATA 2MIIA 3ADKA 2IE8A 4AB1A 5JZBA 1OCEA 5KYUA 3W5JA 2F8LA 2XBLA 1JNXX 2OFPA 4D98A 1RRCA 1OY1A 3GU3A 2ZYAA 3SJBA 2FEAA 3JXEA 1JJ7A 3ZC3A 4P6VF 3R7LA 5C5EA 4HATA 4NHOA 3A06A 4FLFA 2JFVA 1FYFA 5E7JA 4BJ3A 1NVVQ 2CFCA 3C6ZA 3EZFA 4FZ5A 1P5RA 3VH2A 4CM7A 4E11A 3AOEA 5J23A 1DGQA 1V4BA 2WNSA 1A5ZA 5KYXB 2DFVA 3OC0A 3PZRA 4R1SA 1GNVA 2RHHA 4GAEA 2X5OA 3I05A 3GVIA 1PJZA 2B5VA 2YXDA 3I8OA 4IUYA 4JSRA 1MIHA 3RG2A 4ZPJA 1XFDA 3CB4A 2J5BA 4DMLA 3CNBA 1E7SA 1M5TA 4G0OA 2FRDC 1RZ3A 3PDJA 2G1AA 1TNDA 4M9QA 3OZUA 1ZCFA 1VXRA 3KOOA 5AR1A 1PS9A 2JKVA 1RQRA 1W4LA 5EXXA 4FNMA 5C46F 3ZCSA 3EZ7A 3O3OB 2A9QA 3DEHA 1O8BA 3E23A 5K2MA 3CONA 4MUNA 4XQCA 5ITZA 5AJUA 3QXGA 4J0DA 1XKTA 2ESRA 1Z6XA 2A0KA 3UJNA 3N2LA 3S27A 1A5AB 4B3DA 2ZB4A 1E3WB 2VJOA 1YI1A 2QP3A 2JFPA 2R6GA 4D1YA 2QL6A 2OB1A 4RAQA 1DCMA 4BFYA 3Q5GA 3ET4A 5ISMA 3ORSA 3M1IA 5H4HA 4X6YA 2I2AA 3UXEA 4CIVA 2Q5HA 2NQ2C 4FYWA 1FU7A 1Z2OX 2V45A 2VQ3A 1ZMXA 2WJZB 4PCVA 3K0HA 1JDZA 1JFFB 3OD5A 3Q7TA 5A5EA 3VO8A 3SJCA 3PFWO 3EXHC 4RJLA 5HBRA 3UHOA 3B36A 4GQBA 4TSFA 4DT1A 3BDVA 4L6AA 5BORA 3CCBA 2G40A 4IJ5A 3VU8A 4WKPA 3IBFA 1Y4SA 3LZ6A 1BVYF 1CK4A 2CLMB 3QW4B 1LPNA 3R3XA 1KNQA 4G0YA 1PNOA 4MRAA 4BATA 2FW8A 3FDZA 3GLHB 2A14A 3ZU3A 3HZZA 4BO3A 2F1KA 3TEMA 3D5TA 2XUKA 1O77A 4G23A 5C34B 1FP7A 1UBRS 3ZYZA 4A91A 4ATNA 1NYTA 1KZ1A 4UBKA 1VMAA 5EL0A 4D0SA 4R9VA 1Z4OA 5L3ZA 2C96A 3UAWA 4BV8A 3LPNA 5TARA 1QIGA 1ZOOA 4I5FA 3GRCA 3IUPA 3B9PA 3RM3A 1DC3A 1OTYA 4WLOA 1JIKA 4ZTZB 4FD2A 4KLZA 4LOAA 2EZUA 1S2GA 2IU6A 2IDKA 4HWPA 4DWWA 1LJLA 1NR1A 1M1XB 2C2KA 2PV7A 3D6MA 4HXGA 5AKEA 3T41A 3WK4A 4F60A 1DC6A 2ERCA 4G5HA 3QA9A 1S8OA 3VC3A 4G5XA 2WFMA 3G13A 4I6JA 4DDTA 1EQAA 3ESBA 4RGYA 3KTFA 2NNWB 4KPYA 3BHMA 2XTAA 2ZM5A 4KI0A 4FZ3A 4JN6B 1YB4A 1JG1A 3P71T 5A9SA 4GMFA 3R5KA 2VQEB 1BGVA 5G0UA 4R5HA 4P0PB 1MB4A 2FSIA 3H2ZA 2I6TA 2VJCA 2D59A 3QOXA 3TR6A 3VMMA 3AUSA 1WDMA 2BR3A 4I46A 4UQPA 4G0MA 3FBWA 4R6WA 4MW4A 5A2QA 2ZTUA 1K0UA 3AH8A 3RJ5A 4YRPA 5I01A 2JFUA 3WGZA 4O8CA 1VE7A 2D7CA 3OE7D 3J7TA 4IV8A 5F33A 1QZUA 2B1IA 5K0GA 1AGXA 3O26A 4AUNA 3DDWA 1XLWA 2A94A 5TJHA 1ZBQA 4FMDB 1KYTA 3MK31 1DC4A 1SVWA 4PSDA 4IUDS 1R9MA 4HBGA 4K9QA 2XVZA 3ZXXA 3FF1A 1SRQA 2E49A 1NXWA 4YP7A 1OZGA 1ZZEA 4FB4A 3LDUA 4DLZA 4EG8A 4KQKA 5ALEA 1ENPA 1Y8QA 1EH5A 1WWKA 3LVQE 4X61A 4QBKA 4TRNA 3BRQA 3D3KA 1MN6A 3EH1A 3I6BA 2XMDA 1DFGA 2ZJFA 1XRPA 4IWYA 4TSRA 5FWAA 5LOVB 3W1WA 1P2GA 1G0OA 2EW8A 2BE7A 2GKSA 4MQUA 4X1IA 5HCNA 3RREA 3X1XA 4AYWA 4HTFB 2B98A 3KSZO 1B6TA 4YP1A 1NPYA 1R6DA 5LMZA 1E66A 2ZSKA 3IAAA 3NRJA 4MO9A 4Q93A 4AWAA 1A7JA 3O2JA 4XIGS 4XQGA 4BYGA 5JMOA 1CJCA 2W6QA 4Q3KA 5JYCA 4HUQB 2GFHA 3IAM1 3JD2A 1PFGA 1T9ZA 4PC3A 1I8TA 2I8AA 3DV2A 4IZOA 1C7IA 1I2MA 3MJSA 3P9YA 5G2OA 4Z51A 5DZSA 2EBWA 2PUEA 2QDKA 1S5PA 1XHFA 1J56A 1WW3A 2A6PA 3V9PA 3ZW7A 4K87A 1YRHA 4FR5A 3V1LA 2RHDA 2FUNB 1G6KA 2O7SA 3BIXA 1EFKA 3A1VA 2VJBA 1KK2A 3WHIA 3G9ZA 1RWNA 1AHNA 3SFVA 1H5UA 5I7RA 4MEJA 4Z4HA 1K97A 2RONA 4R8MA 1SCNE 4NYJQ 5EPUA 2QRUA 3F5SA 4Q7KA 3DA8A 2IHJA 3VV3A 1ZOLA 4B87A 5JOQA 4KVAA 2QD4A 1VJTA 4Y2GA 2CSXA 3N3BC 2I67A 3QMPA 2QI9F 5C1PA 3ZBPA 4EA7A 5L3SB 1JBQA 3LDFA 3OWXA 3OETA 3ICEA 1CPYA 3U3DA 2A4KA 4C6TA 3BK2A 3JQ8B 4ZIRA 4PXYA 3EFOA 1NI5A 3IUNA 4YRBA 2JD0A 4Y6GB 3FVQA 3V8QA 3RIYA 4J3JA 3I9FA 1M2VB 2PBZA 3NTUA 2OQRA 4JYBA 4DNQA 3VR4A 5IYZB 3CU5A 1KO7A 1NDHA 4RJ2A 3TTVA 5T5QA 3KFXA 4UOEA 1S8FA 1DO2A 1LSJA 4CN8A 1RZRD 5HTKA 1KO4A 4D25A 1U7HA 2EWMA 4Q9KA 3TX6A 3WGTA 3R0JA 1OXTA 1ZC3A 4GXQA 3C3PA 3KXLA 5LZ9A 3EWIA 4JI5B 2HWXA 1A04A 3PHGA 1L4GA 4QT0A 1ZS9A 2ZVJA 5T4BA 1XZFA 4BQPA 5JMWA 4BKPA 4D8TA 4YK7A 5AHOA 3G2LA 1TA0A 2NAPA 4W7HA 4A82A 3DZKA 4EH1A 1T0UA 2C97A 1CY1A 2WYHA 2EJWA 2JCGA 3T3HA 5MN5A 3OZBA 3H9UA 5U4XA 2X19A 3IMFA 3Q87B 3WVNA 5LMNB 2Q1YA 2X4LA 3NWPA 3I2IA 3KZ1E 2EU8A 2P5YA 5HE9A 5J2UB 5F7XA 2IHUA 4NCXA 1F9EA 5IT9A 1Y33E 2HIMA 1RRKA 1IYZA 2IPOA 4YRZA 1AZWA 5JQGF 5LP6B 3DCJA 4YA6A 4ZV7A 2OK8A 1G7CA 1GQYA 4QLBA 1ZP6A 1IZ8A 1SXJE 2OXTA 1EA5A 2Y0CA 4WPGA 4R1QA 4Q82A 7REQA 1A5BB 1JMVA 1RXYA 4I1UA 5IM5A 1H4TA 3K2EA 3K0FA 3NXKA 2OCGA 4DM4A 5ITWA 2A1TR 3ZVMA 1Z2PX 1PWHA 3RVKA 3TL6A 5E4YA 3K09C 5HCUA 3S55A 3UYLA 4K3VA 5DDIP 3WIBA 1Q7EA 4YBZA 4ZQHA 1KQNA 5BW5A 1A2QA 2WTMA 2ONCA 4FT4A 2XDQB 4FHDA 2CE2X 3LY7A 2QYHA 5K8IA 4IDHA 3D4BA 3LL7A 2XMRA 3LVRE 2IUUA 2BFCB 5JXJA 3K0EA 1J8DA 1JQLB 4OHRA 2GEDA 3TKYA 4WK6A 4JYCA 3KUCA 4I5EA 5ELXA 2Y1WA 3PNVA 4ZVMA 3L6OO 1L6RA 4DIUA 1AUXA 1U7XA 3PWTA 3JQGA 4JP1A 5CT9A 4EECA 2GAOA 4CKCA 1QHSA 4MHSA 1K6EA 1J5XA 1NNLA 3MMNA 3K1JA 1VL8A 1RBYA 2BIFA 3FPKA 3ZR4B 4FE7A 1TCAA 4JU8A 2KHZA 5CA1F 1BFUA 1UJCA 2MSEB 4J7AA 4LJKA 2EKDA 2HIHA 2CYCA 3VR2D 3U09A 3P94A 2YY5A 4AD8A 1ZDMA 2OFWA 3BQMB 3KQHA 3IHTA 3ZV3A 4D92A 4N54A 3H5IA 1OT3A 1XCOA 4NAHA 1Y7IA 3HGQA 2PZKA 4LDPA 4YWHA 3PR3A 1RKVA 1NW5A 4BNFA 2JIOA 4MWSA 3V7UA 1G8KA 1UBJS 1JAYA 1PJCA 4RADA 2OBBA 2AG0A 3WIDA 5J4HA 1HG0A 4QYTA 1L8OA 1SG6A 2H4JA 1TM5E 5B3AA 1D1QA 4D96A 2C3YA 3G88A 1SBNE 4TWJA 1UJ2A 3IQGX 3QW2A 4XFKA 4EFMA 1VIYA 5EVJA 3QA3E 4BMPB 2UVDA 2N75A 5EUBA 1B7GO 1KJQA 1I3OA 3KZCA 5EJAA 3WYDA 3I6MA 4LVUA 1LDYA 1F2TA 3D8NA 3EGEA 3EF1A 1YFKA 3KBOA 2OL4A 3HZHA 3NX4A 3O95A 4RDXA 4GKKB 4B32A 1Q0LA 1COZA 3TIXB 5DGXA 4Y2TA 1FPQA 3QX9A 2PSJA 3NANA 4CMGA 1WUIS 1CFJA 1HT1E 1U90A 1PJTA 4H7HA 4J0FA 2NPIA 1ODSA 1KR5A 4P4SA 1OPXA 2IS6A 1JPJA 1S4QA 3D2BA 1TGYA 4N5HX 1DKOA 4BBZA 3ZX5A 3HCCA 3T0GA 3D6FA 5EERA 1XA0A 1JHDA 1M2FA 2PPLA 2X77A 2Y93A 3CUVA 4A8JB 1U3TA 3AIMA 3MMSA 5CA1B 5JSZB 5FOUA 4F6CA 2IZ1A 3EPRA 5REQA 4JEHA 1QOQB 2H1FA 4FEYA 1YR1A 5KYNA 3GNTA 4E2XA 3BBPA 1ZM9A 4I9UA 5H3HA 1Q44A 3AHDA 1EJ6A 4RSGA 1T5OA 4TKUB 4CI0B 4ZGWA 3IQEA 5MGBA 2YZ2A 2PD4A 3UXMA 4TOIA 4IIFA 4B4DA 1BG6A 2O5VA 4EZIA 3DR5A 1YR8A 3O4FA 1PD0A 3H86A 3TTXA 2F9FA 1WXDA 1U3UA 3IRUA 1PZFA 5K45A 1CNMA 1XVVA 2G63A 3JQ7B 1I2BA 1C30B 4AZ3A 3SHOA 3FPEA 3INRA 1OJLA 3OQHA 1ORTA 5CVCA 5AXDA 1VCMA 1WXEA 3PQFA 1GN9A 2CWWA 3F4LA 3ELUA 2XRZA 2VN8A 1QRDA 3T1QA 1Q6YA 3E18A 4PGFA 3GR6A 5KINB 3NBAA 5FCDA 1AIPA 1SC3A 1YRQA 1E2IA 2BWJA 5C8XA 1A8SA 4IIVA 4JKIA 4DARA 1IBMB 5DSTA 1AGYA 2AUNA 2YKGA 4NMMA 4MLPA 4RF4A 1DZ3A 4QQRA 3LZCA 1YS9A 3PFFA 3FYSA 1H4VB 5J2TF 3T3PB 3VYVA 2FPOA 2OORC 5BMVA 3TPZA 3A3KA 1G8JA 1AGPA 1KJJA 1UFVA 2WMNB 3FI9A 1NQTA 5DHQA 2BGJA 3AJDA 4A0HA 4H3HB 3HRHA 4AJKA 4QGHA 3HM2A 5FYDA 2QR5A 4W1RA 4B3MB 2F64A 1NFRA 2YTZA 1CR0A 3MWLA 1AX9A 2KJQA 4QEZA 3EDOA 4QYMA 1E3QA 3MSCA 1N2XA 2NO5A 3ORYA 1A5TA 1I4OA 3K5WA 4TRJA 1ZU5A 4PN3A 4RKYA 2IOFK 4MQBA 2DTDA 2ZR9A 4LHXA 4L72A 4ZO8A 1UAGA 1ORDA 4E08A 4MQ6A 1NF2A 4FPXA 4XDYA 4AKEA 4EUKA 2OBXA 1T25A 2WJ4A 5FPQA 2VJKA 1PYGA 1V3VA 3AG6A 3NALA 4OHOA 3VR4D 4EEKA 3I09A 1UADA 2ZBEA 1E96A 2L19A 3DS8A 4NBTA 4HBZA 4OHYA 5JD6A 1CDZA 1UFQA 1E3LA 3AM5A 2ZWMA 1WP4A 2DR3A 2CNWD 1I80A 4X20B 4PX5A 3QG1A 2DZDA 8OHMA 3E0XA 4OFZA 1FYDA 1OUMA 1F8GA 1JDTA 3W2EA 1W88A 4TLAA 1HWYA 1B2RA 2Z2ZA 3O4RA 3UYKA 4DAOA 2ADOA 2IXBA 4YVFA 3OQIB 3UMMA 4MOWA 4L9WA 2IDJA 4NENB 1XO1A 2V97A 3BGWA 5JXWA 4YMTA 2ZWAA 3K4PA 4W5WA 5CM9C 4ZEWA 3BFKA 3FHOA 4OKSA 2NV0A 3BXPA 5F21A 1FNNA 1FMJA 5DLQC 3WGKA 1HDZA 1LFAA 2G1UA 4G65A 4EW2A 3T5CA 2ODPA 1R0RE 4YRGA 1VIVA 3SYKA 4WCDA 1RAIA 5AKGA 4ZYLA 3H1AA 4EFNA 4JYMA 1KI1A 3JRNA 3O8OB 1GRVA 1N77A 2XMSA 3OKCA 3GAZA 3OC6A 1IVSA 2JIQA 2NT3A 3FYTA 4S2EA 2IU4A 1KZ9A 5HM6A 5JFGA 2P65A 3H0KA 4O2LA 1QCCA 4OXXA 3K5HA 5LQSA 3SHVA 2PKQP 1CUAA 3BHJA 4H4DA 4Y1RB 3ME5A 3E82A 5KO2A 1I5RA 1TVMA 5E7MA 3AERB 1QC5B 2AW5A 4WKOA 4JVMA 2FG6C 3S2SA 1PTJC 1SAYA 3DMNA 3ZUPA 2BFNA 4YN3A 4FYYA 1FP6A 4I4TF 4JZKA 3K6SA 1IUOA 4HR7A 1TLFA 1ZOIA 5A03A 3A6KA 3DC7A 4CLRA 2W8ZA 5K3OA 3WMFA 1T9KA 3SKXA 3RUPA 2H3HA 1CY4A 3AV3A 3GT7A 3DXXA 3NTVA 5AI9A 3W5BA 1EDDA 3N39C 1R8QA 4TL9A 3SXPA 1HLGA 4LRQA 3U19A 3OQPA 1J5EB 1N1GA 3RRFA 3KSUA 4KX5A 1BXRA 4BX0A 4XVCA 1XLUA 4N5NA 3TW4A 1D1TA 4HF7A 1QO9A 3PEEA 4PGMA 3IB6A 2C2HA 3DPIA 2WSMA 1CQXA 1E3IA 4KQ2A 4U7WA 4MNTA 4X65B 5AKYA 1E3SA 3SG0A 3L07A 5DT9A 5ALKA 2GM9A 1TKBA 3U3ZA 5JCOC 1N5OX 1SHJA 1U8ZA 4MR9B 4N7BA 2HA6A 4D8UA 4DUGD 1FOEB 1XIVA 4GXRA 2YUIA 5EVCA 4FMCF 1H9BA 4LBVA 5HKLA 4XAQA 1HTWA 1G291 3EQ6A 3MCAA 2SKDA 4PFSA 3B3JA 5DFAA 3HABA 4JXKA 5DYTA 5CT6A 2OB2A 4MZXA 1ZD1A 5TS3A 2FPPB 2W83A 4LPSA 2QUZA 1HURA 2X40A 2ZS8A 2Y8EA 4R81A 3K1AB 2VT3A 2O5RA 5DNAA 3ZDEA 5JDCA 1T3LA 1W6UA 2QMQA 1DXYA 2YV4A 1BXGB 3D7RA 3P0EA 3JD4A 3QI2A 1K7XB 3OTQA 3FHTA 3I0ZA 4YPVA 3T7CA 1BXGA 1M10A 5K0CA 1MBZA 2VC2B 4I2NA 4NYMR 1YJBA 5CHYA 5TDHA 2WYOA 1MB0A 3BG5A 2I3ZA 1S01A 2P3OA 1TZKA 4CMAA 4BECA 2Z57A 4YCMA 3RK1A 1VB5A 1XWFA 3CJRA 4OM7A 5FRDA 3T4PA 1ZW1A 3M81A 3BFVA 3SR4A 1PJAA 3MOGA 4UMFA 3ZLTA 4L0MA 4PLYA 4KR3A 3E35A 2WM2A 1S9HA 4G5RA 5TE9A 4J43A 4EAQA 4KNYA 3UBMA 1YHNA 5BR1A 4YV1A 3B1VA 4IGKA 3RSCA 2PSDA 3F4BA 3ED1A 1P2FA 4LHYA 4MWBA 1ZWKA 3VU0A 1W6RA 4IMPA 5AWFC 3ORRA 5EQJB 2YIDA 3GAMA 4KN9S 2AJLI 4U2BA 4D0LB 3B1FA 5EUQB 4YT2A 2VWPA 3O1HB 5BOVA 5I7WA 5C18A 2ACWA 2C4KA 3HO8A 1OXUA 3GARA 1KEWA 1UK6A 4G4SP 3GGPA 4G4GA 4L16A 1BXRB 4LVCA 1PNQA 2DH6A 5F3RA 1TL7C 1D0VA 1E9BA 3RLFA 5D6NA 2G4CA 4LF8B 1T1SA 1YDWA 1YL7A 2NZXA 3ZNPA 1O3YA 4Q9NA 1POXA 1BEEA 2O7VA 4FKBA 4WKNA 2Y99A 5JD3A 5LCXA 1R4MA 3AWDA 4EW3A 4YRIA 5EXTA 1T3TA 3X1MA 3AF4A 4UPVA 1DG9A 1JEDA 2CUKA 3C0KA 1P91A 4F8EA 3ZI7A 1R0XA 2QU8A 2A86A 3GJQA 4YXFA 4DWJA 1NDQA 3WG9A 1EFAA 4N0QA 1WSDA 3GEDA 1KK3A 3FB1A 3PF9A 5BN1A 5KC8A 1EQUA 4K88A 1U7PA 5JAOA 1AA9A 1PW5A 1MQ9A 5JVDA 2W2NA 2V7QD 3ZQ4A 2G5PA 1OC4A 4K9OA 4YJHA 3ZLUA 1Z4QA 1UJNA 5EYPB 1J7KA 3DVRX 3EHDA 5HMMA 4BVHA 5I9LA 3M5WA 3JQRA 1ZUIA 3IUYA 4D7AA 1GP2A 4B3XA 2X5XA 2WP8J 3W34A 2P2NA 1JUDA 5CVTA 3FOZA 1CUZA 1IB6A 1IY1A 2WD8A 3PD7A 4WIAA 5EIFA 3TW8A 7ABPA 4IQ0A 1VC2A 1YZLA 2C2WA 4DXHA 4K6HA 2B69A 3KZMA 3NBZC 4E22A 4LXIA 4F93B 4MJ3A 3KBBA 4UEJA 1QGUA 3KHUA 1RWQA 4IH1A 1DAKA 3VQTA 5CH3A 4DBVO 5AHKA 3UAVA 5A5FA 5BQ3A 2QTMA 3SHTA 2DUUA 1MGOA 4L8YA 4HYTA 3PJRA 4IO0A 4LHEA 3SJUA 2YV2A 2YOFA 1FS4A 5BWCA 1SXJD 4YDRA 3ZGXA 4DJEC 2GCOA 3D7KA 5DHFA 3D3WB 2QRVA 1A9PA 4GP9A 3U3KA 4OXRA 3IEPA 4HLQB 3CKKA 3HVKA 2J0EA 3NJ4A 2HRCA 5EGSA 4L4UA 4PSVA 5A2GA 4ZT5A 3TDKA 2Z2IA 1TAGA 3M6LA 3H2IA 4DJDC 1X9IA 1RAGA 4N5IX 5JWOA 3S2YA 2IT1A 3CRW1 2NU8B 5KNBD 4DR4B 4C7OB 2AQHA 4E14A 4U2KA 4RCVA 1XYYA 3HKEB 1RIIA 5IWCA 1VKHA 1KE1A 5JAZA 1BXZA 2QTHA 2ZWPA 4NABA 5DW3A 4ZCMA 1ULUA 2Y71A 1K5DA 1N2CE 3EGXB 2J87A 3DLAA 3GA7A 4OYLA 1VKJA 3GJ3A 2ZBFA 4P7BA 2WU1A 3ZLVA 1ISGA 1E79A 1TLTA 2C98A 2OWDA 2XCUA 4OH1A 1SB9A 1V2HE 3CZ5A 3IC5A 2EWWA 3DBHB 3H2KA 4G07A 3SSOA 3AKZA 2HW8A 2I7XA 2EFCB 1UBLS 3KB6A 1ZRHA 1M33A 2V5VA 2ODTX 4RPLA 5K3AA 3RSQA 4EWLA 1QTRA 3B6MA 5H16A 1JQ5A 3MMXA 2WYIA 3HSSA 3MWJA 2Q3MA 4UXIA 4WY2A 4DV2B 1GNRA 2C5BA 1E1LA 1MORA 1Y42X 3IQXA 2C4MA 2OAEA 4NS1A 3SZUA 4PS0A 1SCDA 3L1IA 5KEIA 3RBZA 2OUIA 2P1ZA 2R7KA 3P45A 3ABZA 3ISJA 4PAGA 4TXNA 1Z4LA 4C5BA 4UASA 5CD1A 2Z8YA 4W9RA 4IAOA 1YB1A 4GZLA 4XM2A 2XY4A 3ZS8A 2UZ4A 1GGNA 3I34X 1G16A 4KFTA 1U5CA 1L5YA 2ZFUA 2V7VA 3HP7A 2CMFA 2JJQA 2N3ZA 4L95C 4KXWA 4QJBA 5EZYB 3DOOA 4DQUA 5GV7A 1OHHD 2C4WA 1YR9A 4BPRA 1A9OA 1L9XA 2OAGA 2PMDA 2FX5A 2Q2NA 1CB0A 2W2TA 3PYMA 3U3JA 1ECPA 1J90A 4QXQA 3GA0A 4BDTA 2A0WA 2HMWA 2RB4A 2H06A 1NFQA 4M6WB 5EWMA 5EJIA 5JROA 5KNDA 4RD6A 3LW8A 4GZ6A 1FFYA 2J5XA 1GG2A 1E0AA 5B2FA 4CKEB 4AQ7A 4TZ6A 4FOOA 2JDID 2PYIA 3KELA 1NW6A 1SXJC 3E0QA 4QAQA 1HXHA 4RL4A 3U3XA 2HFJA 3G2HA 3OFKA 3ZE8A 1XKXA 2O14A 1XQWA 4RABA 4DSZA 4ZI5A 5CA0F 4HWGA 2IIPA 4QDZA 1AQIA 1O97D 2JAPA 3RVNA 3NGXA 9LDBA 1RYDA 3EXEB 4RD4A 4V0ME 1B6GA 3V7NA 3MCUA 1PZHA 3DOUA 1GUYA 3KKLA 4ENTA 4KO3S 5K3DA 4ETMA 1L8AA 2XMZA 1A8HA 3DHWC 1Y3AA 4HFJA 2FZKA 5BV8A 4BFSA 3L6UA 4DWOA 1ORIA 3IBYA 3HGTA 2BAGA 3GQBA 4GVXA 1DHRA 2OXIA 5ITVA 4B48A 1U7TA 2NQ8A 4FGSA 3DVLA 4WESA 1RW4A 2QZJA 2XUHA 3LO5A 4LS3A 3CNLA 1LD3A 4LC9A 2J8ZA 2PKEA 5L3VA 3U1BA 2A78A 1LLQA 2FSFA 3F97A 2WW8A 3PEUA 2W37A 5THXA 2FP4A 5TT1A 3FVTA 3QWHA 2E48A 2ZS9A 4P82A 2VDQB 4XB1A 3T7DA 4CF4A 4ECEA 5IH7A 5JAUA 2C2MA 2OMEA 5ICEA 1WO8A 1P7WA 4J0EA 1OLSA 1AZLA 4QICA 2LXNA 4EP1A 4OKIA 1IL0A 2IKSA 3CF2A 4ZV4A 3NATA 4MQMA 1VJ0A 5FHRA 2JJ2A 1JV2B 2X86A 5HOEA 1OYOA 3D7MA 2A1TS 5CHEA 2PZJA 4Q1CA 4BQSA 2FR8C 3ZCTA 4R0VA 2B1GA 2EKPA 3BDAA 3TLEA 3TLGA 3NS7A 1A72A 1JKXA 2CL5A 2UUPA 4FFLA 2H1SA 3ROQA 3UW1A 5FDFA 2Y77A 3DZHA 3FSGD 4HAYA 4BO2A 5JECA 5CJPA 4KR0A 4U8HA 2Q5EA 2A5JA 1XEWX 5FT9A 5DM4A 1SOAA 3KQKA 4R7ZA 4CMIB 3DEFA 3OT4A 5MFPA 3QFFA 2UUBB 4I8IA 1JX6A 1FTNA 2JFYA 1Q11A 4RM3A 4CRWB 1M74A 3NHFA 2XCTB 4Y2JA 1GPNA 1NC3A 3PFKA 3WL5A 1JIUA 1FRFS 4Z3DA 4RSMA 4G2NA 3CVJA 4NR0A 2W90A 2VK8A 2WTEA 3G9XA 1GPUA 3Q8LA 4M22A 4WEQA 1XEXA 3HJAA 1G38A 4OHXA 1WV1A 2YRWA 4BEBA 4IVPA 4ZRDA 3VPAA 4YMUA 3AUKA 3QKRA 5AJWA 3WLPA 1WHSA 5HK8A 5EMMA 1W8DA 3VZQA 3GJRA 5BYBA 4FYHA 4Y2SA 4XPIB 2WJWA 2ZP1A 3I9KA 1CUYA 1N9ZA 1KS9A 3DW1X 3F96A 3PJEA 3RROA 4E1BA 5LU8A 2CEAA 5ER6A 1HYBA 3GJ5A 4HN9A 2WK1A 4J29A 2HHLA 3QPUA 3HCWA 4PF1A 3GBVA 3BJRA 3LLSA 5A3SA 3UHPA 1SFRA 1N5KA 2PUDA 3IAFA 3OSZA 2W8BB 4QDUA 3T6KA 3NM4A 2A92A 2XA9A 5AUNB 6GPBA 2VAXA 4RAOA 4G63A 1NURA 5K9ZA 1QFXA 2HCJB 4GYJA 4QIHA 1MW8X 1O7JA 3KRTA 3MJFA 2WJVA 5JIBA 2ZR8A 4FCCA 2LW7A 4HHEA 5EJEA 5IXYA 4QJ5A 2Z8XA 3G5LA 4UUAA 1VE3A 1V39A 1CRZA 2XMPA 1I2DA 3AU9A 3K6KA 1U1DA 1TEZA 5L40A 4D3ZA 2B4QA 1AKVA 1MEEA 1NULA 2KBEA 4IDQA 3CEMA 3KU1A 3Q3IA 4KHZA 3RB8A 3T3GA 2G5TA 3NI2A 3TW0A 3UN1A 3UW3A 2GA9A 5TLSA 3MJEA 1C4OA 3IV9A 5HGXA 3EFOB 3OIYA 2HSGA 2BTEA 4P93A 3EVEA 4H6PA 1IOWA 4EG1A 3PIIA 3VJMA 2GNPA 4IDAA 3RC2A 1WB5A 2ZCUA 3A6LA 3EY4A 1LK5A 2DPXA 2IWRA 3P2EA 3AM4A 4IUBS 1Z2DA 2P2DA 4JR0A 4QPCA 3C5HA 1UDBA 4OAOA 2VF7A 1QPZA 4ZAWA 2OENG 1KYIA 1NJ6A 1K5PA 2HZBA 3E9EA 3EHEA 1A8UA 2XGMA 1ZICA 1CB7A 3A1TA 4IDOA 4JITA 2R1ZA 3TQIA 4RE5A 1ABBA 3KEFA 1M8JA 2EP7A 3CJTA 3LCJA 1RYYA 1SCAA 1E2EA 5B4TA 2QZPA 1NYLA 3LSTA 5I7AA 2P6RA 5EPEA 2OV4A 3H8JA 3WICA 5KOIA 4I3GA 4NAUA 3PCTA 2PX5A 1JLHA 5CVVA 1J9ZA 2FNAA 1MGPA 3HE3A 1K75A 4C43A 1U0SY 5BSEA 5DEIA 3R9WA 3MN1A 1LUAA 4P5DA 2HD4A 5HIIA 1QXSA 1F12A 5CIYA 3DZFA 4B33A 3DSRA 4OA5A 3G59A 4PYLA 2G9VA 1MRSA 4C29A 1AKTA 1KOGA 5TS2A 1NUQA 3FWZA 2JFFA 4HN2A 1P18A 2R11A 2BMJA 2H7XA 2VUIB 4B2IA 3KQNA 1WMAA 1R4ZA 1E2HA 3H5OA 1OU4A 2R60A 3KJGA 3U44B 3OE5A 4RA6B 1RJEA 1SOUA 3WMEA 2WIBA 5EIWA 1NVMB 2Q28A 5BWOA 4OB8A 5AI6A 5GJBA 3S2FA 1PG0A 4G5GA 4EENA 5K4GA 1SXIA 1NI4B 4AQYB 4GZ3A 3OPYB 3CPEA 5ALMA 2RC5A 1GY8A 1PU2A 4J4TA 2SBTA 1YZUA 3KPWA 1ZUNB 3PCRB 2PZGA 2EEZA 4KQXA 1XC7A 3RABA 8MHTA 1WEHA 4JBWA 1DAEA 4XD7D 3V34A 5FWNA 1IUKA 6ADHA 2JBAA 1BW9A 2VDWB 4IJUA 4NICA 2EG9A 5CDFA 2AMJA 1GU0A 5JMTA 1JVBA 1MAVA 3LPAA 1P7CA 2BC9A 3AW9A 4CG0A 4RYLA 2UUAB 3RVSA 3ANTA 4UBOA 2CFOA 1NBAA 1II9A 2BW0A 3GO4A 3K6JA 2GCOB 4TTQA 2G83A 2QG6A 2PZFA 4Q05A 5FIUA 3GFSA 3H3XA 5HRAA 3WRYC 2PKWA 4TN5A 1SVLA 1T3SA 2GX6A 3HKBA 3B8HA 1TF7A 2ORIA 4MYHA 1PSWA 3UFBA 4B2PA 1CVRA 1WX1A 1ONPA 4EPXA 1QZ3A 2A9JA 1XVIA 3PE6A 3GP3A 3WBJA 4BEWA 2O3RA 1QOPB 3F90A 2KYRA 3AZPA 2GARA 2W6PA 4O2BF 1AQUA 2W71A 3IT3A 4AWBA 4JOBA 1NQWA 1JTEA 3E7WA 3N5KA 4V2IA 4YDSA 3C39A 3UK2A 4EYOA 4LCJA 1TYBE 2VHYA 1NX6A 2GHRA 1D3AA 5AKZA 5DP1A 4B34A 1WSBA 1TQ8A 1PK7A 1P81A 2DU8A 2QWXA 5AKLA 1E7RA 4XEUA 1IE3A 2MYPA 4N3BA 2Q1TA 3FCCA 3U62A 2UAGA 1FFAA 1Z5NA 6PFKA 1IN1A 3KQSA 3RJMA 3C3AA 4JL5A 4D6PA 3B3AA 2IHNA 2IYLD 3WL7A 3MEQA 5E6UA 2MSKA 1QC5A 3N2NA 4X8HA 3MVEA 2QG9A 1ZSNA 2VNKA 4N03A 1QLHA 2P67A 1E6WA 4CEJA 1W1WA 4A7PA 4BL5A 4F72A 3D0OA 4FOPA 2HQRA 5DEOA 4C7OA 1E94E 2IGTA 4MV1A 4DRZA 2C4UA 3CUEF 4TZTA 3S2ZA 1QRAA 2VCEA 4ZCTA 3TUZC 1TAHA 4MTCA 4G0WA 5CLJA 5EE9A 1R64A 3UJDA 1CJUC 4BEVA 4U3JB 4RD2A 2NXNA 3T7RA 2WI8A 3CH4B 3D3EA 3RV3A 3MT9A 3PDCA 4MVJE 3NAZA 2AZDA 2NU9B 1VG9B 3PC4A 3ENQA 4H4CA 3AR5A 4M1TA 2J7KA 3CG4A 1OTXA 3T7TA 2LR0A 1J1ZA 1DQSA 3OZXA 4PZZA 3QVMA 4OI2A 2NZYA 5CM2Z 1FK8A 4GR4A 1S2MA 1DEHA 4NENA 5C5DA 4JB8A 1OF1A 4UHEA 1O95D 3TGWA 4MVJG 1W88B 1UKCA 4KOAA 1KFCB 3H5TA 4YRJA 4IXTA 2EFEB 3THXA 4Z4EA 4KUHA 4BP8A 4DQKA 2MYUA 5IJ0B 5TQ2B 4HC4A 2R8XA 4ZJZA 2V8BA 1KSFX 2OO5C 5KIAA 2BSAA 5E7QA 4TMTA 4HRAA 2RGXA 4RKWA 1BEUB 1S02A 2JA2A 2UYOA 2PL3A 4GBMA 2DSTA 4I4IA 3VPGA 3ZG6A 3ZWOA 5A7HA 1E2PA 1O1YA 1WMDA 3P2JA 4IDDA 4LJAA 1C80A 4UTOA 1C4KA 5LQAA 3ZXYA 3K1TA 3U3OA 1Y9AA 2C84A 4IX1A 4CG3A 4IP0A 3ZQ6A 1ZK2A 5HZKA 1TDJA 2ERXA 3HB4X 4PCAA 4F2DA 1J22A 2JFWA 2AFVA 3E22B 1DJQA 5GP1A 3AM1A 2XV1A 5JW6A 5FNVB 3W9UA 5A1TA 1P3JA 2GLXA 2MYTA 3AR4A 2Z04A 5T6MA 2QX6A 3JQBA 2PGXA 3VNRA 3IR5A 2GCGA 4EDFA 5BV0A 1GSOA 1PDOA 1BEZA 2JLSA 3DZDA 3H8SA 3OCXA 4L57A 5EIBD 1V7ZA 3EG9B 3P96A 3Q0EA 2I03A 3VSCA 5I7VA 3DT6A 4UEQA 1N5RA 2IYTA 3LT5A 4K9NA 1JEEA 3JD3A 1YAJA 3DL7A 3K9NA 4XQ0A 1V4NA 4J2OA 4EG0A 3SPXA 3CFYA 2BGTA 2J85A 1WJGA 3DFKA 4RIHA 2BCEA 5HGJA 4YJ2B 2QD1A 3AEUA 3DFFA 3B48A 2ZEJA 4NZNA 2WMYA 1NI4A 2DPGA 3O1JC 1FDOA 2FB9A 1AH2A 3D8RA 3HJNA 2OD9A 4HY3A 1DMSA 1MJNA 5CUQA 1RM5A 2I6GA 5GGYA 1N2EA 2OXFA 1CUJA 1F17A 4S12A 1KYWA 1TQ4A 5JRJA 1K63A 3A9TA 1ISFA 4PICA 1L8QA 3SSNA 3A6GA 1H66A 4C7VA 4R9UC 2OHVA 2PVCA 5FUQA 4AI6A 4OHVA 2VHUA 1COWD 1YF3A 4Y0AA 5IDVA 1I7DA 5CBPA 1GGVA 2AZTA 1SG0A 1NY6A 1KF0A 3CG0A 2A5LA 3KOUA 4WZAE 2NXCA 2NPFA 5LQUA 2FZCA 4EMBA 1OFIA 3PNOA 4JVSB 3ELBA 1YL5A 2A0XA 2DEUA 1W5BA 1YE8A 3IPXA 5CLHA 1J4AA 1M6HA 4CV2A 3ZZNA 1IAQA 4EUHA 2CV1A 1Q7RA 2ZSFA 3SYNA 2JGJA 4DMHA 4HXEB 1G59A 5D3KA 3QH4A 1Z12A 1B74A 2X0RA 4OGLA 4Q7EA 4P4TA 5JS6A 1FDSA 2O0KA 3TOSA 3SC4A 5L53A 4UKDA 4G56A 3KE9A 3ZZ1A 3DTTA 4QL3A 5KB3A 2XF8A 5D2CA 4CT5A 2D8AA 3P4UA 3A7EA 4TL7A 3WWDA 2YY7A 3NASA 3JS5A 2J30A 3H9BA 5LLDA 2B21A 5COAA 1O94A 2DHCA 4BX8A 3I0NA 3O75A 3BMOA 4X5OA 4LZLA 1DPFA 1V1RB 4Q7MB 6CHYA 4Z9BA 5JS7A 2H4WA 1IOVA 1TM3E 1DBSA 3VKUA 4MA4A 4Z1OA 2PK3A 4RHFA 2OV1A 5HHTA 5K0FA 5K6AA 3WYBA 1HEUA 3KAQA 5ECYA 1C9MA 5JWHA 1OPRA 4NE2A 3MJHA 1R3DA 2W11A 5F7JA 3N1UA 3X1ZA 2VJDA 2CL0X 2BCJQ 4O08A 3WAKA 3FTQA 1BFDA 2JI7A 3T7SA 5JJKA 3PEVA 4YAEA 2C2YA 1JSZA 1XEWY 4IHKA 3SXUA 4AF7A 2W4QA 4LYFA 1KGSA 5A3JA 1NQUA 3P32A 1L5FA 1G42A 1C1YA 1BDBA 1U9IC 2EZ4A 2Z3WA 2MSNA 2NYRA 1XQXA 2B7BA 2DBZA 4RK7A 2C5LA 1P1RA 4EVSA 1V9CA 2P0YA 2MDTA 2ECOA 1C50A 3BE8A 4NG5A 2CMGA 2BZ0A 4QBTA 4RQTA 4BFZA 3REGA 1TUBA 3VDRA 5H59A 1VLHA 3E3NA 5L3QA 4BTVA 2NVWA 1NMXA 3CV3A 1SA0B 2VK1A 3A25A 3L1VA 3O2NA 3SQLA 3T34A 1TJ4A