2NTOA

Structure of the glutathione transferase from ochrobactrum anthropi in complex with glutathione
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
b'MKLYYKVGACSLAPHIILSEAGLPYELEAVDLKAKKTADGGDYFAVNPRGAVPALEVKPGTVITQNAAILQYIGDHSDVAAFKPAYGSIERARLQEALGFCSDLHAAFSGLFAPNLSEEARAGVIANINRRLGQLEAMLSDKNAYWLGDDFTQPDAYASVIIGWGVGQKLDLSAYPKALKLRERVLARPNVQKAFKEEGLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase
publication title Role of Ser11 in the stabilization of the structure of Ochrobactrum anthropi glutathione transferase
pubmed doi rcsb
source organism Ochrobactrum anthropi
molecule tags Transferase
total genus 75
structure length 201
sequence length 201
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2ntoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ntoA01
3C7MA 3QCPA 4XIHA 2IFQB 3P90A 5G31A 5LNKe 3CTFA 2C3NA 3FR9A 3LWAA 3DEXA 3M8NA 3LGCA 2K18A 2C80A 2P5RA 5KEJA 4K6XA 4Q5RA 3F0IA 4G19A 4I2TA 2IMDA 1XWGA 4JZQA 3MNGA 4IN0A 4ID0A 3W8JA 1XBSA 5A4VA 2H66A 3F63A 2GSRA 5DQYA 1OKDA 1BX9A 2G2QA 3HA9A 3UVTA 4OFTA 3ZVJA 1U88A 2LRCA 3APSA 2VM2A 1LU4A 1USBA 2V6KA 2H1DA 1RQMA 5KN3A 4XS4B 3GSSA 1EWXA 3K8NA 1X9WB 2JADA 5J4UA 5IMFA 4K7NA 3O6TA 4HUAA 1AC1A 3W8SA 3HVVA 3HCZA 4GRFA 1YEPA 2K8VA 2DJ2A 2RUFA 2CA8A 2H0GA 3KMOA 5HR1A 1B8XA 3D21A 1DE2A 1MDJA 3HY2A 3J7Yk 3L4NA 2BTOT 3GX8A 1ZZYA 4ILFA 4OD7A 1XOAA 5ELGA 3Q18A 3OR5A 2GVPA 2K8SA 1PA3A 1ZYEA 4ZL8A 1R26A 2H76A 4MMMA 2H72A 4N0ZA 4P3YB 4MPFA 2IMKA 2HRKB 4H86A 3VPQA 2QKEA 2JZSA 1PSQA 3LFLA 20GSA 1VF1A 2ON5A 2H70A 4GSSA 4I2UA 5JCGA 1H4OA 5DJMA 6GSXA 5ENUA 1F9MA 2PN8A 1PL1A 1YJ6A 4EC0A 4TR0A 2CQ9A 3CTGA 3ZZXA 2YZUA 3GN3A 1V9WA 3TJJA 4D73A 3WGEA 4FO5A 4GTUA 2ES7A 5JWRB 3IR4A 4IJ3A 1OC9A 4ZILA 1JLVA 2H1AA 1HNCA 5G5FA 1ERTA 2WFCA 4K1FA 3FR3A 2H6XA 14GSA 3ME7A 2C3QA 2RLIA 1ZYQB 2H1GA 3HDCA 2F51A 3D6IA 5F06A 3HJOA 4GSTA 5ECMB 4POKA 2WB9A 5ECSA 1SYRA 5IM9A 4FQUA 2FWEA 4JBBA 2FA4A 4K0GA 5A4WA 3GKKA 2YV7A 1A8LA 2HE3A 2VOCA 2YP6A 1HNBA 5J9CA 2DJJA 4IJIA 3ZMLA 4JEDA 3O76A 1R5PA 1U3AA 3M1GA 4NHWA 3DWVA 2VCZA 4ZBDA 2WJUA 4QQ7A 5B6NA 4EO3A 2LNSA 2VLVA 4PNFA 1QGVA 1XIYA 4O7HA 1TDIA 3GA4A 3G7YA 1QK8A 1DSBA 2HSHA 1GLQA 1ZMAA 4J56E 5AIVA 5CRGA 2OKAA 2IL3A 2LNTA 1Z6MA 5D9XA 2YPMA 1JZOA 3JCML 3IOSA 1PL2A 4LA1A 2O7KA 4ZB6A 1K3OA 5B8AA 2L59A 2VCTA 2HI7A 1O8WA 1TKDB 2GZYA 2CZ2A 1O81A 2GZPA 2MBTA 1G7OA 4YAVA 4WF4A 4BVXA 5G1LA 2X8HA 1AQVA 2WRTA 2FD3A 2NBSA 22GSA 1K0MA 3ISOA 1OAZA 4MA9A 3TCOA 2JZRA 2HFDA 3BD2A 3ZMKA 1F6MC 1JZWA 4TRXA 4KAEA 1XWKA 4HEA2 3KD0A 5INYA 1GWCA 3P8WA 3RHCA 4PQ1A 4MABA 1OKTA 1EV4A 17GSA 5A4UA 3ZYWA 4BVYA 5FWGA 1OC8A 5B6MA 3QPMA 3I6AA 3LYPA 3DXBA 3G7JA 1NM3A 4IS0A 3LQ7A 4AF2A 3I43A 4KDXA 3GRXA 5DBQA 3KXOA 3IXRA 2YANA 4KX4A 1GH2A 5G2ZA 4MF6A 4XCSA 3IE3A 2TRCP 3KM6A 1K3LA 3C1SA 4ZBAA 3U5RE 5D9WA 3HVXA 4K2DA 2VD0A 3Q6OA 1J9BA 3CSJA 1FAAA 1TTZA 1O85A 1O6JA 2H01A 4ZB8A 4KE3A 3RAZA 3J7Yb 3C71A 3M0FA 5JWOB 2WS2A 1DE1A 4N10A 4E8HA 3L9VA 4WEYA 3UAPA 2A2RA 3QD9A 5F07A 4WF5A 2YJ7A 2JZTA 3GYKA 3BBYA 2OE0A 3WGXA 5HR2A 1YZXA 6GSSA 5IQYA 2F8AA 4D73B 2WDUA 4JR6A 1OC9B 2UZ8A 2F3MA 2GT5A 5BMUA 1BJXA 4BWSA 2P0GA 1Q4JA 4JRRA 4KUNA 4TVEA 3H93A 3LXTA 5H5SA 4HQZA 1SKRB 3E0UA 1GLPA 1WIKA 4DEJA 1ON4A 2O89A 4ZXGA 8GSSA 1CQGA 5KN0A 3H79A 2MMZA 2L5OA 4OFMA 3H4KA 1B48A 5CYYA 2X64A 3DRNA 3VLNA 4IELA 5HFKA 3WT1A 3HZ8A 3HJPA 5D93A 2L6DA 5IMVA 3GH6A 3C73A 4KCEA 3G9BA 4LL4B 3D0ZA 3APOA 5G1KA 3ED3A 4TXOB 4FYUA 3DIEA 2DC5A 3F9UA 5ECLB 5J3RA 4KA0A 3TOUA 2HT9A 5GZZB 3FZ5A 2OA7A 2OACA 2VL9A 2CVBA 1AQXA 2KP2A 2M80A 3APQA 2GGTA 4YAPA 1U3IA 1SJZA 1ERVA 3VWVA 5IMCA 1VF3A 3TUEA 1GUHA 5C00A 4Q5QA 4DSRA 4Z7XA 4HQSA 2O8VB 3E3EA 2N5BA 5F0GA 4EDYA 4MDCA 4YQMA 1T1VA 4BVXB 1E6BA 4EDZA 1XZOA 5D9VA 2YWIA 1FB0A 1EEJA 5ECKB 3F4RA 5JWQB 3VI7A 2DMMA 4ECIA 2E2MA 2PU9C 3EU3A 2KLXA 3FZ4A 1ERUA 4USSA 2GT6A 2DJ3A 2B7JA 3TKSC 2JACA 1ACVA 5DCHA 1PRXA 1YEXA 4PXOA 3PGTA 2PERA 1T4YA 2REMA 3A2XA 2V1MA 1GSYA 2HSYA 2B5YA 3VURA 4GCIA 4BVYB 4FYBA 3EE2A 1TRWA 4AJ8A 2FA8A 3TGZA 3IK9A 4BA7A 1MTCA 3U6VA 1GNWA 4IBPA 5B7CA 4KF9A 1X9MB 4MJCA 5J9BA 4GWRA 4ECCA 1K0NA 2B1KA 1OYJA 5IO0A 1TP9A 1H75A 4TKYA 1IYHA 1B4PA 1FVKA 2LUSA 3FW2A 1PKZA 4I5QA 1AXDA 2L57A 1XVQA 4GF0A 1NHYA 4L0WA 3GSTA 1TOFA 4TR1A 3FRCA 3F6FA 3CSIA 3EURA 2H75A 4OFNA 18GSA 5LD0A 2R2JA 1ML6A 4BWQA 2XPEA 3KZQA 2H1BA 3RPNA 2BMXA 5AGYA 3DVWA 2PWJA 2FY6A 3HHVA 2WULA 3D22A 2DSAA 1GUMA 5H5RA 2YV9A 3TJKA 4WXTA 1ZOFA 1SL1B 1XPVA 2KP1A 3TKSA 1GUKA 2XPDA 3GKXA 2VL2C 2YZHA 4MF7A 4K8MA 4J2FA 5IO2A 3KTLA 2VL3A 5F8BA 1UA5A 4KDUA 2NVLA 2DLXA 3EMXA 3V1WA 2PVQA 3VI5A 2C0EA 4LLRA 2I1UA 1WOUA 4EL1A 1XVWA 1TRVA 4V1Ag 1B9XC 1XFLA 1G6WA 2NPBA 6GSYA 2LV3A 3HZ4A 1V58A 5CNWA 2KUCA 3AY8A 4POMA 3D5JA 1N2AA 2LRTA 4F82A 2QGVA 2DMLA 5CRWA 2EIOA 3R2QA 3ZVJD 3ZFBA 3FEUA 3R3EA 4MH3A 1F3BA 3KH7A 4RI6A 4RUVA 4DVCA 4NPBA 5H5QA 3EC3A 2CVDA 2M72A 3ZFLA 2VLUA 1TRUA 2EIRA 1A0RP 4EF0A 4GLTA 1WRYA 4G10A 3SWLA 5AIXA 5DVBA 4K7OA 1GSSA 2F8FA 5ECPB 3BCIA 2YWNA 3TJFA 4TXVA 3TRXA 2HLSA 3TKPA 1BG5A 1T4ZA 3GKMA 2PMTA 2L4CA 2B6MA 13GSA 1R4WA 4FH8A 3E9JB 5C04A 5FHIA 2VL2A 4TXOA 3FKFA 4EE0A 2KOKA 4RQRA 2H6YA 5CRHA 3H1NA 1GSDA 2I3YA 3TKQA 3P2AA 1A24A 1G7EA 1Y25A 1SKWB 3M9JA 2HSMA 3EMPA 2L4QA 1FHEA 4IHUA 4MPGA 4PQIA 5ECRB 3KH9A 1JZDA 2VCXA 1A2LA 3A5WA 2FWHA 2ZUPA 1M9BA 4O92A 4WBJA 4MZCA 1MD3A 4MK3A 2AUVA 4IP6A 2F9SA 4LMVA 4OWYA 3PINA 1EP8A 3NZNA 3LXZA 1FOVA 2H71A 3BCKA 4TR3A 4GQFA 1VF4A 2FCHA 5DCGA 4MJBA 1QQ2A 3UARA 3US3A 1XOBA 5CRDA 1JHBA 3KGKA 2Z9SA 1A23A 2CX4A 4AJ6A 1MDIA 5CO3A 3ZITA 2MYGA 1PGTA 4F2IA 3GIXA 1OE7A 1WJKA 4XS6A 5HFIA 1PD21 1GTIA 1EV9A 4I97A 1GSEA 1FB6A 1M2BA 4HS1A 3BOAA 4PQHA 1BAYA 2RIIA 3L78A 3TRPA 4TR1B 2OBIA 2LJRA 2NTOA 1ZGNA 4NMUA 5IMDA 3FYGA 2CVKA 1Z7PA 2R3XA 5E59A 4PUAA 1PMTA 4CDOA 2HRNA 3TB2A 3IBHA 2HRAA 2FUG2 2GQKA 1GL8A 2GS3A 4AJ7A 5D73A 3MDKA 2VO4A 2H30A 3CSHA 2X8GA 4IKHA 2XHFA 2GDRA 5DQSA 3GNJA 1GSUA 3IV4A 2IMFA 1EGOA 3EVIA 5COHA 4ZB9A 1JFUA 3ZIJA 1KBNA 1K0CA 3DKSA 3QMXA 1W4VA 1PN9A 1QUWA 2M46A 2LQOA 3F8UA 2IN3A 4BL7A 3KEBA 1Z3EA 4TW5A 2AYTA 4LL1B 1S3CA 2G0FA 1N8JA 4ML1A 3N9JA 2ZNMA 4MLYA 2C4JA 1K0OA 1F3AA 1EZKA 4PNGA 4IGJA 3ZRDA 4PUFC 6GSWA 1YDKA 1SK0A 1X9SB 2XBQA 4KGIA 2E0QA 1MEKA 3TOTA 1WE0A 1EP7A 1QXHA 1QMVA 3GURA 3RDWA 2H74A 3A2WA 1B4QA 1DBYA 2X99A 3ZIVA 4GQCA 5IMZA 2QC7A 1G0TA 1PQNA 4EVMA 2RM6A 3FY7A 3DGQA 5ECHB 4KSMA 5G30A 4OCEA 3Q74A 4POBA 2MMAA 5EL8A 3CRTA 1AIUA 1PKWA 4HJ2A 3FZ9A 1JZRA 1A8YA 5CAXA 2R6KA 5JCWA 1OC3A 3KTBA 2HNLA 5HFGA 1ABAA 3ZREA 2MMNA 3EYTA 3VFIA 1V98A 5AISA 4ZIJA 2JU5A 3VWXA 2AV4A 2CAQA 3QFBC 16GSA 1MDKA 2O87A 2DJ1A 4RQXA 3I9V2 3NOFA 5IOXA 4YQVA 2H8LA 2HSMB 3PR8A 1AW9A 3KJYA 3LG6A 5ABRA 1WMJA 4V2NA 1GSFA 4IQ1A 5DALA 4X1UA 2FNOA 4PX1A 4NV5A 1LJRA 3F3RA 4EXJA 3GFKA 2VCWA 4WKWA 3A3TA 3QFAC 1GULA 4MH2A 2IWTA 1Z7RA 1VRSD 1YQ1A 1TU8A 3HKRA 4OO5A 4CW9A 2WZ9A 2C0FA 1E2YA 4F03A 3QOUA 2QSIA 1T3BA 2N5FA 2DJ0A 2PPTA 1LBKA 3CYNA 4F9ZA 1TI1A 5G5EA 3D4MA 4KCAA 4BPYA 2YN1A 1I5GA 3HXSA 3RBTA 1NHOA 1J0FA 3VWWA 4TOPA 3H8QA 1HQOA 4KH7A 3D4TA 4L5LA 7GSSA 2C0GA 2LRNA 4K9ZA 4AGSA 10GSA 2GTUA 1ST9A 1O8XA 2HRFA 2PUKC 5EPFA 2YOIA 3UJ1A 2B3SA 1GSQA 4V2LA 3DMLA 2AAWA 2P31A 1GTBA 2TRXA 6GSTA 3IA1A 1FO5A 4N11A 3WT2A 5CP1A 5B8BA 3CXGA 3UVHA 4KDYA 3F3QA 2V6OA 5J5NA 5HR0A 1RK4A 2FLSA 2HXKA 4G0KA 3P7XA 4HZ2A 1HD2A 2MBSA 4QL9A 1YF0A 4L0UA 5GSTA 2XBIA 5DAKA 2I81A 5L71A 1UVZA 3QAWA 3L9UA 1M0UA 3DD3A 4ZL9A 4G0IA 1SK2A 1YKCA 2OBKA 1F2EA 3LJRA 1M2AA 1X5DA 4NXIA 2DIYA 1GP1A 1HYUA 3HVSA 4EUYA 1A0FA 3GKNA 4Q5NA 2N5AA 2PVOC 2HZFA 2KHPA 2VCVA 2B7KA 3F4TA 3IK7A 4BL7B 4O32A 3TKSE 3KMNA 4HOJA 3LORA 1V2AA 4KB3A 3TKRA 2E7PA 2VCQA 3IPZA 5IPHA 2JL4A 1SU9A 5ECQB 5GAPD 3MAKA 1SYXA 4L5OA 1TJDA 2R37A 2FWFA 2LJAA 2LSTA 4J57E 3FZAA 4ECBA 4DSSA 4O5RA 1XXUA 1Z9HA 1SENA 3IC8A 3IAS2 2IMEA 2IJYA 2C1YA 4IP1A 4I6XA 4WBRD 4FIWA 1ERWA 1TU7A 2GQMA 2PGTA 2GQLA 4IVFA 11GSA 3GL3A 1KTEA 2VAFA 1Q98A 3IC4A 3UBLA 2AB6A 3QR6A 1I9DA 1SD9A 1K0BA 1XW5A 1YF1A 1ZCPA 2J9HA 3FHKA 1IYIA 4ULXA 1AQWA 4KSOA 3IAM2 4QL7A 2GLRA 3G7IA 1M7TA 3I69A 5DDLA 4F0CA 1THOA 5DJLA 1JLWA 1F37A 4TR4A 4NV2A 3L0HA 2DIZA 2LKUA 4YQUA 1T7PB 4HU7A 1J08A 3ZLPA 4POLA 3VWUA 2DBCA 4FYCA 3SBCA 4MJEA 2B1LA 4XS1A 2H6ZA 1CQHA 4XRDA 3UMAA 1BYEA 1SL0B 12GSA 4OMVA 2VUPA 1TK5B 3BJ5A 2AJQB 2X8CA 4V1Ap 2OADA 1S3DA 3FK8A 1K0DA 2V2GA 2B5EA 3EWLA 1HNAA 2OE1A 5KN2A 2HYXA 1B9YC 4MP4A 1PX6A 3HYPA 5D9TA 5DALB 3ERWA 5LCZA 2H0IA 4XHMA 4RI7A 3UBKA 1TW9A 2L5LA 3EINA 1THXA 3F4SA 4GXZA 5KN1A 2B5XA 3IDVA 4JR4A 1PX7A 5D96A 4IW9A 1Z6NA 2VD1A 3KP8A 2FHEA 1TI3A 4MF5A 3C8EA 3GTUA 4ML6A 4F0BA 2DJKA 4NAXA 5ID2A 1SK1A 2CZ3A 2YNXA 5HQPA 1EOHA 6GSUA 4TN8A 4N0VA 2CT6A 1QFNA 4K0NA 2P5QA 1GTUA 5J41A 2A2SA 4L8EA 4MJAA 3N5OA 1NW2A 2YJHA 3HD5A 4OCFA 2LTKA 1XWBA 2I4AA 2C8UA 4DSQA 1EGRA 1W89A 3W6GA 1EEMA 1U87A 1ILOA 1XW6A 2CV4A 3M3MA 2E2GA 3HJMA 1R7HA 3GX0A 2GSQA 1KNGA 4HI7A 1V40A 1WP0A 2K9FA 1G6YA 2AHEA 3ERGA 2VIMA 5HR3A 3ERFA 1Y6EA 1X5CA 2MZCA 2IIYA 1SKSB 2HZEA 3IRAA 4XTSA 2LQQA 2IFQA 3L9SA 3ZL5A 4CHSA 4ZBBA 6GSVA 1VF2A 5DAKB 1U6TA 2MMOA 4ACSA 1XW9A 3DYRA 3CMIA 3QAVA 3GUSA 2C0DA 3PPUA 1S3AA 1UC7A 1MD4A 1ZL9A 5GSSA 3GH9A 3KP9A 3WD6A 1XWCA 5EVOA 4NHZA 2FGXA 4WR5A 1O7UA 1TK8B 3PH9A 2J23A 2EIQA 2CX3A 4LMWA 1GTAA 4XS4A 2IPAA 3MSZA 4OO4A 5IIZA 1T8EB 4JE1A 3UOMA 5IOWA 1GRXA 5D8IA 3NIVA 1FW1A 1BQ7A 2RUEA 1X5EA 1A2JA 2BJXA 1K3YA 4PGTA 2R4VA 2CAIA 2C3TA 4DSSB 3O3TA 3M9KA 1O73A 1TRSA 1VGLA 2XC2A 3EU4A 2H0HA 4MZWA 1KEBA 1XCCA 1K0AA 4I8BA 5ECOB 2D2ZA 3IHQA 4E8EA 3KCMA 4KNDA 2A4VA 4ZL7A 5ECNB 4YH2A 2YWOA 4PTSA 2YCDA 2HQTA 1OE8A 5GAND 1EOGA 2HRKA 3FR6A 3GL5A 4G2EA 3KIJA 1WPIA 5EY6A 4HJMA 4HZ4A 4PURA 3TJBA 3ME8A 3VPTA 1R5AA 3CRUA 4MCUA 1URMA 2EC4A 3A2VA 5A5KA 2ZCTA 5IPGA 1TK0B 2V32A 5JCUA 4X43A 2R5GA 3WYWA 2LEGA 4G0LA 2JSZA 1YY7A 1SJ6A 4K7IA 4XRAA 2WCIA 1BEDA 1AAZA 5E4WA 3C1RA 2WGRA 1FG4A 2HSNB 5FT3A 1M99A 4N30A 3TDGA 2I9HA 1A2MA 2OE3A 5F05A 4Q5FA 2JSYA 9GSSA 3TJGA 1V57A 3GV1A 5CREA 4ECJA 1T00A 5IMAA 2GZZA 4EKZA 4X0XA 1AUCA 4HU9A 1NSWA 3RPPA 3LYKA 3LEFA 4KW6A 1TXXA 4NWYA 2PBJA 2TIRA 3MWHA 2ALBA 3S9FA 2LJKA 1M2DA 2RM5A 4WR4A 1SD8A 1YKAA 2NDOA 1WWJA 3CBUA 2IMIA 1DUGA 1M9AA 3GTUB 2LS5A 5ECIB 4ISDA 4G9HA 3UL3A 2O85A 4HDEA 5ID2B 2GSSA 2K6VA 4V2MA 3TRQA 2V41A 1FVJA 3GHAA 3QDNA 4JU5A 1Z5YE 5AN1A 19GSA 4MZBA 1C72A 1SJIA 3UEMA 1SL2B 3Q19A 4WETA 4GSNA 4IQAA 2OJLA 3ZTLA 2L6CA 3LSZA 2H73A 3VK9A 2YWMA 2VM1A 5ELAA 3F6DA 3QAGA 1UN2A 1GNEA 2VLTA 1XWAA 3RHBA 3GMFA 1OVNA 3DVXA 3UIWA 3WGDA 2H19A 2ON7A 1RW1A 1X0RA 2GSTA 2HZEB 2FWGA
chains in the Genus database with same CATH superfamily
3C7MA 3QCPA 4XIHA 2IFQB 3P90A 5G31A 5LNKe 3CTFA 2C3NA 3FR9A 3LWAA 1BG1A 3DEXA 3M8NA 3LGCA 2K18A 2C80A 2P5RA 5KEJA 4K6XA 4Q5RA 3F0IA 4G19A 4I2TA 2IMDA 1XWGA 4JZQA 3MNGA 4IN0A 4ID0A 3W8JA 2WVZA 1XBSA 5A4VA 2H66A 3F63A 2GSRA 5DQYA 1OKDA 1BF5A 1BX9A 2G2QA 3HA9A 3UVTA 4OFTA 3ZVJA 1U88A 2LRCA 3APSA 2VM2A 1LU4A 1USBA 2V6KA 2H1DA 1RQMA 5KN3A 4XS4B 3GSSA 1EWXA 3K8NA 1X9WB 2JADA 5J4UA 5IMFA 4K7NA 3O6TA 4HUAA 1AC1A 3W8SA 3HVVA 3HCZA 4GRFA 1YEPA 2K8VA 2DJ2A 2RUFA 4K5RA 2CA8A 2H0GA 2O36A 3KMOA 5HR1A 1B8XA 3D21A 1DE2A 1MDJA 3HY2A 3J7Yk 3L4NA 2BTOT 3GX8A 1ZZYA 4ILFA 4YKGA 4OD7A 1XOAA 5ELGA 3Q18A 3OR5A 2GVPA 2K8SA 2WVXA 1PA3A 1ZYEA 4ZL8A 1R26A 2H76A 4MMMA 2H72A 4N0ZA 4P3YB 4MPFA 2IMKA 2HRKB 4H86A 1S3RA 3VPQA 2QKEA 2JZSA 1PSQA 3LFLA 20GSA 1VF1A 2ON5A 2H70A 4GSSA 4I2UA 5BMUB 5JCGA 1H4OA 5DJMA 6GSXA 5ENUA 1F9MA 2PN8A 1PL1A 1YJ6A 4EC0A 4TR0A 2CQ9A 3CTGA 3ZZXA 2YZUA 3GN3A 1V9WA 3TJJA 4D73A 3WGEA 1S4BP 4GTUA 4FO5A 2ES7A 5JWRB 3IR4A 4IJ3A 1OC9A 4ZILA 1JLVA 2H1AA 1HNCA 5G5FA 1ERTA 2WFCA 4K1FA 3FR3A 3HMJG 2H6XA 14GSA 3ME7A 2C3QA 2RLIA 4YKFA 1ZYQB 2H1GA 3HDCA 2F51A 3D6IA 5F06A 3HJOA 4GSTA 5ECMB 4POKA 2WB9A 5ECSA 4BIKA 1SYRA 5IM9A 4FQUA 2FWEA 4JBBA 2FA4A 4K0GA 5A4WA 3GKKA 2YV7A 1A8LA 2HE3A 2VOCA 2YP6A 2R0GA 3RGBC 1HNBA 5J9CA 2DJJA 4IJIA 3ZMLA 4JEDA 3O76A 1R5PA 1U3AA 3M1GA 4NHWA 3DWVA 2VCZA 1ZYNA 4O5UA 4ZBDA 2WJUA 4QQ7A 2EFCA 5B6NA 4EO3A 4GDFA 2LNSA 2VLVA 4PNFA 1QGVA 1XIYA 4O7HA 3RFRC 1TDIA 3A5IA 3GA4A 3G7YA 1QK8A 1DSBA 2HSHA 1GLQA 1ZMAA 4J56E 5AIVA 5CRGA 2OKAA 2IL3A 2LNTA 1Z6MA 2X4AA 5D9XA 2YPMA 1JZOA 3JCML 3IOSA 1PL2A 4LA1A 2O7KA 4ZB6A 1K3OA 5B8AA 2L59A 2VCTA 2HI7A 1O8WA 1TKDB 2GZYA 2CZ2A 1O81A 2GZPA 2MBTA 1G7OA 2QA2A 4YAVA 4WF4A 4BVXA 5G1LA 2X8HA 1AQVA 2WRTA 2FD3A 2NBSA 22GSA 1K0MA 3ISOA 1OAZA 4MA9A 4Z2UA 4QMKA 3TCOA 2JZRA 2HFDA 3BD2A 3ZMKA 1F6MC 1JZWA 4TRXA 4KAEA 1XWKA 4HEA2 3KD0A 5INYA 1GWCA 3P8WA 3RHCA 4PQ1A 4MABA 1OKTA 1EV4A 17GSA 5A4UA 3ZYWA 4BVYA 5FWGA 1OC8A 5B6MA 3QPMA 3I6AA 3LYPA 3DXBA 3G7JA 1NM3A 4IS0A 3LQ7A 4AF2A 3I43A 4KDXA 3GRXA 4Z2TA 5DBQA 3KXOA 3IXRA 4AKHA 2YANA 4KX4A 1GH2A 5G2ZA 4MF6A 4XCSA 3IE3A 2TRCP 3KM6A 1K3LA 3C1SA 4ZBAA 3U5RE 5D9WA 3HVXA 4K2DA 4PHZC 2VD0A 3Q6OA 1J9BA 3CSJA 1FAAA 1TTZA 1O85A 1O6JA 2H01A 4ZB8A 4KE3A 3RAZA 3J7Yb 3C71A 3M0FA 5JWOB 2WS2A 1DE1A 4N10A 4E8HA 3L9VA 4AI6A 4WEYA 3UAPA 2A2RA 3QD9A 5F07A 4WF5A 2EFDA 2YJ7A 2JZTA 3GYKA 3BBYA 2OE0A 3WGXA 5HR2A 1YZXA 6GSSA 5IQYA 2F8AA 4D73B 2WDUA 4JR6A 1OC9B 1M3JA 2UZ8A 2F3MA 2GT5A 5BMUA 1BJXA 2R0PA 4BWSA 2P0GA 1Q4JA 4JRRA 4KUNA 4TVEA 3H93A 3LXTA 5H5SA 4HQZA 1SKRB 3E0UA 1GLPA 1WIKA 4DEJA 1ON4A 2O89A 4ZXGA 8GSSA 1CQGA 5KN0A 3H79A 2MMZA 2L5OA 4OFMA 3H4KA 1B48A 5CYYA 2X64A 3DRNA 3VLNA 4IELA 5HFKA 3WT1A 3HZ8A 3HJPA 5D93A 2L6DA 5IMVA 3GH6A 3C73A 4KCEA 3G9BA 4LL4B 3D0ZA 3APOA 5G1KA 3ED3A 4TXOB 4FYUA 3DIEA 2DC5A 3F9UA 2UV8G 5ECLB 5J3RA 4KA0A 3TOUA 2HT9A 5GZZB 3FZ5A 2OA7A 2OACA 2VL9A 2CVBA 1AQXA 2KP2A 2M80A 3APQA 2GGTA 4YAPA 1U3IA 1SJZA 1ERVA 3VWVA 5IMCA 1VF3A 3TUEA 1GUHA 5C00A 4Q5QA 4DSRA 4Z7XA 4HQSA 2O8VB 3E3EA 2N5BA 5F0GA 4EDYA 4MDCA 4YQMA 1T1VA 4BVXB 1E6BA 4EDZA 1XZOA 5D9VA 2YWIA 1FB0A 1EEJA 5ECKB 3F4RA 5JWQB 2DKHA 3VI7A 2DMMA 4ECIA 2E2MA 2PU9C 3EU3A 2KLXA 3FZ4A 1ERUA 3LW9A 4USSA 2GT6A 2DJ3A 2B7JA 3TKSC 2JACA 1ACVA 5DCHA 1PRXA 4G01A 1YEXA 3HVNA 4PXOA 3PGTA 2PERA 1T4YA 2REMA 3A2XA 2V1MA 1GSYA 2HSYA 2B5YA 3VURA 4GCIA 4BVYB 4FYBA 3EE2A 1TRWA 4AJ8A 2FA8A 3TGZA 3IK9A 4FXYP 4BA7A 1MTCA 3U6VA 1GNWA 4IBPA 2O3EA 5B7CA 4KF9A 1X9MB 4MJCA 5J9BA 4GWRA 4ECCA 1K0NA 2B1KA 1OYJA 5IO0A 1TP9A 1H75A 4TKYA 1IYHA 1B4PA 1FVKA 2LUSA 3FW2A 4AKGA 1PKZA 4I5QA 1AXDA 2L57A 1XVQA 4GF0A 1NHYA 4L0WA 3GSTA 1SVOA 1TOFA 4TR1A 4HSCX 2A2PA 3FRCA 3F6FA 3CSIA 2WW1A 3EURA 2H75A 4OFNA 18GSA 5LD0A 2R2JA 1ML6A 3EPTA 4BWQA 2XPEA 3KZQA 2H1BA 3RPNA 2BMXA 5AGYA 3DVWA 2PWJA 2FY6A 3HHVA 5KOXA 2WULA 3D22A 2DSAA 1GUMA 5H5RA 2YV9A 3TJKA 4WXTA 2H1LA 1ZOFA 5A34A 1SL1B 1XPVA 2KP1A 3TKSA 1GUKA 2XPDA 3GKXA 2VL2C 2YZHA 4MF7A 4K8MA 4J2FA 5IO2A 3KTLA 2VL3A 5F8BA 1N25A 1UA5A 4KDUA 2NVLA 2DLXA 3EMXA 3V1WA 2PVQA 3VI5A 2C0EA 4LLRA 2I1UA 1WOUA 4EL1A 1XVWA 1TRVA 4V1Ag 2WW2A 1B9XC 1XFLA 1G6WA 2NPBA 6GSYA 2LV3A 3HZ4A 1V58A 4E68A 5CNWA 2KUCA 3AY8A 4POMA 3D5JA 1N2AA 2LRTA 4F82A 2QGVA 2DMLA 5J47A 5CRWA 2EIOA 3R2QA 3ZVJD 3ZFBA 3FEUA 3R3EA 4MH3A 1F3BA 3KH7A 3FMWA 4RI6A 4RUVA 4DVCA 4NPBA 5H5QA 3EC3A 3MIXA 2CVDA 2M72A 3ZFLA 2VLUA 1TRUA 5A1NA 2EIRA 1A0RP 4EF0A 4GLTA 1WRYA 4G10A 3SWLA 5AIXA 1PN0A 4K7OA 1GSSA 5DVBA 2F8FA 5ECPB 3BCIA 2YWNA 4K2XA 3TJFA 4TXVA 3TRXA 2HLSA 3TKPA 1BG5A 1T4ZA 3GKMA 2PMTA 2EFHA 2L4CA 2B6MA 13GSA 1R4WA 4FH8A 3E9JB 5C04A 5FHIA 2VL2A 4TXOA 4N3ZA 3FKFA 4EE0A 2KOKA 4RQRA 2H6YA 5CRHA 3H1NA 1GSDA 2I3YA 3TKQA 3P2AA 1A24A 5J4VA 1G7EA 1Y25A 1SKWB 3M9JA 2HSMA 3EMPA 1FOHA 2L4QA 1FHEA 4IHUA 4MPGA 4PQIA 5ECRB 3KH9A 1JZDA 2VCXA 1A2LA 3A5WA 2FWHA 2ZUPA 1M9BA 4O92A 4WBJA 4MZCA 4AKIA 1MD3A 4MK3A 2AUVA 4IP6A 2F9SA 4LMVA 4OWYA 3PINA 1EP8A 3NZNA 3LXZA 1FOVA 2H71A 3BCKA 2WW0A 4TR3A 4GQFA 1VF4A 2FCHA 5DCGA 4MJBA 1QQ2A 3UARA 3US3A 1XOBA 5CRDA 1JHBA 3KGKA 2Z9SA 1A23A 2CX4A 4AJ6A 1MDIA 5CO3A 3ZITA 2MYGA 1PGTA 4F2IA 3GIXA 1OE7A 1WJKA 4XS6A 5HFIA 1PD21 1GTIA 1EV9A 4I97A 1GSEA 1FB6A 1M2BA 4HS1A 3BOAA 4PQHA 1BAYA 2RIIA 3L78A 3TRPA 4TR1B 2OBIA 2LJRA 2NTOA 1ZGNA 4NMUA 5IMDA 3FYGA 4X4JA 2CVKA 1Z7PA 2R3XA 5E59A 4PUAA 1PMTA 4CDOA 2HRNA 3TB2A 3IBHA 2HRAA 2FUG2 2GQKA 1GL8A 2WZSA 2GS3A 4AJ7A 5D73A 3MDKA 4A5PA 2VO4A 2H30A 5A34B 3CSHA 2X8GA 4IKHA 2XHFA 2GDRA 5DQSA 3GNJA 1GSUA 3IV4A 2IMFA 1EGOA 3EVIA 5COHA 4ZB9A 1JFUA 3ZIJA 1KBNA 1K0CA 3DKSA 3QMXA 1W4VA 1PN9A 2DKIA 1QUWA 2M46A 2LQOA 3F8UA 1Y1UA 2IN3A 5A5HA 4BL7A 3KEBA 1Z3EA 4TW5A 2R0CA 2AYTA 4LL1B 1S3CA 2G0FA 1N8JA 4ML1A 3N9JA 2ZNMA 4MLYA 2C4JA 1K0OA 1F3AA 1EZKA 4PNGA 4IGJA 3ZRDA 2OT3A 4PUFC 6GSWA 1YDKA 1SK0A 1X9SB 2XBQA 4KGIA 2E0QA 1MEKA 3TOTA 1WE0A 1EP7A 1QXHA 1QMVA 3GURA 3RDWA 2H74A 3A2WA 1B4QA 1DBYA 2X99A 3ZIVA 4O5QA 4GQCA 5IMZA 2QC7A 1G0TA 1PQNA 4EVMA 2RM6A 5A1NB 3FY7A 3DGQA 5ECHB 4KSMA 5G30A 4OCEA 3Q74A 4POBA 2MMAA 5EL8A 3CRTA 1AIUA 1PKWA 4HJ2A 3FZ9A 1JZRA 1A8YA 5CAXA 2R6KA 5JCWA 1OC3A 3KTBA 2HNLA 5HFGA 1ABAA 3ZREA 2MMNA 3EYTA 3VFIA 1V98A 5AISA 4ZIJA 2JU5A 3VWXA 2AV4A 2CAQA 3QFBC 4K5SA 16GSA 1MDKA 5KOWA 2O87A 2DJ1A 4RQXA 3I9V2 3NOFA 5IOXA 4YQVA 2H8LA 2HSMB 3PR8A 1AW9A 3KJYA 3LG6A 5ABRA 1WMJA 4V2NA 1GSFA 4IQ1A 5DALA 4X1UA 2FNOA 4PX1A 2O5VA 4NV5A 1LJRA 3F3RA 4EXJA 3GFKA 2VCWA 4WKWA 3A3TA 3QFAC 1GULA 4MH2A 2IWTA 1Z7RA 1VRSD 1YQ1A 1TU8A 3HKRA 4OO5A 4CY8A 4CW9A 2WZ9A 2C0FA 1YEWC 1E2YA 4F03A 4ZB7A 3QOUA 2QSIA 1T3BA 2N5FA 2DJ0A 2PPTA 1LBKA 3CYNA 4F9ZA 1TI1A 5G5EA 3D4MA 4KCAA 4BPYA 2YN1A 1I5GA 3HXSA 3RBTA 1NHOA 1J0FA 3VWWA 4TOPA 3H8QA 1HQOA 4KH7A 3D4TA 4L5LA 7GSSA 2C0GA 2LRNA 4K9ZA 4AGSA 10GSA 2GTUA 1ST9A 1O8XA 1I1IP 2HRFA 2PUKC 5EPFA 2YOIA 3UJ1A 2B3SA 1GSQA 4V2LA 3DMLA 2AAWA 2P31A 1GTBA 2TRXA 6GSTA 3IA1A 1FO5A 4N11A 3WT2A 5CP1A 5B8BA 3CXGA 3UVHA 4KDYA 3F3QA 2V6OA 5J5NA 5HR0A 1RK4A 2FLSA 2HXKA 4G0KA 3P7XA 4HZ2A 1HD2A 2MBSA 1PFOA 4QL9A 1YF0A 4L0UA 5GSTA 2XBIA 5DAKA 2I81A 5L71A 2WVYA 1UVZA 3QAWA 3L9UA 1M0UA 3DD3A 4ZL9A 4G0IA 5BRTA 1SK2A 1YKCA 2OBKA 1F2EA 3LJRA 1M2AA 1X5DA 4NXIA 2DIYA 1GP1A 1HYUA 3HVSA 4EUYA 1A0FA 3GKNA 4Q5NA 2N5AA 2PVOC 2HZFA 2KHPA 2VCVA 2B7KA 3F4TA 5A5HB 3IK7A 4BL7B 4O32A 3TKSE 3KMNA 4HOJA 3LORA 4EIPA 1V2AA 4KB3A 3TKRA 2E7PA 2VCQA 3IPZA 5IPHA 2JL4A 4AKXB 1SU9A 5ECQB 5GAPD 3MAKA 1SYXA 4L5OA 1TJDA 2R37A 2FWFA 2LJAA 2LSTA 4J57E 3FZAA 4ECBA 4DSSA 4O5RA 1XXUA 1Z9HA 1SENA 3IC8A 3IAS2 2IMEA 2IJYA 2C1YA 4IP1A 4I6XA 4WBRD 4FIWA 1ERWA 1TU7A 2GQMA 2PGTA 2GQLA 4IVFA 11GSA 3GL3A 1KTEA 2VAFA 1Q98A 3IC4A 3UBLA 4Z2RA 2AB6A 3QR6A 1I9DA 1SD9A 1TXUA 1K0BA 2QA1A 1XW5A 1YF1A 1ZCPA 2J9HA 3FHKA 1IYIA 4ULXA 1AQWA 4KSOA 3IAM2 4QL7A 2GLRA 3G7IA 1M7TA 3I69A 5DDLA 4F0CA 1THOA 5DJLA 1JLWA 1F37A 4TR4A 4NV2A 5J40A 3L0HA 2DIZA 2LKUA 4YQUA 1T7PB 4HU7A 1J08A 3ZLPA 4POLA 3VWUA 2DBCA 4FYCA 3SBCA 4MJEA 2B1LA 4XS1A 2H6ZA 1CQHA 4XRDA 1YVLA 3UMAA 1BYEA 1SL0B 12GSA 4OMVA 3TU3B 2VUPA 1TK5B 3BJ5A 2AJQB 2X8CA 4V1Ap 2OADA 1S3DA 2HSNA 3FK8A 1K0DA 2V2GA 1XG8A 2B5EA 3EWLA 1HNAA 2OE1A 5KN2A 2HYXA 1B9YC 4MP4A 1PX6A 3HYPA 5D9TA 5DALB 3ERWA 3IHGA 5LCZA 2H0IA 4XHMA 4RI7A 3UBKA 1TW9A 2L5LA 4PI2C 3EINA 1THXA 3F4SA 4GXZA 5KN1A 2B5XA 3IDVA 4JR4A 1PX7A 5D96A 4IW9A 1Z6NA 2WW3A 2VD1A 3KP8A 2FHEA 1TI3A 4MF5A 3C8EA 3GTUA 4ML6A 4F0BA 2DJKA 4NAXA 5ID2A 1SK1A 2CZ3A 2X49A 2YNXA 5HQPA 1EOHA 6GSUA 4TN8A 4N0VA 2CT6A 1QFNA 4K0NA 2EFEA 2P5QA 1GTUA 5J41A 2A2SA 4L8EA 4MJAA 3N5OA 1M3IA 1NW2A 2YJHA 3HD5A 4OCFA 2LTKA 1XWBA 2I4AA 2C8UA 4DSQA 1EGRA 1W89A 3W6GA 1EEMA 1U87A 1SVLA 1ILOA 1XW6A 2CV4A 3M3MA 2E2GA 3HJMA 1R7HA 3GX0A 2GSQA 1KNGA 4HI7A 1V40A 1WP0A 2K9FA 1G6YA 2AHEA 3ERGA 2VIMA 5HR3A 3ERFA 1Y6EA 1X5CA 2MZCA 2IIYA 1SKSB 2HZEA 3IRAA 4XTSA 2LQQA 2IFQA 3L9SA 3ZL5A 4CHSA 5J4YA 4ZBBA 6GSVA 1VF2A 5DAKB 1U6TA 2MMOA 4ACSA 4W66A 1XW9A 3DYRA 3CMIA 3QAVA 3MYDA 3GUSA 2C0DA 3PPUA 1S3AA 1UC7A 1MD4A 1ZL9A 5GSSA 3GH9A 3KP9A 3WD6A 1XWCA 5EVOA 4NHZA 3CQFA 2FGXA 4WR5A 1O7UA 1TK8B 3PH9A 2J23A 2EIQA 2CX3A 4LMWA 1GTAA 4XS4A 2IPAA 3MSZA 4OO4A 5IIZA 1T8EB 4JE1A 3UOMA 5IOWA 2WVXB 1GRXA 5D8IA 3NIVA 1FW1A 1BQ7A 2RUEA 1X5EA 4EIQA 1A2JA 2BJXA 1K3YA 4PGTA 2R4VA 2CAIA 2C3TA 4DSSB 3O3TA 1O73A 3M9KA 1TRSA 1VGLA 2XC2A 3EU4A 2H0HA 4MZWA 1KEBA 1XCCA 1K0AA 4I8BA 5ECOB 2D2ZA 3IHQA 4E8EA 3KCMA 2VKZG 4KNDA 2A4VA 4ZL7A 5ECNB 4ICYA 4YH2A 2YWOA 4PTSA 4CY6A 2YCDA 1ZYPA 2HQTA 1OE8A 5GAND 1EOGA 2HRKA 3CHXC 3FR6A 3GL5A 4G2EA 3KIJA 1WPIA 5EY6A 4HJMA 4HZ4A 4PURA 3TJBA 3ME8A 3VPTA 1R5AA 3CRUA 4MCUA 1URMA 2EC4A 3A2VA 5A5KA 2ZCTA 5IPGA 1TK0B 2V32A 5JCUA 4X43A 2R5GA 3WYWA 2LEGA 4G0LA 2JSZA 1YY7A 1SJ6A 4K7IA 4XRAA 2WCIA 1BEDA 1AAZA 5E4WA 3C1RA 2WGRA 1FG4A 4MNNA 2HSNB 5FT3A 1M99A 4N30A 3TDGA 2I9HA 1A2MA 2OE3A 5F05A 4Q5FA 2JSYA 9GSSA 3TJGA 1V57A 3GV1A 5CREA 4ECJA 1T00A 5IMAA 2GZZA 4EKZA 4X0XA 1AUCA 4HU9A 1NSWA 3RPPA 3LYKA 3LEFA 4KW6A 4PI0C 1TXXA 4NWYA 2PBJA 2TIRA 3MWHA 2ALBA 3S9FA 2LJKA 1M2DA 2RM5A 4WR4A 1SD8A 1YKAA 2NDOA 1WWJA 2A4HA 3CBUA 2IMIA 1DUGA 1M9AA 3GTUB 2LS5A 5ECIB 4ISDA 4G9HA 3UL3A 2O85A 4HDEA 5ID2B 2GSSA 2K6VA 4V2MA 3TRQA 2V41A 1FVJA 3GHAA 3QDNA 4JU5A 1Z5YE 5AN1A 19GSA 4MZBA 1C72A 1SJIA 3UEMA 3CWGA 1SL2B 3Q19A 4WETA 4GSNA 4IQAA 2OJLA 3ZTLA 2L6CA 3LSZA 2H73A 3VK9A 2YWMA 2VM1A 5ELAA 1SVMA 3F6DA 3QAGA 1UN2A 1GNEA 2VLTA 1XWAA 3RHBA 3GMFA 1OVNA 3DVXA 3UIWA 3WGDA 2H19A 2ON7A 1RW1A 1X0RA 2GSTA 2HZEB 2FWGA
chains in the Genus database with same CATH topology
3C7MA 3QCPA 4XIHA 2IFQB 3P90A 5G31A 5LNKe 3CTFA 2C3NA 3FR9A 3LWAA 1BG1A 3DEXA 3M8NA 3LGCA 2K18A 2C80A 2P5RA 5KEJA 4K6XA 4Q5RA 3F0IA 4G19A 4I2TA 2IMDA 1XWGA 4JZQA 3MNGA 4IN0A 4ID0A 3W8JA 1XBSA 5A4VA 2H66A 3F63A 2GSRA 5DQYA 1OKDA 1BF5A 1BX9A 2G2QA 3HA9A 3UVTA 4OFTA 3ZVJA 1U88A 2LRCA 3APSA 2VM2A 1LU4A 1USBA 2V6KA 2H1DA 1RQMA 5KN3A 4XS4B 3GSSA 1EWXA 3K8NA 1X9WB 2JADA 5J4UA 5IMFA 4K7NA 3O6TA 4HUAA 1AC1A 3W8SA 3HVVA 3HCZA 4GRFA 1YEPA 2K8VA 2DJ2A 2RUFA 4K5RA 2CA8A 2H0GA 3KMOA 5HR1A 1B8XA 3D21A 1DE2A 1MDJA 3HY2A 3J7Yk 3L4NA 2BTOT 3GX8A 1ZZYA 4ILFA 4YKGA 4OD7A 1XOAA 5ELGA 3Q18A 3OR5A 2GVPA 2K8SA 1PA3A 1ZYEA 4ZL8A 1R26A 2H76A 4MMMA 2H72A 4N0ZA 4P3YB 4MPFA 2IMKA 2HRKB 4H86A 3VPQA 2QKEA 2JZSA 1PSQA 3LFLA 20GSA 1VF1A 2ON5A 2H70A 4GSSA 4I2UA 5BMUB 5JCGA 1H4OA 5DJMA 6GSXA 5ENUA 1F9MA 2PN8A 1PL1A 1YJ6A 4EC0A 4TR0A 2CQ9A 3CTGA 3ZZXA 2YZUA 3GN3A 1V9WA 3TJJA 4D73A 3WGEA 4FO5A 4GTUA 2ES7A 5JWRB 3IR4A 4IJ3A 1OC9A 4ZILA 1JLVA 2H1AA 1HNCA 5G5FA 1ERTA 2WFCA 4K1FA 3FR3A 3HMJG 2H6XA 14GSA 3ME7A 2C3QA 2RLIA 4YKFA 1ZYQB 2H1GA 3HDCA 2F51A 3D6IA 5F06A 3HJOA 4GSTA 5ECMB 4POKA 2WB9A 5ECSA 1SYRA 5IM9A 4FQUA 2FWEA 4JBBA 2FA4A 4K0GA 5A4WA 3GKKA 2YV7A 1A8LA 2HE3A 2VOCA 2YP6A 2R0GA 1HNBA 5J9CA 2DJJA 4IJIA 3ZMLA 4JEDA 3O76A 1R5PA 1U3AA 3M1GA 4NHWA 3DWVA 2VCZA 1ZYNA 4O5UA 4ZBDA 2WJUA 4QQ7A 2EFCA 5B6NA 4EO3A 4GDFA 2LNSA 2VLVA 4PNFA 1QGVA 1XIYA 4O7HA 1TDIA 3A5IA 3GA4A 3G7YA 1QK8A 1DSBA 2HSHA 1GLQA 1ZMAA 4J56E 5AIVA 5CRGA 2OKAA 2IL3A 2LNTA 1Z6MA 2X4AA 5D9XA 2YPMA 1JZOA 3JCML 3IOSA 1PL2A 4LA1A 2O7KA 4ZB6A 1K3OA 5B8AA 2L59A 2VCTA 2HI7A 1O8WA 1TKDB 2GZYA 2CZ2A 1O81A 2GZPA 2MBTA 1G7OA 2QA2A 4YAVA 4WF4A 4BVXA 5G1LA 2X8HA 1AQVA 2WRTA 2FD3A 2NBSA 22GSA 1K0MA 3ISOA 1OAZA 4MA9A 4Z2UA 4QMKA 3TCOA 2JZRA 2HFDA 3BD2A 3ZMKA 1F6MC 1JZWA 4TRXA 4KAEA 1XWKA 4HEA2 3KD0A 5INYA 1GWCA 3P8WA 3RHCA 4PQ1A 4MABA 1OKTA 1EV4A 17GSA 5A4UA 3ZYWA 4BVYA 5FWGA 1OC8A 5B6MA 3QPMA 3I6AA 3LYPA 3DXBA 3G7JA 1NM3A 4IS0A 3LQ7A 4AF2A 3I43A 4KDXA 3GRXA 4Z2TA 5DBQA 3KXOA 3IXRA 4AKHA 2YANA 4KX4A 1GH2A 5G2ZA 4MF6A 4XCSA 3IE3A 2TRCP 3KM6A 1K3LA 3C1SA 4ZBAA 3U5RE 5D9WA 3HVXA 4K2DA 2VD0A 3Q6OA 1J9BA 3CSJA 1FAAA 1TTZA 1O85A 1O6JA 2H01A 4ZB8A 4KE3A 3RAZA 3J7Yb 3C71A 3M0FA 5JWOB 2WS2A 1DE1A 4N10A 4E8HA 3L9VA 4AI6A 4WEYA 3UAPA 2A2RA 3QD9A 5F07A 4WF5A 2EFDA 2YJ7A 2JZTA 3GYKA 3BBYA 2OE0A 3WGXA 5HR2A 1YZXA 6GSSA 5IQYA 2F8AA 4D73B 2WDUA 4JR6A 1OC9B 2UZ8A 2F3MA 2GT5A 5BMUA 1BJXA 2R0PA 4BWSA 2P0GA 1Q4JA 4JRRA 4KUNA 4TVEA 3H93A 3LXTA 5H5SA 4HQZA 1SKRB 3E0UA 1GLPA 1WIKA 4DEJA 1ON4A 2O89A 4ZXGA 8GSSA 1CQGA 5KN0A 3H79A 2MMZA 2L5OA 4OFMA 3H4KA 1B48A 5CYYA 2X64A 3DRNA 3VLNA 4IELA 5HFKA 3WT1A 3HZ8A 3HJPA 5D93A 2L6DA 5IMVA 3GH6A 3C73A 4KCEA 3G9BA 4LL4B 3D0ZA 3APOA 5G1KA 3ED3A 4TXOB 4FYUA 3DIEA 2DC5A 3F9UA 2UV8G 5ECLB 5J3RA 4KA0A 3TOUA 2HT9A 5GZZB 3FZ5A 2OA7A 2OACA 2VL9A 2CVBA 1AQXA 2KP2A 2M80A 3APQA 2GGTA 4YAPA 1U3IA 1SJZA 1ERVA 3VWVA 5IMCA 1VF3A 3TUEA 1GUHA 5C00A 4Q5QA 4DSRA 4Z7XA 4HQSA 2O8VB 3E3EA 2N5BA 5F0GA 4EDYA 4MDCA 4YQMA 1T1VA 4BVXB 1E6BA 4EDZA 1XZOA 5D9VA 2YWIA 1FB0A 1EEJA 5ECKB 3F4RA 5JWQB 2DKHA 3VI7A 2DMMA 4ECIA 2E2MA 2PU9C 3EU3A 2KLXA 3FZ4A 1ERUA 3LW9A 4USSA 2GT6A 2DJ3A 2B7JA 3TKSC 2JACA 1ACVA 5DCHA 1PRXA 4G01A 1YEXA 4PXOA 3PGTA 2PERA 1T4YA 2REMA 3A2XA 2V1MA 1GSYA 2HSYA 2B5YA 3VURA 4GCIA 4BVYB 4FYBA 3EE2A 1TRWA 4AJ8A 2FA8A 3TGZA 3IK9A 4BA7A 1MTCA 3U6VA 1GNWA 4IBPA 5B7CA 4KF9A 1X9MB 4MJCA 5J9BA 4GWRA 4ECCA 1K0NA 2B1KA 1OYJA 5IO0A 1TP9A 1H75A 4TKYA 1IYHA 1B4PA 1FVKA 2LUSA 3FW2A 4AKGA 1PKZA 4I5QA 1AXDA 2L57A 1XVQA 4GF0A 1NHYA 4L0WA 3GSTA 1SVOA 1TOFA 4TR1A 2A2PA 3FRCA 3F6FA 3CSIA 3EURA 2H75A 4OFNA 18GSA 5LD0A 2R2JA 1ML6A 3EPTA 4BWQA 2XPEA 3KZQA 2H1BA 3RPNA 2BMXA 5AGYA 3DVWA 2PWJA 2FY6A 3HHVA 5KOXA 2WULA 3D22A 2DSAA 1GUMA 5H5RA 2YV9A 3TJKA 4WXTA 2H1LA 1ZOFA 5A34A 1SL1B 1XPVA 2KP1A 3TKSA 1GUKA 2XPDA 3GKXA 2VL2C 2YZHA 4MF7A 4K8MA 4J2FA 5IO2A 3KTLA 2VL3A 5F8BA 1N25A 1UA5A 4KDUA 2NVLA 2DLXA 3EMXA 3V1WA 2PVQA 3VI5A 2C0EA 4LLRA 2I1UA 1WOUA 4EL1A 1XVWA 1TRVA 4V1Ag 1B9XC 1XFLA 1G6WA 2NPBA 6GSYA 2LV3A 3HZ4A 1V58A 4E68A 5CNWA 2KUCA 3AY8A 4POMA 3D5JA 1N2AA 2LRTA 4F82A 2QGVA 2DMLA 5J47A 5CRWA 2EIOA 3R2QA 3ZVJD 3ZFBA 3FEUA 3R3EA 4MH3A 1F3BA 3KH7A 3FMWA 4RI6A 4RUVA 4DVCA 4NPBA 5H5QA 3EC3A 3MIXA 2CVDA 2M72A 3ZFLA 2VLUA 1TRUA 5A1NA 2EIRA 1A0RP 4EF0A 4GLTA 1WRYA 4G10A 3SWLA 5AIXA 1PN0A 4K7OA 1GSSA 5DVBA 2F8FA 5ECPB 3BCIA 2YWNA 4K2XA 3TJFA 4TXVA 3TRXA 2HLSA 3TKPA 1BG5A 1T4ZA 3GKMA 2PMTA 2EFHA 2L4CA 2B6MA 13GSA 1R4WA 4FH8A 3E9JB 5C04A 5FHIA 2VL2A 4TXOA 4N3ZA 3FKFA 4EE0A 2KOKA 4RQRA 2H6YA 5CRHA 3H1NA 1GSDA 2I3YA 3TKQA 3P2AA 1A24A 5J4VA 1G7EA 1Y25A 1SKWB 3M9JA 2HSMA 3EMPA 1FOHA 2L4QA 1FHEA 4IHUA 4MPGA 4PQIA 5ECRB 3KH9A 1JZDA 2VCXA 1A2LA 3A5WA 2FWHA 2ZUPA 1M9BA 4O92A 4WBJA 4MZCA 4AKIA 1MD3A 4MK3A 2AUVA 4IP6A 2F9SA 4LMVA 4OWYA 3PINA 1EP8A 3NZNA 3LXZA 1FOVA 2H71A 3BCKA 4TR3A 4GQFA 1VF4A 2FCHA 5DCGA 4MJBA 1QQ2A 3UARA 3US3A 1XOBA 5CRDA 1JHBA 3KGKA 2Z9SA 1A23A 2CX4A 4AJ6A 1MDIA 5CO3A 3ZITA 2MYGA 1PGTA 4F2IA 3GIXA 1OE7A 1WJKA 4XS6A 5HFIA 1PD21 1GTIA 1EV9A 4I97A 1GSEA 1FB6A 1M2BA 4HS1A 3BOAA 4PQHA 1BAYA 2RIIA 3L78A 3TRPA 4TR1B 2OBIA 2LJRA 2NTOA 1ZGNA 4NMUA 5IMDA 3FYGA 4X4JA 2CVKA 1Z7PA 2R3XA 5E59A 4PUAA 1PMTA 4CDOA 2HRNA 3TB2A 3IBHA 2HRAA 2FUG2 2GQKA 1GL8A 2GS3A 4AJ7A 5D73A 3MDKA 4A5PA 2VO4A 2H30A 5A34B 3CSHA 2X8GA 4IKHA 2XHFA 2GDRA 5DQSA 3GNJA 1GSUA 3IV4A 2IMFA 1EGOA 3EVIA 5COHA 4ZB9A 1JFUA 3ZIJA 1KBNA 1K0CA 3DKSA 3QMXA 1W4VA 1PN9A 2DKIA 1QUWA 2M46A 2LQOA 3F8UA 1Y1UA 2IN3A 5A5HA 4BL7A 3KEBA 1Z3EA 4TW5A 2R0CA 2AYTA 4LL1B 1S3CA 2G0FA 1N8JA 4ML1A 3N9JA 2ZNMA 4MLYA 2C4JA 1K0OA 1F3AA 1EZKA 4PNGA 4IGJA 3ZRDA 2OT3A 4PUFC 6GSWA 1YDKA 1SK0A 1X9SB 2XBQA 4KGIA 2E0QA 1MEKA 3TOTA 1WE0A 1EP7A 1QXHA 1QMVA 3GURA 3RDWA 2H74A 3A2WA 1B4QA 1DBYA 2X99A 3ZIVA 4O5QA 4GQCA 5IMZA 2QC7A 1G0TA 1PQNA 4EVMA 2RM6A 5A1NB 3FY7A 3DGQA 5ECHB 4KSMA 5G30A 4OCEA 3Q74A 4POBA 2MMAA 5EL8A 3CRTA 1AIUA 1PKWA 4HJ2A 3FZ9A 1JZRA 1A8YA 5CAXA 2R6KA 5JCWA 1OC3A 3KTBA 2HNLA 5HFGA 1ABAA 3ZREA 2MMNA 3EYTA 3VFIA 1V98A 5AISA 4ZIJA 2JU5A 3VWXA 2AV4A 2CAQA 3QFBC 4K5SA 16GSA 1MDKA 5KOWA 2O87A 2DJ1A 4RQXA 3I9V2 3NOFA 5IOXA 4YQVA 2H8LA 2HSMB 3PR8A 1AW9A 3KJYA 3LG6A 5ABRA 1WMJA 4V2NA 1GSFA 4IQ1A 5DALA 4X1UA 2FNOA 4PX1A 2O5VA 4NV5A 1LJRA 3F3RA 4EXJA 3GFKA 2VCWA 4WKWA 3A3TA 3QFAC 1GULA 4MH2A 2IWTA 1Z7RA 1VRSD 1YQ1A 1TU8A 3HKRA 4OO5A 4CY8A 4CW9A 2WZ9A 2C0FA 1E2YA 4F03A 4ZB7A 3QOUA 2QSIA 1T3BA 2N5FA 2DJ0A 2PPTA 1LBKA 3CYNA 4F9ZA 1TI1A 5G5EA 3D4MA 4KCAA 4BPYA 2YN1A 1I5GA 3HXSA 3RBTA 1NHOA 1J0FA 3VWWA 4TOPA 3H8QA 1HQOA 4KH7A 3D4TA 4L5LA 7GSSA 2C0GA 2LRNA 4K9ZA 4AGSA 10GSA 2GTUA 1ST9A 1O8XA 2HRFA 2PUKC 5EPFA 2YOIA 3UJ1A 2B3SA 1GSQA 4V2LA 3DMLA 2AAWA 2P31A 1GTBA 2TRXA 6GSTA 3IA1A 1FO5A 4N11A 3WT2A 5CP1A 5B8BA 3CXGA 3UVHA 4KDYA 3F3QA 2V6OA 5J5NA 5HR0A 1RK4A 2FLSA 2HXKA 4G0KA 3P7XA 4HZ2A 1HD2A 2MBSA 4QL9A 1YF0A 4L0UA 5GSTA 2XBIA 5DAKA 2I81A 5L71A 1UVZA 3QAWA 3L9UA 1M0UA 3DD3A 4ZL9A 4G0IA 5BRTA 1SK2A 1YKCA 2OBKA 1F2EA 3LJRA 1M2AA 1X5DA 4NXIA 2DIYA 1GP1A 1HYUA 3HVSA 4EUYA 1A0FA 3GKNA 4Q5NA 2N5AA 2PVOC 2HZFA 2KHPA 2VCVA 2B7KA 3F4TA 5A5HB 3IK7A 4BL7B 4O32A 3TKSE 3KMNA 4HOJA 3LORA 4EIPA 1V2AA 4KB3A 3TKRA 2E7PA 2VCQA 3IPZA 5IPHA 2JL4A 4AKXB 1SU9A 5ECQB 5GAPD 3MAKA 1SYXA 4L5OA 1TJDA 2R37A 2FWFA 2LJAA 2LSTA 4J57E 3FZAA 4ECBA 4DSSA 4O5RA 1XXUA 1Z9HA 1SENA 3IC8A 3IAS2 2IMEA 2IJYA 2C1YA 4IP1A 4I6XA 4WBRD 4FIWA 1ERWA 1TU7A 2GQMA 2PGTA 2GQLA 4IVFA 11GSA 3GL3A 1KTEA 2VAFA 1Q98A 3IC4A 3UBLA 4Z2RA 2AB6A 3QR6A 1I9DA 1SD9A 1TXUA 1K0BA 2QA1A 1XW5A 1YF1A 1ZCPA 2J9HA 3FHKA 1IYIA 4ULXA 1AQWA 4KSOA 3IAM2 4QL7A 2GLRA 3G7IA 1M7TA 3I69A 5DDLA 4F0CA 1THOA 5DJLA 1JLWA 1F37A 4TR4A 4NV2A 5J40A 3L0HA 2DIZA 2LKUA 4YQUA 1T7PB 4HU7A 1J08A 3ZLPA 4POLA 3VWUA 2DBCA 4FYCA 3SBCA 4MJEA 2B1LA 4XS1A 2H6ZA 1CQHA 4XRDA 1YVLA 3UMAA 1BYEA 1SL0B 12GSA 4OMVA 3TU3B 2VUPA 1TK5B 3BJ5A 2AJQB 2X8CA 4V1Ap 2OADA 1S3DA 2HSNA 3FK8A 1K0DA 2V2GA 2B5EA 3EWLA 1HNAA 2OE1A 5KN2A 2HYXA 1B9YC 4MP4A 1PX6A 3HYPA 5D9TA 5DALB 3ERWA 3IHGA 5LCZA 2H0IA 4XHMA 4RI7A 3UBKA 1TW9A 2L5LA 3EINA 1THXA 3F4SA 4GXZA 5KN1A 2B5XA 3IDVA 4JR4A 1PX7A 5D96A 4IW9A 1Z6NA 2VD1A 3KP8A 2FHEA 1TI3A 4MF5A 3C8EA 3GTUA 4ML6A 4F0BA 2DJKA 4NAXA 5ID2A 1SK1A 2CZ3A 2X49A 2YNXA 5HQPA 1EOHA 6GSUA 4TN8A 4N0VA 2CT6A 1QFNA 4K0NA 2EFEA 2P5QA 1GTUA 5J41A 2A2SA 4L8EA 4MJAA 3N5OA 1NW2A 2YJHA 3HD5A 4OCFA 2LTKA 1XWBA 2I4AA 2C8UA 4DSQA 1EGRA 1W89A 3W6GA 1EEMA 1U87A 1SVLA 1ILOA 1XW6A 2CV4A 3M3MA 2E2GA 3HJMA 1R7HA 3GX0A 2GSQA 1KNGA 4HI7A 1V40A 1WP0A 2K9FA 1G6YA 2AHEA 3ERGA 2VIMA 5HR3A 3ERFA 1Y6EA 1X5CA 2MZCA 2IIYA 1SKSB 2HZEA 3IRAA 4XTSA 2LQQA 2IFQA 3L9SA 3ZL5A 4CHSA 5J4YA 4ZBBA 6GSVA 1VF2A 5DAKB 1U6TA 2MMOA 4ACSA 4W66A 1XW9A 3DYRA 3CMIA 3QAVA 3MYDA 3GUSA 2C0DA 3PPUA 1S3AA 1UC7A 1MD4A 1ZL9A 5GSSA 3GH9A 3KP9A 3WD6A 1XWCA 5EVOA 4NHZA 2FGXA 4WR5A 1O7UA 1TK8B 3PH9A 2J23A 2EIQA 2CX3A 4LMWA 1GTAA 4XS4A 2IPAA 3MSZA 4OO4A 5IIZA 1T8EB 4JE1A 3UOMA 5IOWA 1GRXA 5D8IA 3NIVA 1FW1A 1BQ7A 2RUEA 1X5EA 4EIQA 1A2JA 2BJXA 1K3YA 4PGTA 2R4VA 2CAIA 2C3TA 4DSSB 3O3TA 3M9KA 1O73A 1TRSA 1VGLA 2XC2A 3EU4A 2H0HA 4MZWA 1KEBA 1XCCA 1K0AA 4I8BA 5ECOB 2D2ZA 3IHQA 4E8EA 3KCMA 2VKZG 4KNDA 2A4VA 4ZL7A 5ECNB 4ICYA 4YH2A 2YWOA 4PTSA 4CY6A 2YCDA 1ZYPA 2HQTA 1OE8A 5GAND 1EOGA 2HRKA 3FR6A 3GL5A 4G2EA 3KIJA 1WPIA 5EY6A 4HJMA 4HZ4A 4PURA 3TJBA 3ME8A 3VPTA 1R5AA 3CRUA 4MCUA 1URMA 2EC4A 3A2VA 5A5KA 2ZCTA 5IPGA 1TK0B 2V32A 5JCUA 4X43A 2R5GA 3WYWA 2LEGA 4G0LA 2JSZA 1YY7A 1SJ6A 4K7IA 4XRAA 2WCIA 1BEDA 1AAZA 5E4WA 3C1RA 2WGRA 1FG4A 4MNNA 2HSNB 5FT3A 1M99A 4N30A 3TDGA 2I9HA 1A2MA 2OE3A 5F05A 4Q5FA 2JSYA 9GSSA 3TJGA 1V57A 3GV1A 5CREA 4ECJA 1T00A 5IMAA 2GZZA 4EKZA 4X0XA 1AUCA 4HU9A 1NSWA 3RPPA 3LYKA 3LEFA 4KW6A 1TXXA 4NWYA 2PBJA 2TIRA 3MWHA 2ALBA 3S9FA 2LJKA 1M2DA 2RM5A 4WR4A 1SD8A 1YKAA 2NDOA 1WWJA 2A4HA 3CBUA 2IMIA 1DUGA 1M9AA 3GTUB 2LS5A 5ECIB 4ISDA 4G9HA 3UL3A 2O85A 4HDEA 5ID2B 2GSSA 2K6VA 4V2MA 3TRQA 2V41A 1FVJA 3GHAA 3QDNA 4JU5A 1Z5YE 5AN1A 19GSA 4MZBA 1C72A 1SJIA 3UEMA 3CWGA 1SL2B 3Q19A 4WETA 4GSNA 4IQAA 2OJLA 3ZTLA 2L6CA 3LSZA 2H73A 3VK9A 2YWMA 2VM1A 5ELAA 1SVMA 3F6DA 3QAGA 1UN2A 1GNEA 2VLTA 1XWAA 3RHBA 3GMFA 1OVNA 3DVXA 3UIWA 3WGDA 2H19A 2ON7A 1RW1A 1X0RA 2GSTA 2HZEB 2FWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7M A;  3QCP A;  4XIH A;  2IFQ B;  3P90 A;  5G31 A;  5LNK e;  3CTF A;  2C3N A;  3FR9 A;  3LWA A;  3DEX A;  3M8N A;  3LGC A;  2K18 A;  2C80 A;  2P5R A;  5KEJ A;  4K6X A;  4Q5R A;  3F0I A;  4G19 A;  4I2T A;  2IMD A;  1XWG A;  4JZQ A;  3MNG A;  4IN0 A;  4ID0 A;  3W8J A;  1XBS A;  5A4V A;  2H66 A;  3F63 A;  2GSR A;  5DQY A;  1OKD A;  1BX9 A;  2G2Q A;  3HA9 A;  3UVT A;  4OFT A;  3ZVJ A;  1U88 A;  2LRC A;  3APS A;  2VM2 A;  1LU4 A;  1USB A;  2V6K A;  2H1D A;  1RQM A;  5KN3 A;  4XS4 B;  3GSS A;  1EWX A;  3K8N A;  1X9W B;  2JAD A;  5J4U A;  5IMF A;  4K7N A;  3O6T A;  4HUA A;  1AC1 A;  3W8S A;  3HVV A;  3HCZ A;  4GRF A;  1YEP A;  2K8V A;  2DJ2 A;  2RUF A;  2CA8 A;  2H0G A;  3KMO A;  5HR1 A;  1B8X A;  3D21 A;  1DE2 A;  1MDJ A;  3HY2 A;  3J7Y k;  3L4N A;  2BTO T;  3GX8 A;  1ZZY A;  4ILF A;  4OD7 A;  1XOA A;  5ELG A;  3Q18 A;  3OR5 A;  2GVP A;  2K8S A;  1PA3 A;  1ZYE A;  4ZL8 A;  1R26 A;  2H76 A;  4MMM A;  2H72 A;  4N0Z A;  4P3Y B;  4MPF A;  2IMK A;  2HRK B;  4H86 A;  3VPQ A;  2QKE A;  2JZS A;  1PSQ A;  3LFL A;  20GS A;  1VF1 A;  2ON5 A;  2H70 A;  4GSS A;  4I2U A;  5JCG A;  1H4O A;  5DJM A;  6GSX A;  5ENU A;  1F9M A;  2PN8 A;  1PL1 A;  1YJ6 A;  4EC0 A;  4TR0 A;  2CQ9 A;  3CTG A;  3ZZX A;  2YZU A;  3GN3 A;  1V9W A;  3TJJ A;  4D73 A;  3WGE A;  4FO5 A;  4GTU A;  2ES7 A;  5JWR B;  3IR4 A;  4IJ3 A;  1OC9 A;  4ZIL A;  1JLV A;  2H1A A;  1HNC A;  5G5F A;  1ERT A;  2WFC A;  4K1F A;  3FR3 A;  2H6X A;  14GS A;  3ME7 A;  2C3Q A;  2RLI A;  1ZYQ B;  2H1G A;  3HDC A;  2F51 A;  3D6I A;  5F06 A;  3HJO A;  4GST A;  5ECM B;  4POK A;  2WB9 A;  5ECS A;  1SYR A;  5IM9 A;  4FQU A;  2FWE A;  4JBB A;  2FA4 A;  4K0G A;  5A4W A;  3GKK A;  2YV7 A;  1A8L A;  2HE3 A;  2VOC A;  2YP6 A;  1HNB A;  5J9C A;  2DJJ A;  4IJI A;  3ZML A;  4JED A;  3O76 A;  1R5P A;  1U3A A;  3M1G A;  4NHW A;  3DWV A;  2VCZ A;  4ZBD A;  2WJU A;  4QQ7 A;  5B6N A;  4EO3 A;  2LNS A;  2VLV A;  4PNF A;  1QGV A;  1XIY A;  4O7H A;  1TDI A;  3GA4 A;  3G7Y A;  1QK8 A;  1DSB A;  2HSH A;  1GLQ A;  1ZMA A;  4J56 E;  5AIV A;  5CRG A;  2OKA A;  2IL3 A;  2LNT A;  1Z6M A;  5D9X A;  2YPM A;  1JZO A;  3JCM L;  3IOS A;  1PL2 A;  4LA1 A;  2O7K A;  4ZB6 A;  1K3O A;  5B8A A;  2L59 A;  2VCT A;  2HI7 A;  1O8W A;  1TKD B;  2GZY A;  2CZ2 A;  1O81 A;  2GZP A;  2MBT A;  1G7O A;  4YAV A;  4WF4 A;  4BVX A;  5G1L A;  2X8H A;  1AQV A;  2WRT A;  2FD3 A;  2NBS A;  22GS A;  1K0M A;  3ISO A;  1OAZ A;  4MA9 A;  3TCO A;  2JZR A;  2HFD A;  3BD2 A;  3ZMK A;  1F6M C;  1JZW A;  4TRX A;  4KAE A;  1XWK A;  4HEA 2;  3KD0 A;  5INY A;  1GWC A;  3P8W A;  3RHC A;  4PQ1 A;  4MAB A;  1OKT A;  1EV4 A;  17GS A;  5A4U A;  3ZYW A;  4BVY A;  5FWG A;  1OC8 A;  5B6M A;  3QPM A;  3I6A A;  3LYP A;  3DXB A;  3G7J A;  1NM3 A;  4IS0 A;  3LQ7 A;  4AF2 A;  3I43 A;  4KDX A;  3GRX A;  5DBQ A;  3KXO A;  3IXR A;  2YAN A;  4KX4 A;  1GH2 A;  5G2Z A;  4MF6 A;  4XCS A;  3IE3 A;  2TRC P;  3KM6 A;  1K3L A;  3C1S A;  4ZBA A;  3U5R E;  5D9W A;  3HVX A;  4K2D A;  2VD0 A;  3Q6O A;  1J9B A;  3CSJ A;  1FAA A;  1TTZ A;  1O85 A;  1O6J A;  2H01 A;  4ZB8 A;  4KE3 A;  3RAZ A;  3J7Y b;  3C71 A;  3M0F A;  5JWO B;  2WS2 A;  1DE1 A;  4N10 A;  4E8H A;  3L9V A;  4WEY A;  3UAP A;  2A2R A;  3QD9 A;  5F07 A;  4WF5 A;  2YJ7 A;  2JZT A;  3GYK A;  3BBY A;  2OE0 A;  3WGX A;  5HR2 A;  1YZX A;  6GSS A;  5IQY A;  2F8A A;  4D73 B;  2WDU A;  4JR6 A;  1OC9 B;  2UZ8 A;  2F3M A;  2GT5 A;  5BMU A;  1BJX A;  4BWS A;  2P0G A;  1Q4J A;  4JRR A;  4KUN A;  4TVE A;  3H93 A;  3LXT A;  5H5S A;  4HQZ A;  1SKR B;  3E0U A;  1GLP A;  1WIK A;  4DEJ A;  1ON4 A;  2O89 A;  4ZXG A;  8GSS A;  1CQG A;  5KN0 A;  3H79 A;  2MMZ A;  2L5O A;  4OFM A;  3H4K A;  1B48 A;  5CYY A;  2X64 A;  3DRN A;  3VLN A;  4IEL A;  5HFK A;  3WT1 A;  3HZ8 A;  3HJP A;  5D93 A;  2L6D A;  5IMV A;  3GH6 A;  3C73 A;  4KCE A;  3G9B A;  4LL4 B;  3D0Z A;  3APO A;  5G1K A;  3ED3 A;  4TXO B;  4FYU A;  3DIE A;  2DC5 A;  3F9U A;  5ECL B;  5J3R A;  4KA0 A;  3TOU A;  2HT9 A;  5GZZ B;  3FZ5 A;  2OA7 A;  2OAC A;  2VL9 A;  2CVB A;  1AQX A;  2KP2 A;  2M80 A;  3APQ A;  2GGT A;  4YAP A;  1U3I A;  1SJZ A;  1ERV A;  3VWV A;  5IMC A;  1VF3 A;  3TUE A;  1GUH A;  5C00 A;  4Q5Q A;  4DSR A;  4Z7X A;  4HQS A;  2O8V B;  3E3E A;  2N5B A;  5F0G A;  4EDY A;  4MDC A;  4YQM A;  1T1V A;  4BVX B;  1E6B A;  4EDZ A;  1XZO A;  5D9V A;  2YWI A;  1FB0 A;  1EEJ A;  5ECK B;  3F4R A;  5JWQ B;  3VI7 A;  2DMM A;  4ECI A;  2E2M A;  2PU9 C;  3EU3 A;  2KLX A;  3FZ4 A;  1ERU A;  4USS A;  2GT6 A;  2DJ3 A;  2B7J A;  3TKS C;  2JAC A;  1ACV A;  5DCH A;  1PRX A;  1YEX A;  4PXO A;  3PGT A;  2PER A;  1T4Y A;  2REM A;  3A2X A;  2V1M A;  1GSY A;  2HSY A;  2B5Y A;  3VUR A;  4GCI A;  4BVY B;  4FYB A;  3EE2 A;  1TRW A;  4AJ8 A;  2FA8 A;  3TGZ A;  3IK9 A;  4BA7 A;  1MTC A;  3U6V A;  1GNW A;  4IBP A;  5B7C A;  4KF9 A;  1X9M B;  4MJC A;  5J9B A;  4GWR A;  4ECC A;  1K0N A;  2B1K A;  1OYJ A;  5IO0 A;  1TP9 A;  1H75 A;  4TKY A;  1IYH A;  1B4P A;  1FVK A;  2LUS A;  3FW2 A;  1PKZ A;  4I5Q A;  1AXD A;  2L57 A;  1XVQ A;  4GF0 A;  1NHY A;  4L0W A;  3GST A;  1TOF A;  4TR1 A;  3FRC A;  3F6F A;  3CSI A;  3EUR A;  2H75 A;  4OFN A;  18GS A;  5LD0 A;  2R2J A;  1ML6 A;  4BWQ A;  2XPE A;  3KZQ A;  2H1B A;  3RPN A;  2BMX A;  5AGY A;  3DVW A;  2PWJ A;  2FY6 A;  3HHV A;  2WUL A;  3D22 A;  2DSA A;  1GUM A;  5H5R A;  2YV9 A;  3TJK A;  4WXT A;  1ZOF A;  1SL1 B;  1XPV A;  2KP1 A;  3TKS A;  1GUK A;  2XPD A;  3GKX A;  2VL2 C;  2YZH A;  4MF7 A;  4K8M A;  4J2F A;  5IO2 A;  3KTL A;  2VL3 A;  5F8B A;  1UA5 A;  4KDU A;  2NVL A;  2DLX A;  3EMX A;  3V1W A;  2PVQ A;  3VI5 A;  2C0E A;  4LLR A;  2I1U A;  1WOU A;  4EL1 A;  1XVW A;  1TRV A;  4V1A g;  1B9X C;  1XFL A;  1G6W A;  2NPB A;  6GSY A;  2LV3 A;  3HZ4 A;  1V58 A;  5CNW A;  2KUC A;  3AY8 A;  4POM A;  3D5J A;  1N2A A;  2LRT A;  4F82 A;  2QGV A;  2DML A;  5CRW A;  2EIO A;  3R2Q A;  3ZVJ D;  3ZFB A;  3FEU A;  3R3E A;  4MH3 A;  1F3B A;  3KH7 A;  4RI6 A;  4RUV A;  4DVC A;  4NPB A;  5H5Q A;  3EC3 A;  2CVD A;  2M72 A;  3ZFL A;  2VLU A;  1TRU A;  2EIR A;  1A0R P;  4EF0 A;  4GLT A;  1WRY A;  4G10 A;  3SWL A;  5AIX A;  5DVB A;  4K7O A;  1GSS A;  2F8F A;  5ECP B;  3BCI A;  2YWN A;  3TJF A;  4TXV A;  3TRX A;  2HLS A;  3TKP A;  1BG5 A;  1T4Z A;  3GKM A;  2PMT A;  2L4C A;  2B6M A;  13GS A;  1R4W A;  4FH8 A;  3E9J B;  5C04 A;  5FHI A;  2VL2 A;  4TXO A;  3FKF A;  4EE0 A;  2KOK A;  4RQR A;  2H6Y A;  5CRH A;  3H1N A;  1GSD A;  2I3Y A;  3TKQ A;  3P2A A;  1A24 A;  1G7E A;  1Y25 A;  1SKW B;  3M9J A;  2HSM A;  3EMP A;  2L4Q A;  1FHE A;  4IHU A;  4MPG A;  4PQI A;  5ECR B;  3KH9 A;  1JZD A;  2VCX A;  1A2L A;  3A5W A;  2FWH A;  2ZUP A;  1M9B A;  4O92 A;  4WBJ A;  4MZC A;  1MD3 A;  4MK3 A;  2AUV A;  4IP6 A;  2F9S A;  4LMV A;  4OWY A;  3PIN A;  1EP8 A;  3NZN A;  3LXZ A;  1FOV A;  2H71 A;  3BCK A;  4TR3 A;  4GQF A;  1VF4 A;  2FCH A;  5DCG A;  4MJB A;  1QQ2 A;  3UAR A;  3US3 A;  1XOB A;  5CRD A;  1JHB A;  3KGK A;  2Z9S A;  1A23 A;  2CX4 A;  4AJ6 A;  1MDI A;  5CO3 A;  3ZIT A;  2MYG A;  1PGT A;  4F2I A;  3GIX A;  1OE7 A;  1WJK A;  4XS6 A;  5HFI A;  1PD2 1;  1GTI A;  1EV9 A;  4I97 A;  1GSE A;  1FB6 A;  1M2B A;  4HS1 A;  3BOA A;  4PQH A;  1BAY A;  2RII A;  3L78 A;  3TRP A;  4TR1 B;  2OBI A;  2LJR A;  2NTO A;  1ZGN A;  4NMU A;  5IMD A;  3FYG A;  2CVK A;  1Z7P A;  2R3X A;  5E59 A;  4PUA A;  1PMT A;  4CDO A;  2HRN A;  3TB2 A;  3IBH A;  2HRA A;  2FUG 2;  2GQK A;  1GL8 A;  2GS3 A;  4AJ7 A;  5D73 A;  3MDK A;  2VO4 A;  2H30 A;  3CSH A;  2X8G A;  4IKH A;  2XHF A;  2GDR A;  5DQS A;  3GNJ A;  1GSU A;  3IV4 A;  2IMF A;  1EGO A;  3EVI A;  5COH A;  4ZB9 A;  1JFU A;  3ZIJ A;  1KBN A;  1K0C A;  3DKS A;  3QMX A;  1W4V A;  1PN9 A;  1QUW A;  2M46 A;  2LQO A;  3F8U A;  2IN3 A;  4BL7 A;  3KEB A;  1Z3E A;  4TW5 A;  2AYT A;  4LL1 B;  1S3C A;  2G0F A;  1N8J A;  4ML1 A;  3N9J A;  2ZNM A;  4MLY A;  2C4J A;  1K0O A;  1F3A A;  1EZK A;  4PNG A;  4IGJ A;  3ZRD A;  4PUF C;  6GSW A;  1YDK A;  1SK0 A;  1X9S B;  2XBQ A;  4KGI A;  2E0Q A;  1MEK A;  3TOT A;  1WE0 A;  1EP7 A;  1QXH A;  1QMV A;  3GUR A;  3RDW A;  2H74 A;  3A2W A;  1B4Q A;  1DBY A;  2X99 A;  3ZIV A;  4GQC A;  5IMZ A;  2QC7 A;  1G0T A;  1PQN A;  4EVM A;  2RM6 A;  3FY7 A;  3DGQ A;  5ECH B;  4KSM A;  5G30 A;  4OCE A;  3Q74 A;  4POB A;  2MMA A;  5EL8 A;  3CRT A;  1AIU A;  1PKW A;  4HJ2 A;  3FZ9 A;  1JZR A;  1A8Y A;  5CAX A;  2R6K A;  5JCW A;  1OC3 A;  3KTB A;  2HNL A;  5HFG A;  1ABA A;  3ZRE A;  2MMN A;  3EYT A;  3VFI A;  1V98 A;  5AIS A;  4ZIJ A;  2JU5 A;  3VWX A;  2AV4 A;  2CAQ A;  3QFB C;  16GS A;  1MDK A;  2O87 A;  2DJ1 A;  4RQX A;  3I9V 2;  3NOF A;  5IOX A;  4YQV A;  2H8L A;  2HSM B;  3PR8 A;  1AW9 A;  3KJY A;  3LG6 A;  5ABR A;  1WMJ A;  4V2N A;  1GSF A;  4IQ1 A;  5DAL A;  4X1U A;  2FNO A;  4PX1 A;  4NV5 A;  1LJR A;  3F3R A;  4EXJ A;  3GFK A;  2VCW A;  4WKW A;  3A3T A;  3QFA C;  1GUL A;  4MH2 A;  2IWT A;  1Z7R A;  1VRS D;  1YQ1 A;  1TU8 A;  3HKR A;  4OO5 A;  4CW9 A;  2WZ9 A;  2C0F A;  1E2Y A;  4F03 A;  3QOU A;  2QSI A;  1T3B A;  2N5F A;  2DJ0 A;  2PPT A;  1LBK A;  3CYN A;  4F9Z A;  1TI1 A;  5G5E A;  3D4M A;  4KCA A;  4BPY A;  2YN1 A;  1I5G A;  3HXS A;  3RBT A;  1NHO A;  1J0F A;  3VWW A;  4TOP A;  3H8Q A;  1HQO A;  4KH7 A;  3D4T A;  4L5L A;  7GSS A;  2C0G A;  2LRN A;  4K9Z A;  4AGS A;  10GS A;  2GTU A;  1ST9 A;  1O8X A;  2HRF A;  2PUK C;  5EPF A;  2YOI A;  3UJ1 A;  2B3S A;  1GSQ A;  4V2L A;  3DML A;  2AAW A;  2P31 A;  1GTB A;  2TRX A;  6GST A;  3IA1 A;  1FO5 A;  4N11 A;  3WT2 A;  5CP1 A;  5B8B A;  3CXG A;  3UVH A;  4KDY A;  3F3Q A;  2V6O A;  5J5N A;  5HR0 A;  1RK4 A;  2FLS A;  2HXK A;  4G0K A;  3P7X A;  4HZ2 A;  1HD2 A;  2MBS A;  4QL9 A;  1YF0 A;  4L0U A;  5GST A;  2XBI A;  5DAK A;  2I81 A;  5L71 A;  1UVZ A;  3QAW A;  3L9U A;  1M0U A;  3DD3 A;  4ZL9 A;  4G0I A;  1SK2 A;  1YKC A;  2OBK A;  1F2E A;  3LJR A;  1M2A A;  1X5D A;  4NXI A;  2DIY A;  1GP1 A;  1HYU A;  3HVS A;  4EUY A;  1A0F A;  3GKN A;  4Q5N A;  2N5A A;  2PVO C;  2HZF A;  2KHP A;  2VCV A;  2B7K A;  3F4T A;  3IK7 A;  4BL7 B;  4O32 A;  3TKS E;  3KMN A;  4HOJ A;  3LOR A;  1V2A A;  4KB3 A;  3TKR A;  2E7P A;  2VCQ A;  3IPZ A;  5IPH A;  2JL4 A;  1SU9 A;  5ECQ B;  5GAP D;  3MAK A;  1SYX A;  4L5O A;  1TJD A;  2R37 A;  2FWF A;  2LJA A;  2LST A;  4J57 E;  3FZA A;  4ECB A;  4DSS A;  4O5R A;  1XXU A;  1Z9H A;  1SEN A;  3IC8 A;  3IAS 2;  2IME A;  2IJY A;  2C1Y A;  4IP1 A;  4I6X A;  4WBR D;  4FIW A;  1ERW A;  1TU7 A;  2GQM A;  2PGT A;  2GQL A;  4IVF A;  11GS A;  3GL3 A;  1KTE A;  2VAF A;  1Q98 A;  3IC4 A;  3UBL A;  2AB6 A;  3QR6 A;  1I9D A;  1SD9 A;  1K0B A;  1XW5 A;  1YF1 A;  1ZCP A;  2J9H A;  3FHK A;  1IYI A;  4ULX A;  1AQW A;  4KSO A;  3IAM 2;  4QL7 A;  2GLR A;  3G7I A;  1M7T A;  3I69 A;  5DDL A;  4F0C A;  1THO A;  5DJL A;  1JLW A;  1F37 A;  4TR4 A;  4NV2 A;  3L0H A;  2DIZ A;  2LKU A;  4YQU A;  1T7P B;  4HU7 A;  1J08 A;  3ZLP A;  4POL A;  3VWU A;  2DBC A;  4FYC A;  3SBC A;  4MJE A;  2B1L A;  4XS1 A;  2H6Z A;  1CQH A;  4XRD A;  3UMA A;  1BYE A;  1SL0 B;  12GS A;  4OMV A;  2VUP A;  1TK5 B;  3BJ5 A;  2AJQ B;  2X8C A;  4V1A p;  2OAD A;  1S3D A;  3FK8 A;  1K0D A;  2V2G A;  2B5E A;  3EWL A;  1HNA A;  2OE1 A;  5KN2 A;  2HYX A;  1B9Y C;  4MP4 A;  1PX6 A;  3HYP A;  5D9T A;  5DAL B;  3ERW A;  5LCZ A;  2H0I A;  4XHM A;  4RI7 A;  3UBK A;  1TW9 A;  2L5L A;  3EIN A;  1THX A;  3F4S A;  4GXZ A;  5KN1 A;  2B5X A;  3IDV A;  4JR4 A;  1PX7 A;  5D96 A;  4IW9 A;  1Z6N A;  2VD1 A;  3KP8 A;  2FHE A;  1TI3 A;  4MF5 A;  3C8E A;  3GTU A;  4ML6 A;  4F0B A;  2DJK A;  4NAX A;  5ID2 A;  1SK1 A;  2CZ3 A;  2YNX A;  5HQP A;  1EOH A;  6GSU A;  4TN8 A;  4N0V A;  2CT6 A;  1QFN A;  4K0N A;  2P5Q A;  1GTU A;  5J41 A;  2A2S A;  4L8E A;  4MJA A;  3N5O A;  1NW2 A;  2YJH A;  3HD5 A;  4OCF A;  2LTK A;  1XWB A;  2I4A A;  2C8U A;  4DSQ A;  1EGR A;  1W89 A;  3W6G A;  1EEM A;  1U87 A;  1ILO A;  1XW6 A;  2CV4 A;  3M3M A;  2E2G A;  3HJM A;  1R7H A;  3GX0 A;  2GSQ A;  1KNG A;  4HI7 A;  1V40 A;  1WP0 A;  2K9F A;  1G6Y A;  2AHE A;  3ERG A;  2VIM A;  5HR3 A;  3ERF A;  1Y6E A;  1X5C A;  2MZC A;  2IIY A;  1SKS B;  2HZE A;  3IRA A;  4XTS A;  2LQQ A;  2IFQ A;  3L9S A;  3ZL5 A;  4CHS A;  4ZBB A;  6GSV A;  1VF2 A;  5DAK B;  1U6T A;  2MMO A;  4ACS A;  1XW9 A;  3DYR A;  3CMI A;  3QAV A;  3GUS A;  2C0D A;  3PPU A;  1S3A A;  1UC7 A;  1MD4 A;  1ZL9 A;  5GSS A;  3GH9 A;  3KP9 A;  3WD6 A;  1XWC A;  5EVO A;  4NHZ A;  2FGX A;  4WR5 A;  1O7U A;  1TK8 B;  3PH9 A;  2J23 A;  2EIQ A;  2CX3 A;  4LMW A;  1GTA A;  4XS4 A;  2IPA A;  3MSZ A;  4OO4 A;  5IIZ A;  1T8E B;  4JE1 A;  3UOM A;  5IOW A;  1GRX A;  5D8I A;  3NIV A;  1FW1 A;  1BQ7 A;  2RUE A;  1X5E A;  1A2J A;  2BJX A;  1K3Y A;  4PGT A;  2R4V A;  2CAI A;  2C3T A;  4DSS B;  3O3T A;  3M9K A;  1O73 A;  1TRS A;  1VGL A;  2XC2 A;  3EU4 A;  2H0H A;  4MZW A;  1KEB A;  1XCC A;  1K0A A;  4I8B A;  5ECO B;  2D2Z A;  3IHQ A;  4E8E A;  3KCM A;  4KND A;  2A4V A;  4ZL7 A;  5ECN B;  4YH2 A;  2YWO A;  4PTS A;  2YCD A;  2HQT A;  1OE8 A;  5GAN D;  1EOG A;  2HRK A;  3FR6 A;  3GL5 A;  4G2E A;  3KIJ A;  1WPI A;  5EY6 A;  4HJM A;  4HZ4 A;  4PUR A;  3TJB A;  3ME8 A;  3VPT A;  1R5A A;  3CRU A;  4MCU A;  1URM A;  2EC4 A;  3A2V A;  5A5K A;  2ZCT A;  5IPG A;  1TK0 B;  2V32 A;  5JCU A;  4X43 A;  2R5G A;  3WYW A;  2LEG A;  4G0L A;  2JSZ A;  1YY7 A;  1SJ6 A;  4K7I A;  4XRA A;  2WCI A;  1BED A;  1AAZ A;  5E4W A;  3C1R A;  2WGR A;  1FG4 A;  2HSN B;  5FT3 A;  1M99 A;  4N30 A;  3TDG A;  2I9H A;  1A2M A;  2OE3 A;  5F05 A;  4Q5F A;  2JSY A;  9GSS A;  3TJG A;  1V57 A;  3GV1 A;  5CRE A;  4ECJ A;  1T00 A;  5IMA A;  2GZZ A;  4EKZ A;  4X0X A;  1AUC A;  4HU9 A;  1NSW A;  3RPP A;  3LYK A;  3LEF A;  4KW6 A;  1TXX A;  4NWY A;  2PBJ A;  2TIR A;  3MWH A;  2ALB A;  3S9F A;  2LJK A;  1M2D A;  2RM5 A;  4WR4 A;  1SD8 A;  1YKA A;  2NDO A;  1WWJ A;  3CBU A;  2IMI A;  1DUG A;  1M9A A;  3GTU B;  2LS5 A;  5ECI B;  4ISD A;  4G9H A;  3UL3 A;  2O85 A;  4HDE A;  5ID2 B;  2GSS A;  2K6V A;  4V2M A;  3TRQ A;  2V41 A;  1FVJ A;  3GHA A;  3QDN A;  4JU5 A;  1Z5Y E;  5AN1 A;  19GS A;  4MZB A;  1C72 A;  1SJI A;  3UEM A;  1SL2 B;  3Q19 A;  4WET A;  4GSN A;  4IQA A;  2OJL A;  3ZTL A;  2L6C A;  3LSZ A;  2H73 A;  3VK9 A;  2YWM A;  2VM1 A;  5ELA A;  3F6D A;  3QAG A;  1UN2 A;  1GNE A;  2VLT A;  1XWA A;  3RHB A;  3GMF A;  1OVN A;  3DVX A;  3UIW A;  3WGD A;  2H19 A;  2ON7 A;  1RW1 A;  1X0R A;  2GST A;  2HZE B;  2FWG A; 
#chains in the Genus database with same CATH topology
 3C7M A;  3QCP A;  4XIH A;  2IFQ B;  3P90 A;  5G31 A;  5LNK e;  3CTF A;  2C3N A;  3FR9 A;  3LWA A;  1BG1 A;  3DEX A;  3M8N A;  3LGC A;  2K18 A;  2C80 A;  2P5R A;  5KEJ A;  4K6X A;  4Q5R A;  3F0I A;  4G19 A;  4I2T A;  2IMD A;  1XWG A;  4JZQ A;  3MNG A;  4IN0 A;  4ID0 A;  3W8J A;  2WVZ A;  1XBS A;  5A4V A;  2H66 A;  3F63 A;  2GSR A;  5DQY A;  1OKD A;  1BF5 A;  1BX9 A;  2G2Q A;  3HA9 A;  3UVT A;  4OFT A;  3ZVJ A;  1U88 A;  2LRC A;  3APS A;  2VM2 A;  1LU4 A;  1USB A;  2V6K A;  2H1D A;  1RQM A;  5KN3 A;  4XS4 B;  3GSS A;  1EWX A;  3K8N A;  1X9W B;  2JAD A;  5J4U A;  5IMF A;  4K7N A;  3O6T A;  4HUA A;  1AC1 A;  3W8S A;  3HVV A;  3HCZ A;  4GRF A;  1YEP A;  2K8V A;  2DJ2 A;  2RUF A;  4K5R A;  2CA8 A;  2H0G A;  2O36 A;  3KMO A;  5HR1 A;  1B8X A;  3D21 A;  1DE2 A;  1MDJ A;  3HY2 A;  3J7Y k;  3L4N A;  2BTO T;  3GX8 A;  1ZZY A;  4ILF A;  4YKG A;  4OD7 A;  1XOA A;  5ELG A;  3Q18 A;  3OR5 A;  2GVP A;  2K8S A;  2WVX A;  1PA3 A;  1ZYE A;  4ZL8 A;  1R26 A;  2H76 A;  4MMM A;  2H72 A;  4N0Z A;  4P3Y B;  4MPF A;  2IMK A;  2HRK B;  4H86 A;  1S3R A;  3VPQ A;  2QKE A;  2JZS A;  1PSQ A;  3LFL A;  20GS A;  1VF1 A;  2ON5 A;  2H70 A;  4GSS A;  4I2U A;  5BMU B;  5JCG A;  1H4O A;  5DJM A;  6GSX A;  5ENU A;  1F9M A;  2PN8 A;  1PL1 A;  1YJ6 A;  4EC0 A;  4TR0 A;  2CQ9 A;  3CTG A;  3ZZX A;  2YZU A;  3GN3 A;  1V9W A;  3TJJ A;  4D73 A;  3WGE A;  1S4B P;  4GTU A;  4FO5 A;  2ES7 A;  5JWR B;  3IR4 A;  4IJ3 A;  1OC9 A;  4ZIL A;  1JLV A;  2H1A A;  1HNC A;  5G5F A;  1ERT A;  2WFC A;  4K1F A;  3FR3 A;  3HMJ G;  2H6X A;  14GS A;  3ME7 A;  2C3Q A;  2RLI A;  4YKF A;  1ZYQ B;  2H1G A;  3HDC A;  2F51 A;  3D6I A;  5F06 A;  3HJO A;  4GST A;  5ECM B;  4POK A;  2WB9 A;  5ECS A;  4BIK A;  1SYR A;  5IM9 A;  4FQU A;  2FWE A;  4JBB A;  2FA4 A;  4K0G A;  5A4W A;  3GKK A;  2YV7 A;  1A8L A;  2HE3 A;  2VOC A;  2YP6 A;  2R0G A;  3RGB C;  1HNB A;  5J9C A;  2DJJ A;  4IJI A;  3ZML A;  4JED A;  3O76 A;  1R5P A;  1U3A A;  3M1G A;  4NHW A;  3DWV A;  2VCZ A;  1ZYN A;  4O5U A;  4ZBD A;  2WJU A;  4QQ7 A;  2EFC A;  5B6N A;  4EO3 A;  4GDF A;  2LNS A;  2VLV A;  4PNF A;  1QGV A;  1XIY A;  4O7H A;  3RFR C;  1TDI A;  3A5I A;  3GA4 A;  3G7Y A;  1QK8 A;  1DSB A;  2HSH A;  1GLQ A;  1ZMA A;  4J56 E;  5AIV A;  5CRG A;  2OKA A;  2IL3 A;  2LNT A;  1Z6M A;  2X4A A;  5D9X A;  2YPM A;  1JZO A;  3JCM L;  3IOS A;  1PL2 A;  4LA1 A;  2O7K A;  4ZB6 A;  1K3O A;  5B8A A;  2L59 A;  2VCT A;  2HI7 A;  1O8W A;  1TKD B;  2GZY A;  2CZ2 A;  1O81 A;  2GZP A;  2MBT A;  1G7O A;  2QA2 A;  4YAV A;  4WF4 A;  4BVX A;  5G1L A;  2X8H A;  1AQV A;  2WRT A;  2FD3 A;  2NBS A;  22GS A;  1K0M A;  3ISO A;  1OAZ A;  4MA9 A;  4Z2U A;  4QMK A;  3TCO A;  2JZR A;  2HFD A;  3BD2 A;  3ZMK A;  1F6M C;  1JZW A;  4TRX A;  4KAE A;  1XWK A;  4HEA 2;  3KD0 A;  5INY A;  1GWC A;  3P8W A;  3RHC A;  4PQ1 A;  4MAB A;  1OKT A;  1EV4 A;  17GS A;  5A4U A;  3ZYW A;  4BVY A;  5FWG A;  1OC8 A;  5B6M A;  3QPM A;  3I6A A;  3LYP A;  3DXB A;  3G7J A;  1NM3 A;  4IS0 A;  3LQ7 A;  4AF2 A;  3I43 A;  4KDX A;  3GRX A;  4Z2T A;  5DBQ A;  3KXO A;  3IXR A;  4AKH A;  2YAN A;  4KX4 A;  1GH2 A;  5G2Z A;  4MF6 A;  4XCS A;  3IE3 A;  2TRC P;  3KM6 A;  1K3L A;  3C1S A;  4ZBA A;  3U5R E;  5D9W A;  3HVX A;  4K2D A;  4PHZ C;  2VD0 A;  3Q6O A;  1J9B A;  3CSJ A;  1FAA A;  1TTZ A;  1O85 A;  1O6J A;  2H01 A;  4ZB8 A;  4KE3 A;  3RAZ A;  3J7Y b;  3C71 A;  3M0F A;  5JWO B;  2WS2 A;  1DE1 A;  4N10 A;  4E8H A;  3L9V A;  4AI6 A;  4WEY A;  3UAP A;  2A2R A;  3QD9 A;  5F07 A;  4WF5 A;  2EFD A;  2YJ7 A;  2JZT A;  3GYK A;  3BBY A;  2OE0 A;  3WGX A;  5HR2 A;  1YZX A;  6GSS A;  5IQY A;  2F8A A;  4D73 B;  2WDU A;  4JR6 A;  1OC9 B;  1M3J A;  2UZ8 A;  2F3M A;  2GT5 A;  5BMU A;  1BJX A;  2R0P A;  4BWS A;  2P0G A;  1Q4J A;  4JRR A;  4KUN A;  4TVE A;  3H93 A;  3LXT A;  5H5S A;  4HQZ A;  1SKR B;  3E0U A;  1GLP A;  1WIK A;  4DEJ A;  1ON4 A;  2O89 A;  4ZXG A;  8GSS A;  1CQG A;  5KN0 A;  3H79 A;  2MMZ A;  2L5O A;  4OFM A;  3H4K A;  1B48 A;  5CYY A;  2X64 A;  3DRN A;  3VLN A;  4IEL A;  5HFK A;  3WT1 A;  3HZ8 A;  3HJP A;  5D93 A;  2L6D A;  5IMV A;  3GH6 A;  3C73 A;  4KCE A;  3G9B A;  4LL4 B;  3D0Z A;  3APO A;  5G1K A;  3ED3 A;  4TXO B;  4FYU A;  3DIE A;  2DC5 A;  3F9U A;  2UV8 G;  5ECL B;  5J3R A;  4KA0 A;  3TOU A;  2HT9 A;  5GZZ B;  3FZ5 A;  2OA7 A;  2OAC A;  2VL9 A;  2CVB A;  1AQX A;  2KP2 A;  2M80 A;  3APQ A;  2GGT A;  4YAP A;  1U3I A;  1SJZ A;  1ERV A;  3VWV A;  5IMC A;  1VF3 A;  3TUE A;  1GUH A;  5C00 A;  4Q5Q A;  4DSR A;  4Z7X A;  4HQS A;  2O8V B;  3E3E A;  2N5B A;  5F0G A;  4EDY A;  4MDC A;  4YQM A;  1T1V A;  4BVX B;  1E6B A;  4EDZ A;  1XZO A;  5D9V A;  2YWI A;  1FB0 A;  1EEJ A;  5ECK B;  3F4R A;  5JWQ B;  2DKH A;  3VI7 A;  2DMM A;  4ECI A;  2E2M A;  2PU9 C;  3EU3 A;  2KLX A;  3FZ4 A;  1ERU A;  3LW9 A;  4USS A;  2GT6 A;  2DJ3 A;  2B7J A;  3TKS C;  2JAC A;  1ACV A;  5DCH A;  1PRX A;  4G01 A;  1YEX A;  3HVN A;  4PXO A;  3PGT A;  2PER A;  1T4Y A;  2REM A;  3A2X A;  2V1M A;  1GSY A;  2HSY A;  2B5Y A;  3VUR A;  4GCI A;  4BVY B;  4FYB A;  3EE2 A;  1TRW A;  4AJ8 A;  2FA8 A;  3TGZ A;  3IK9 A;  4FXY P;  4BA7 A;  1MTC A;  3U6V A;  1GNW A;  4IBP A;  2O3E A;  5B7C A;  4KF9 A;  1X9M B;  4MJC A;  5J9B A;  4GWR A;  4ECC A;  1K0N A;  2B1K A;  1OYJ A;  5IO0 A;  1TP9 A;  1H75 A;  4TKY A;  1IYH A;  1B4P A;  1FVK A;  2LUS A;  3FW2 A;  4AKG A;  1PKZ A;  4I5Q A;  1AXD A;  2L57 A;  1XVQ A;  4GF0 A;  1NHY A;  4L0W A;  3GST A;  1SVO A;  1TOF A;  4TR1 A;  4HSC X;  2A2P A;  3FRC A;  3F6F A;  3CSI A;  2WW1 A;  3EUR A;  2H75 A;  4OFN A;  18GS A;  5LD0 A;  2R2J A;  1ML6 A;  3EPT A;  4BWQ A;  2XPE A;  3KZQ A;  2H1B A;  3RPN A;  2BMX A;  5AGY A;  3DVW A;  2PWJ A;  2FY6 A;  3HHV A;  5KOX A;  2WUL A;  3D22 A;  2DSA A;  1GUM A;  5H5R A;  2YV9 A;  3TJK A;  4WXT A;  2H1L A;  1ZOF A;  5A34 A;  1SL1 B;  1XPV A;  2KP1 A;  3TKS A;  1GUK A;  2XPD A;  3GKX A;  2VL2 C;  2YZH A;  4MF7 A;  4K8M A;  4J2F A;  5IO2 A;  3KTL A;  2VL3 A;  5F8B A;  1N25 A;  1UA5 A;  4KDU A;  2NVL A;  2DLX A;  3EMX A;  3V1W A;  2PVQ A;  3VI5 A;  2C0E A;  4LLR A;  2I1U A;  1WOU A;  4EL1 A;  1XVW A;  1TRV A;  4V1A g;  2WW2 A;  1B9X C;  1XFL A;  1G6W A;  2NPB A;  6GSY A;  2LV3 A;  3HZ4 A;  1V58 A;  4E68 A;  5CNW A;  2KUC A;  3AY8 A;  4POM A;  3D5J A;  1N2A A;  2LRT A;  4F82 A;  2QGV A;  2DML A;  5J47 A;  5CRW A;  2EIO A;  3R2Q A;  3ZVJ D;  3ZFB A;  3FEU A;  3R3E A;  4MH3 A;  1F3B A;  3KH7 A;  3FMW A;  4RI6 A;  4RUV A;  4DVC A;  4NPB A;  5H5Q A;  3EC3 A;  3MIX A;  2CVD A;  2M72 A;  3ZFL A;  2VLU A;  1TRU A;  5A1N A;  2EIR A;  1A0R P;  4EF0 A;  4GLT A;  1WRY A;  4G10 A;  3SWL A;  5AIX A;  1PN0 A;  4K7O A;  1GSS A;  5DVB A;  2F8F A;  5ECP B;  3BCI A;  2YWN A;  4K2X A;  3TJF A;  4TXV A;  3TRX A;  2HLS A;  3TKP A;  1BG5 A;  1T4Z A;  3GKM A;  2PMT A;  2EFH A;  2L4C A;  2B6M A;  13GS A;  1R4W A;  4FH8 A;  3E9J B;  5C04 A;  5FHI A;  2VL2 A;  4TXO A;  4N3Z A;  3FKF A;  4EE0 A;  2KOK A;  4RQR A;  2H6Y A;  5CRH A;  3H1N A;  1GSD A;  2I3Y A;  3TKQ A;  3P2A A;  1A24 A;  5J4V A;  1G7E A;  1Y25 A;  1SKW B;  3M9J A;  2HSM A;  3EMP A;  1FOH A;  2L4Q A;  1FHE A;  4IHU A;  4MPG A;  4PQI A;  5ECR B;  3KH9 A;  1JZD A;  2VCX A;  1A2L A;  3A5W A;  2FWH A;  2ZUP A;  1M9B A;  4O92 A;  4WBJ A;  4MZC A;  4AKI A;  1MD3 A;  4MK3 A;  2AUV A;  4IP6 A;  2F9S A;  4LMV A;  4OWY A;  3PIN A;  1EP8 A;  3NZN A;  3LXZ A;  1FOV A;  2H71 A;  3BCK A;  2WW0 A;  4TR3 A;  4GQF A;  1VF4 A;  2FCH A;  5DCG A;  4MJB A;  1QQ2 A;  3UAR A;  3US3 A;  1XOB A;  5CRD A;  1JHB A;  3KGK A;  2Z9S A;  1A23 A;  2CX4 A;  4AJ6 A;  1MDI A;  5CO3 A;  3ZIT A;  2MYG A;  1PGT A;  4F2I A;  3GIX A;  1OE7 A;  1WJK A;  4XS6 A;  5HFI A;  1PD2 1;  1GTI A;  1EV9 A;  4I97 A;  1GSE A;  1FB6 A;  1M2B A;  4HS1 A;  3BOA A;  4PQH A;  1BAY A;  2RII A;  3L78 A;  3TRP A;  4TR1 B;  2OBI A;  2LJR A;  2NTO A;  1ZGN A;  4NMU A;  5IMD A;  3FYG A;  4X4J A;  2CVK A;  1Z7P A;  2R3X A;  5E59 A;  4PUA A;  1PMT A;  4CDO A;  2HRN A;  3TB2 A;  3IBH A;  2HRA A;  2FUG 2;  2GQK A;  1GL8 A;  2WZS A;  2GS3 A;  4AJ7 A;  5D73 A;  3MDK A;  4A5P A;  2VO4 A;  2H30 A;  5A34 B;  3CSH A;  2X8G A;  4IKH A;  2XHF A;  2GDR A;  5DQS A;  3GNJ A;  1GSU A;  3IV4 A;  2IMF A;  1EGO A;  3EVI A;  5COH A;  4ZB9 A;  1JFU A;  3ZIJ A;  1KBN A;  1K0C A;  3DKS A;  3QMX A;  1W4V A;  1PN9 A;  2DKI A;  1QUW A;  2M46 A;  2LQO A;  3F8U A;  1Y1U A;  2IN3 A;  5A5H A;  4BL7 A;  3KEB A;  1Z3E A;  4TW5 A;  2R0C A;  2AYT A;  4LL1 B;  1S3C A;  2G0F A;  1N8J A;  4ML1 A;  3N9J A;  2ZNM A;  4MLY A;  2C4J A;  1K0O A;  1F3A A;  1EZK A;  4PNG A;  4IGJ A;  3ZRD A;  2OT3 A;  4PUF C;  6GSW A;  1YDK A;  1SK0 A;  1X9S B;  2XBQ A;  4KGI A;  2E0Q A;  1MEK A;  3TOT A;  1WE0 A;  1EP7 A;  1QXH A;  1QMV A;  3GUR A;  3RDW A;  2H74 A;  3A2W A;  1B4Q A;  1DBY A;  2X99 A;  3ZIV A;  4O5Q A;  4GQC A;  5IMZ A;  2QC7 A;  1G0T A;  1PQN A;  4EVM A;  2RM6 A;  5A1N B;  3FY7 A;  3DGQ A;  5ECH B;  4KSM A;  5G30 A;  4OCE A;  3Q74 A;  4POB A;  2MMA A;  5EL8 A;  3CRT A;  1AIU A;  1PKW A;  4HJ2 A;  3FZ9 A;  1JZR A;  1A8Y A;  5CAX A;  2R6K A;  5JCW A;  1OC3 A;  3KTB A;  2HNL A;  5HFG A;  1ABA A;  3ZRE A;  2MMN A;  3EYT A;  3VFI A;  1V98 A;  5AIS A;  4ZIJ A;  2JU5 A;  3VWX A;  2AV4 A;  2CAQ A;  3QFB C;  4K5S A;  16GS A;  1MDK A;  5KOW A;  2O87 A;  2DJ1 A;  4RQX A;  3I9V 2;  3NOF A;  5IOX A;  4YQV A;  2H8L A;  2HSM B;  3PR8 A;  1AW9 A;  3KJY A;  3LG6 A;  5ABR A;  1WMJ A;  4V2N A;  1GSF A;  4IQ1 A;  5DAL A;  4X1U A;  2FNO A;  4PX1 A;  2O5V A;  4NV5 A;  1LJR A;  3F3R A;  4EXJ A;  3GFK A;  2VCW A;  4WKW A;  3A3T A;  3QFA C;  1GUL A;  4MH2 A;  2IWT A;  1Z7R A;  1VRS D;  1YQ1 A;  1TU8 A;  3HKR A;  4OO5 A;  4CY8 A;  4CW9 A;  2WZ9 A;  2C0F A;  1YEW C;  1E2Y A;  4F03 A;  4ZB7 A;  3QOU A;  2QSI A;  1T3B A;  2N5F A;  2DJ0 A;  2PPT A;  1LBK A;  3CYN A;  4F9Z A;  1TI1 A;  5G5E A;  3D4M A;  4KCA A;  4BPY A;  2YN1 A;  1I5G A;  3HXS A;  3RBT A;  1NHO A;  1J0F A;  3VWW A;  4TOP A;  3H8Q A;  1HQO A;  4KH7 A;  3D4T A;  4L5L A;  7GSS A;  2C0G A;  2LRN A;  4K9Z A;  4AGS A;  10GS A;  2GTU A;  1ST9 A;  1O8X A;  1I1I P;  2HRF A;  2PUK C;  5EPF A;  2YOI A;  3UJ1 A;  2B3S A;  1GSQ A;  4V2L A;  3DML A;  2AAW A;  2P31 A;  1GTB A;  2TRX A;  6GST A;  3IA1 A;  1FO5 A;  4N11 A;  3WT2 A;  5CP1 A;  5B8B A;  3CXG A;  3UVH A;  4KDY A;  3F3Q A;  2V6O A;  5J5N A;  5HR0 A;  1RK4 A;  2FLS A;  2HXK A;  4G0K A;  3P7X A;  4HZ2 A;  1HD2 A;  2MBS A;  1PFO A;  4QL9 A;  1YF0 A;  4L0U A;  5GST A;  2XBI A;  5DAK A;  2I81 A;  5L71 A;  2WVY A;  1UVZ A;  3QAW A;  3L9U A;  1M0U A;  3DD3 A;  4ZL9 A;  4G0I A;  5BRT A;  1SK2 A;  1YKC A;  2OBK A;  1F2E A;  3LJR A;  1M2A A;  1X5D A;  4NXI A;  2DIY A;  1GP1 A;  1HYU A;  3HVS A;  4EUY A;  1A0F A;  3GKN A;  4Q5N A;  2N5A A;  2PVO C;  2HZF A;  2KHP A;  2VCV A;  2B7K A;  3F4T A;  5A5H B;  3IK7 A;  4BL7 B;  4O32 A;  3TKS E;  3KMN A;  4HOJ A;  3LOR A;  4EIP A;  1V2A A;  4KB3 A;  3TKR A;  2E7P A;  2VCQ A;  3IPZ A;  5IPH A;  2JL4 A;  4AKX B;  1SU9 A;  5ECQ B;  5GAP D;  3MAK A;  1SYX A;  4L5O A;  1TJD A;  2R37 A;  2FWF A;  2LJA A;  2LST A;  4J57 E;  3FZA A;  4ECB A;  4DSS A;  4O5R A;  1XXU A;  1Z9H A;  1SEN A;  3IC8 A;  3IAS 2;  2IME A;  2IJY A;  2C1Y A;  4IP1 A;  4I6X A;  4WBR D;  4FIW A;  1ERW A;  1TU7 A;  2GQM A;  2PGT A;  2GQL A;  4IVF A;  11GS A;  3GL3 A;  1KTE A;  2VAF A;  1Q98 A;  3IC4 A;  3UBL A;  4Z2R A;  2AB6 A;  3QR6 A;  1I9D A;  1SD9 A;  1TXU A;  1K0B A;  2QA1 A;  1XW5 A;  1YF1 A;  1ZCP A;  2J9H A;  3FHK A;  1IYI A;  4ULX A;  1AQW A;  4KSO A;  3IAM 2;  4QL7 A;  2GLR A;  3G7I A;  1M7T A;  3I69 A;  5DDL A;  4F0C A;  1THO A;  5DJL A;  1JLW A;  1F37 A;  4TR4 A;  4NV2 A;  5J40 A;  3L0H A;  2DIZ A;  2LKU A;  4YQU A;  1T7P B;  4HU7 A;  1J08 A;  3ZLP A;  4POL A;  3VWU A;  2DBC A;  4FYC A;  3SBC A;  4MJE A;  2B1L A;  4XS1 A;  2H6Z A;  1CQH A;  4XRD A;  1YVL A;  3UMA A;  1BYE A;  1SL0 B;  12GS A;  4OMV A;  3TU3 B;  2VUP A;  1TK5 B;  3BJ5 A;  2AJQ B;  2X8C A;  4V1A p;  2OAD A;  1S3D A;  2HSN A;  3FK8 A;  1K0D A;  2V2G A;  1XG8 A;  2B5E A;  3EWL A;  1HNA A;  2OE1 A;  5KN2 A;  2HYX A;  1B9Y C;  4MP4 A;  1PX6 A;  3HYP A;  5D9T A;  5DAL B;  3ERW A;  3IHG A;  5LCZ A;  2H0I A;  4XHM A;  4RI7 A;  3UBK A;  1TW9 A;  2L5L A;  4PI2 C;  3EIN A;  1THX A;  3F4S A;  4GXZ A;  5KN1 A;  2B5X A;  3IDV A;  4JR4 A;  1PX7 A;  5D96 A;  4IW9 A;  1Z6N A;  2WW3 A;  2VD1 A;  3KP8 A;  2FHE A;  1TI3 A;  4MF5 A;  3C8E A;  3GTU A;  4ML6 A;  4F0B A;  2DJK A;  4NAX A;  5ID2 A;  1SK1 A;  2CZ3 A;  2X49 A;  2YNX A;  5HQP A;  1EOH A;  6GSU A;  4TN8 A;  4N0V A;  2CT6 A;  1QFN A;  4K0N A;  2EFE A;  2P5Q A;  1GTU A;  5J41 A;  2A2S A;  4L8E A;  4MJA A;  3N5O A;  1M3I A;  1NW2 A;  2YJH A;  3HD5 A;  4OCF A;  2LTK A;  1XWB A;  2I4A A;  2C8U A;  4DSQ A;  1EGR A;  1W89 A;  3W6G A;  1EEM A;  1U87 A;  1SVL A;  1ILO A;  1XW6 A;  2CV4 A;  3M3M A;  2E2G A;  3HJM A;  1R7H A;  3GX0 A;  2GSQ A;  1KNG A;  4HI7 A;  1V40 A;  1WP0 A;  2K9F A;  1G6Y A;  2AHE A;  3ERG A;  2VIM A;  5HR3 A;  3ERF A;  1Y6E A;  1X5C A;  2MZC A;  2IIY A;  1SKS B;  2HZE A;  3IRA A;  4XTS A;  2LQQ A;  2IFQ A;  3L9S A;  3ZL5 A;  4CHS A;  5J4Y A;  4ZBB A;  6GSV A;  1VF2 A;  5DAK B;  1U6T A;  2MMO A;  4ACS A;  4W66 A;  1XW9 A;  3DYR A;  3CMI A;  3QAV A;  3MYD A;  3GUS A;  2C0D A;  3PPU A;  1S3A A;  1UC7 A;  1MD4 A;  1ZL9 A;  5GSS A;  3GH9 A;  3KP9 A;  3WD6 A;  1XWC A;  5EVO A;  4NHZ A;  3CQF A;  2FGX A;  4WR5 A;  1O7U A;  1TK8 B;  3PH9 A;  2J23 A;  2EIQ A;  2CX3 A;  4LMW A;  1GTA A;  4XS4 A;  2IPA A;  3MSZ A;  4OO4 A;  5IIZ A;  1T8E B;  4JE1 A;  3UOM A;  5IOW A;  2WVX B;  1GRX A;  5D8I A;  3NIV A;  1FW1 A;  1BQ7 A;  2RUE A;  1X5E A;  4EIQ A;  1A2J A;  2BJX A;  1K3Y A;  4PGT A;  2R4V A;  2CAI A;  2C3T A;  4DSS B;  3O3T A;  1O73 A;  3M9K A;  1TRS A;  1VGL A;  2XC2 A;  3EU4 A;  2H0H A;  4MZW A;  1KEB A;  1XCC A;  1K0A A;  4I8B A;  5ECO B;  2D2Z A;  3IHQ A;  4E8E A;  3KCM A;  2VKZ G;  4KND A;  2A4V A;  4ZL7 A;  5ECN B;  4ICY A;  4YH2 A;  2YWO A;  4PTS A;  4CY6 A;  2YCD A;  1ZYP A;  2HQT A;  1OE8 A;  5GAN D;  1EOG A;  2HRK A;  3CHX C;  3FR6 A;  3GL5 A;  4G2E A;  3KIJ A;  1WPI A;  5EY6 A;  4HJM A;  4HZ4 A;  4PUR A;  3TJB A;  3ME8 A;  3VPT A;  1R5A A;  3CRU A;  4MCU A;  1URM A;  2EC4 A;  3A2V A;  5A5K A;  2ZCT A;  5IPG A;  1TK0 B;  2V32 A;  5JCU A;  4X43 A;  2R5G A;  3WYW A;  2LEG A;  4G0L A;  2JSZ A;  1YY7 A;  1SJ6 A;  4K7I A;  4XRA A;  2WCI A;  1BED A;  1AAZ A;  5E4W A;  3C1R A;  2WGR A;  1FG4 A;  4MNN A;  2HSN B;  5FT3 A;  1M99 A;  4N30 A;  3TDG A;  2I9H A;  1A2M A;  2OE3 A;  5F05 A;  4Q5F A;  2JSY A;  9GSS A;  3TJG A;  1V57 A;  3GV1 A;  5CRE A;  4ECJ A;  1T00 A;  5IMA A;  2GZZ A;  4EKZ A;  4X0X A;  1AUC A;  4HU9 A;  1NSW A;  3RPP A;  3LYK A;  3LEF A;  4KW6 A;  4PI0 C;  1TXX A;  4NWY A;  2PBJ A;  2TIR A;  3MWH A;  2ALB A;  3S9F A;  2LJK A;  1M2D A;  2RM5 A;  4WR4 A;  1SD8 A;  1YKA A;  2NDO A;  1WWJ A;  2A4H A;  3CBU A;  2IMI A;  1DUG A;  1M9A A;  3GTU B;  2LS5 A;  5ECI B;  4ISD A;  4G9H A;  3UL3 A;  2O85 A;  4HDE A;  5ID2 B;  2GSS A;  2K6V A;  4V2M A;  3TRQ A;  2V41 A;  1FVJ A;  3GHA A;  3QDN A;  4JU5 A;  1Z5Y E;  5AN1 A;  19GS A;  4MZB A;  1C72 A;  1SJI A;  3UEM A;  3CWG A;  1SL2 B;  3Q19 A;  4WET A;  4GSN A;  4IQA A;  2OJL A;  3ZTL A;  2L6C A;  3LSZ A;  2H73 A;  3VK9 A;  2YWM A;  2VM1 A;  5ELA A;  1SVM A;  3F6D A;  3QAG A;  1UN2 A;  1GNE A;  2VLT A;  1XWA A;  3RHB A;  3GMF A;  1OVN A;  3DVX A;  3UIW A;  3WGD A;  2H19 A;  2ON7 A;  1RW1 A;  1X0R A;  2GST A;  2HZE B;  2FWG A; 
#chains in the Genus database with same CATH homology
 3C7M A;  3QCP A;  4XIH A;  2IFQ B;  3P90 A;  5G31 A;  5LNK e;  3CTF A;  2C3N A;  3FR9 A;  3LWA A;  1BG1 A;  3DEX A;  3M8N A;  3LGC A;  2K18 A;  2C80 A;  2P5R A;  5KEJ A;  4K6X A;  4Q5R A;  3F0I A;  4G19 A;  4I2T A;  2IMD A;  1XWG A;  4JZQ A;  3MNG A;  4IN0 A;  4ID0 A;  3W8J A;  1XBS A;  5A4V A;  2H66 A;  3F63 A;  2GSR A;  5DQY A;  1OKD A;  1BF5 A;  1BX9 A;  2G2Q A;  3HA9 A;  3UVT A;  4OFT A;  3ZVJ A;  1U88 A;  2LRC A;  3APS A;  2VM2 A;  1LU4 A;  1USB A;  2V6K A;  2H1D A;  1RQM A;  5KN3 A;  4XS4 B;  3GSS A;  1EWX A;  3K8N A;  1X9W B;  2JAD A;  5J4U A;  5IMF A;  4K7N A;  3O6T A;  4HUA A;  1AC1 A;  3W8S A;  3HVV A;  3HCZ A;  4GRF A;  1YEP A;  2K8V A;  2DJ2 A;  2RUF A;  4K5R A;  2CA8 A;  2H0G A;  3KMO A;  5HR1 A;  1B8X A;  3D21 A;  1DE2 A;  1MDJ A;  3HY2 A;  3J7Y k;  3L4N A;  2BTO T;  3GX8 A;  1ZZY A;  4ILF A;  4YKG A;  4OD7 A;  1XOA A;  5ELG A;  3Q18 A;  3OR5 A;  2GVP A;  2K8S A;  1PA3 A;  1ZYE A;  4ZL8 A;  1R26 A;  2H76 A;  4MMM A;  2H72 A;  4N0Z A;  4P3Y B;  4MPF A;  2IMK A;  2HRK B;  4H86 A;  3VPQ A;  2QKE A;  2JZS A;  1PSQ A;  3LFL A;  20GS A;  1VF1 A;  2ON5 A;  2H70 A;  4GSS A;  4I2U A;  5BMU B;  5JCG A;  1H4O A;  5DJM A;  6GSX A;  5ENU A;  1F9M A;  2PN8 A;  1PL1 A;  1YJ6 A;  4EC0 A;  4TR0 A;  2CQ9 A;  3CTG A;  3ZZX A;  2YZU A;  3GN3 A;  1V9W A;  3TJJ A;  4D73 A;  3WGE A;  4FO5 A;  4GTU A;  2ES7 A;  5JWR B;  3IR4 A;  4IJ3 A;  1OC9 A;  4ZIL A;  1JLV A;  2H1A A;  1HNC A;  5G5F A;  1ERT A;  2WFC A;  4K1F A;  3FR3 A;  3HMJ G;  2H6X A;  14GS A;  3ME7 A;  2C3Q A;  2RLI A;  4YKF A;  1ZYQ B;  2H1G A;  3HDC A;  2F51 A;  3D6I A;  5F06 A;  3HJO A;  4GST A;  5ECM B;  4POK A;  2WB9 A;  5ECS A;  1SYR A;  5IM9 A;  4FQU A;  2FWE A;  4JBB A;  2FA4 A;  4K0G A;  5A4W A;  3GKK A;  2YV7 A;  1A8L A;  2HE3 A;  2VOC A;  2YP6 A;  2R0G A;  1HNB A;  5J9C A;  2DJJ A;  4IJI A;  3ZML A;  4JED A;  3O76 A;  1R5P A;  1U3A A;  3M1G A;  4NHW A;  3DWV A;  2VCZ A;  1ZYN A;  4O5U A;  4ZBD A;  2WJU A;  4QQ7 A;  2EFC A;  5B6N A;  4EO3 A;  4GDF A;  2LNS A;  2VLV A;  4PNF A;  1QGV A;  1XIY A;  4O7H A;  1TDI A;  3A5I A;  3GA4 A;  3G7Y A;  1QK8 A;  1DSB A;  2HSH A;  1GLQ A;  1ZMA A;  4J56 E;  5AIV A;  5CRG A;  2OKA A;  2IL3 A;  2LNT A;  1Z6M A;  2X4A A;  5D9X A;  2YPM A;  1JZO A;  3JCM L;  3IOS A;  1PL2 A;  4LA1 A;  2O7K A;  4ZB6 A;  1K3O A;  5B8A A;  2L59 A;  2VCT A;  2HI7 A;  1O8W A;  1TKD B;  2GZY A;  2CZ2 A;  1O81 A;  2GZP A;  2MBT A;  1G7O A;  2QA2 A;  4YAV A;  4WF4 A;  4BVX A;  5G1L A;  2X8H A;  1AQV A;  2WRT A;  2FD3 A;  2NBS A;  22GS A;  1K0M A;  3ISO A;  1OAZ A;  4MA9 A;  4Z2U A;  4QMK A;  3TCO A;  2JZR A;  2HFD A;  3BD2 A;  3ZMK A;  1F6M C;  1JZW A;  4TRX A;  4KAE A;  1XWK A;  4HEA 2;  3KD0 A;  5INY A;  1GWC A;  3P8W A;  3RHC A;  4PQ1 A;  4MAB A;  1OKT A;  1EV4 A;  17GS A;  5A4U A;  3ZYW A;  4BVY A;  5FWG A;  1OC8 A;  5B6M A;  3QPM A;  3I6A A;  3LYP A;  3DXB A;  3G7J A;  1NM3 A;  4IS0 A;  3LQ7 A;  4AF2 A;  3I43 A;  4KDX A;  3GRX A;  4Z2T A;  5DBQ A;  3KXO A;  3IXR A;  4AKH A;  2YAN A;  4KX4 A;  1GH2 A;  5G2Z A;  4MF6 A;  4XCS A;  3IE3 A;  2TRC P;  3KM6 A;  1K3L A;  3C1S A;  4ZBA A;  3U5R E;  5D9W A;  3HVX A;  4K2D A;  2VD0 A;  3Q6O A;  1J9B A;  3CSJ A;  1FAA A;  1TTZ A;  1O85 A;  1O6J A;  2H01 A;  4ZB8 A;  4KE3 A;  3RAZ A;  3J7Y b;  3C71 A;  3M0F A;  5JWO B;  2WS2 A;  1DE1 A;  4N10 A;  4E8H A;  3L9V A;  4AI6 A;  4WEY A;  3UAP A;  2A2R A;  3QD9 A;  5F07 A;  4WF5 A;  2EFD A;  2YJ7 A;  2JZT A;  3GYK A;  3BBY A;  2OE0 A;  3WGX A;  5HR2 A;  1YZX A;  6GSS A;  5IQY A;  2F8A A;  4D73 B;  2WDU A;  4JR6 A;  1OC9 B;  2UZ8 A;  2F3M A;  2GT5 A;  5BMU A;  1BJX A;  2R0P A;  4BWS A;  2P0G A;  1Q4J A;  4JRR A;  4KUN A;  4TVE A;  3H93 A;  3LXT A;  5H5S A;  4HQZ A;  1SKR B;  3E0U A;  1GLP A;  1WIK A;  4DEJ A;  1ON4 A;  2O89 A;  4ZXG A;  8GSS A;  1CQG A;  5KN0 A;  3H79 A;  2MMZ A;  2L5O A;  4OFM A;  3H4K A;  1B48 A;  5CYY A;  2X64 A;  3DRN A;  3VLN A;  4IEL A;  5HFK A;  3WT1 A;  3HZ8 A;  3HJP A;  5D93 A;  2L6D A;  5IMV A;  3GH6 A;  3C73 A;  4KCE A;  3G9B A;  4LL4 B;  3D0Z A;  3APO A;  5G1K A;  3ED3 A;  4TXO B;  4FYU A;  3DIE A;  2DC5 A;  3F9U A;  2UV8 G;  5ECL B;  5J3R A;  4KA0 A;  3TOU A;  2HT9 A;  5GZZ B;  3FZ5 A;  2OA7 A;  2OAC A;  2VL9 A;  2CVB A;  1AQX A;  2KP2 A;  2M80 A;  3APQ A;  2GGT A;  4YAP A;  1U3I A;  1SJZ A;  1ERV A;  3VWV A;  5IMC A;  1VF3 A;  3TUE A;  1GUH A;  5C00 A;  4Q5Q A;  4DSR A;  4Z7X A;  4HQS A;  2O8V B;  3E3E A;  2N5B A;  5F0G A;  4EDY A;  4MDC A;  4YQM A;  1T1V A;  4BVX B;  1E6B A;  4EDZ A;  1XZO A;  5D9V A;  2YWI A;  1FB0 A;  1EEJ A;  5ECK B;  3F4R A;  5JWQ B;  2DKH A;  3VI7 A;  2DMM A;  4ECI A;  2E2M A;  2PU9 C;  3EU3 A;  2KLX A;  3FZ4 A;  1ERU A;  3LW9 A;  4USS A;  2GT6 A;  2DJ3 A;  2B7J A;  3TKS C;  2JAC A;  1ACV A;  5DCH A;  1PRX A;  4G01 A;  1YEX A;  4PXO A;  3PGT A;  2PER A;  1T4Y A;  2REM A;  3A2X A;  2V1M A;  1GSY A;  2HSY A;  2B5Y A;  3VUR A;  4GCI A;  4BVY B;  4FYB A;  3EE2 A;  1TRW A;  4AJ8 A;  2FA8 A;  3TGZ A;  3IK9 A;  4BA7 A;  1MTC A;  3U6V A;  1GNW A;  4IBP A;  5B7C A;  4KF9 A;  1X9M B;  4MJC A;  5J9B A;  4GWR A;  4ECC A;  1K0N A;  2B1K A;  1OYJ A;  5IO0 A;  1TP9 A;  1H75 A;  4TKY A;  1IYH A;  1B4P A;  1FVK A;  2LUS A;  3FW2 A;  4AKG A;  1PKZ A;  4I5Q A;  1AXD A;  2L57 A;  1XVQ A;  4GF0 A;  1NHY A;  4L0W A;  3GST A;  1SVO A;  1TOF A;  4TR1 A;  2A2P A;  3FRC A;  3F6F A;  3CSI A;  3EUR A;  2H75 A;  4OFN A;  18GS A;  5LD0 A;  2R2J A;  1ML6 A;  3EPT A;  4BWQ A;  2XPE A;  3KZQ A;  2H1B A;  3RPN A;  2BMX A;  5AGY A;  3DVW A;  2PWJ A;  2FY6 A;  3HHV A;  5KOX A;  2WUL A;  3D22 A;  2DSA A;  1GUM A;  5H5R A;  2YV9 A;  3TJK A;  4WXT A;  2H1L A;  1ZOF A;  5A34 A;  1SL1 B;  1XPV A;  2KP1 A;  3TKS A;  1GUK A;  2XPD A;  3GKX A;  2VL2 C;  2YZH A;  4MF7 A;  4K8M A;  4J2F A;  5IO2 A;  3KTL A;  2VL3 A;  5F8B A;  1N25 A;  1UA5 A;  4KDU A;  2NVL A;  2DLX A;  3EMX A;  3V1W A;  2PVQ A;  3VI5 A;  2C0E A;  4LLR A;  2I1U A;  1WOU A;  4EL1 A;  1XVW A;  1TRV A;  4V1A g;  1B9X C;  1XFL A;  1G6W A;  2NPB A;  6GSY A;  2LV3 A;  3HZ4 A;  1V58 A;  4E68 A;  5CNW A;  2KUC A;  3AY8 A;  4POM A;  3D5J A;  1N2A A;  2LRT A;  4F82 A;  2QGV A;  2DML A;  5J47 A;  5CRW A;  2EIO A;  3R2Q A;  3ZVJ D;  3ZFB A;  3FEU A;  3R3E A;  4MH3 A;  1F3B A;  3KH7 A;  3FMW A;  4RI6 A;  4RUV A;  4DVC A;  4NPB A;  5H5Q A;  3EC3 A;  3MIX A;  2CVD A;  2M72 A;  3ZFL A;  2VLU A;  1TRU A;  5A1N A;  2EIR A;  1A0R P;  4EF0 A;  4GLT A;  1WRY A;  4G10 A;  3SWL A;  5AIX A;  1PN0 A;  4K7O A;  1GSS A;  5DVB A;  2F8F A;  5ECP B;  3BCI A;  2YWN A;  4K2X A;  3TJF A;  4TXV A;  3TRX A;  2HLS A;  3TKP A;  1BG5 A;  1T4Z A;  3GKM A;  2PMT A;  2EFH A;  2L4C A;  2B6M A;  13GS A;  1R4W A;  4FH8 A;  3E9J B;  5C04 A;  5FHI A;  2VL2 A;  4TXO A;  4N3Z A;  3FKF A;  4EE0 A;  2KOK A;  4RQR A;  2H6Y A;  5CRH A;  3H1N A;  1GSD A;  2I3Y A;  3TKQ A;  3P2A A;  1A24 A;  5J4V A;  1G7E A;  1Y25 A;  1SKW B;  3M9J A;  2HSM A;  3EMP A;  1FOH A;  2L4Q A;  1FHE A;  4IHU A;  4MPG A;  4PQI A;  5ECR B;  3KH9 A;  1JZD A;  2VCX A;  1A2L A;  3A5W A;  2FWH A;  2ZUP A;  1M9B A;  4O92 A;  4WBJ A;  4MZC A;  4AKI A;  1MD3 A;  4MK3 A;  2AUV A;  4IP6 A;  2F9S A;  4LMV A;  4OWY A;  3PIN A;  1EP8 A;  3NZN A;  3LXZ A;  1FOV A;  2H71 A;  3BCK A;  4TR3 A;  4GQF A;  1VF4 A;  2FCH A;  5DCG A;  4MJB A;  1QQ2 A;  3UAR A;  3US3 A;  1XOB A;  5CRD A;  1JHB A;  3KGK A;  2Z9S A;  1A23 A;  2CX4 A;  4AJ6 A;  1MDI A;  5CO3 A;  3ZIT A;  2MYG A;  1PGT A;  4F2I A;  3GIX A;  1OE7 A;  1WJK A;  4XS6 A;  5HFI A;  1PD2 1;  1GTI A;  1EV9 A;  4I97 A;  1GSE A;  1FB6 A;  1M2B A;  4HS1 A;  3BOA A;  4PQH A;  1BAY A;  2RII A;  3L78 A;  3TRP A;  4TR1 B;  2OBI A;  2LJR A;  2NTO A;  1ZGN A;  4NMU A;  5IMD A;  3FYG A;  4X4J A;  2CVK A;  1Z7P A;  2R3X A;  5E59 A;  4PUA A;  1PMT A;  4CDO A;  2HRN A;  3TB2 A;  3IBH A;  2HRA A;  2FUG 2;  2GQK A;  1GL8 A;  2GS3 A;  4AJ7 A;  5D73 A;  3MDK A;  4A5P A;  2VO4 A;  2H30 A;  5A34 B;  3CSH A;  2X8G A;  4IKH A;  2XHF A;  2GDR A;  5DQS A;  3GNJ A;  1GSU A;  3IV4 A;  2IMF A;  1EGO A;  3EVI A;  5COH A;  4ZB9 A;  1JFU A;  3ZIJ A;  1KBN A;  1K0C A;  3DKS A;  3QMX A;  1W4V A;  1PN9 A;  2DKI A;  1QUW A;  2M46 A;  2LQO A;  3F8U A;  1Y1U A;  2IN3 A;  5A5H A;  4BL7 A;  3KEB A;  1Z3E A;  4TW5 A;  2R0C A;  2AYT A;  4LL1 B;  1S3C A;  2G0F A;  1N8J A;  4ML1 A;  3N9J A;  2ZNM A;  4MLY A;  2C4J A;  1K0O A;  1F3A A;  1EZK A;  4PNG A;  4IGJ A;  3ZRD A;  2OT3 A;  4PUF C;  6GSW A;  1YDK A;  1SK0 A;  1X9S B;  2XBQ A;  4KGI A;  2E0Q A;  1MEK A;  3TOT A;  1WE0 A;  1EP7 A;  1QXH A;  1QMV A;  3GUR A;  3RDW A;  2H74 A;  3A2W A;  1B4Q A;  1DBY A;  2X99 A;  3ZIV A;  4O5Q A;  4GQC A;  5IMZ A;  2QC7 A;  1G0T A;  1PQN A;  4EVM A;  2RM6 A;  5A1N B;  3FY7 A;  3DGQ A;  5ECH B;  4KSM A;  5G30 A;  4OCE A;  3Q74 A;  4POB A;  2MMA A;  5EL8 A;  3CRT A;  1AIU A;  1PKW A;  4HJ2 A;  3FZ9 A;  1JZR A;  1A8Y A;  5CAX A;  2R6K A;  5JCW A;  1OC3 A;  3KTB A;  2HNL A;  5HFG A;  1ABA A;  3ZRE A;  2MMN A;  3EYT A;  3VFI A;  1V98 A;  5AIS A;  4ZIJ A;  2JU5 A;  3VWX A;  2AV4 A;  2CAQ A;  3QFB C;  4K5S A;  16GS A;  1MDK A;  5KOW A;  2O87 A;  2DJ1 A;  4RQX A;  3I9V 2;  3NOF A;  5IOX A;  4YQV A;  2H8L A;  2HSM B;  3PR8 A;  1AW9 A;  3KJY A;  3LG6 A;  5ABR A;  1WMJ A;  4V2N A;  1GSF A;  4IQ1 A;  5DAL A;  4X1U A;  2FNO A;  4PX1 A;  2O5V A;  4NV5 A;  1LJR A;  3F3R A;  4EXJ A;  3GFK A;  2VCW A;  4WKW A;  3A3T A;  3QFA C;  1GUL A;  4MH2 A;  2IWT A;  1Z7R A;  1VRS D;  1YQ1 A;  1TU8 A;  3HKR A;  4OO5 A;  4CY8 A;  4CW9 A;  2WZ9 A;  2C0F A;  1E2Y A;  4F03 A;  4ZB7 A;  3QOU A;  2QSI A;  1T3B A;  2N5F A;  2DJ0 A;  2PPT A;  1LBK A;  3CYN A;  4F9Z A;  1TI1 A;  5G5E A;  3D4M A;  4KCA A;  4BPY A;  2YN1 A;  1I5G A;  3HXS A;  3RBT A;  1NHO A;  1J0F A;  3VWW A;  4TOP A;  3H8Q A;  1HQO A;  4KH7 A;  3D4T A;  4L5L A;  7GSS A;  2C0G A;  2LRN A;  4K9Z A;  4AGS A;  10GS A;  2GTU A;  1ST9 A;  1O8X A;  2HRF A;  2PUK C;  5EPF A;  2YOI A;  3UJ1 A;  2B3S A;  1GSQ A;  4V2L A;  3DML A;  2AAW A;  2P31 A;  1GTB A;  2TRX A;  6GST A;  3IA1 A;  1FO5 A;  4N11 A;  3WT2 A;  5CP1 A;  5B8B A;  3CXG A;  3UVH A;  4KDY A;  3F3Q A;  2V6O A;  5J5N A;  5HR0 A;  1RK4 A;  2FLS A;  2HXK A;  4G0K A;  3P7X A;  4HZ2 A;  1HD2 A;  2MBS A;  4QL9 A;  1YF0 A;  4L0U A;  5GST A;  2XBI A;  5DAK A;  2I81 A;  5L71 A;  1UVZ A;  3QAW A;  3L9U A;  1M0U A;  3DD3 A;  4ZL9 A;  4G0I A;  5BRT A;  1SK2 A;  1YKC A;  2OBK A;  1F2E A;  3LJR A;  1M2A A;  1X5D A;  4NXI A;  2DIY A;  1GP1 A;  1HYU A;  3HVS A;  4EUY A;  1A0F A;  3GKN A;  4Q5N A;  2N5A A;  2PVO C;  2HZF A;  2KHP A;  2VCV A;  2B7K A;  3F4T A;  5A5H B;  3IK7 A;  4BL7 B;  4O32 A;  3TKS E;  3KMN A;  4HOJ A;  3LOR A;  4EIP A;  1V2A A;  4KB3 A;  3TKR A;  2E7P A;  2VCQ A;  3IPZ A;  5IPH A;  2JL4 A;  4AKX B;  1SU9 A;  5ECQ B;  5GAP D;  3MAK A;  1SYX A;  4L5O A;  1TJD A;  2R37 A;  2FWF A;  2LJA A;  2LST A;  4J57 E;  3FZA A;  4ECB A;  4DSS A;  4O5R A;  1XXU A;  1Z9H A;  1SEN A;  3IC8 A;  3IAS 2;  2IME A;  2IJY A;  2C1Y A;  4IP1 A;  4I6X A;  4WBR D;  4FIW A;  1ERW A;  1TU7 A;  2GQM A;  2PGT A;  2GQL A;  4IVF A;  11GS A;  3GL3 A;  1KTE A;  2VAF A;  1Q98 A;  3IC4 A;  3UBL A;  4Z2R A;  2AB6 A;  3QR6 A;  1I9D A;  1SD9 A;  1TXU A;  1K0B A;  2QA1 A;  1XW5 A;  1YF1 A;  1ZCP A;  2J9H A;  3FHK A;  1IYI A;  4ULX A;  1AQW A;  4KSO A;  3IAM 2;  4QL7 A;  2GLR A;  3G7I A;  1M7T A;  3I69 A;  5DDL A;  4F0C A;  1THO A;  5DJL A;  1JLW A;  1F37 A;  4TR4 A;  4NV2 A;  5J40 A;  3L0H A;  2DIZ A;  2LKU A;  4YQU A;  1T7P B;  4HU7 A;  1J08 A;  3ZLP A;  4POL A;  3VWU A;  2DBC A;  4FYC A;  3SBC A;  4MJE A;  2B1L A;  4XS1 A;  2H6Z A;  1CQH A;  4XRD A;  1YVL A;  3UMA A;  1BYE A;  1SL0 B;  12GS A;  4OMV A;  3TU3 B;  2VUP A;  1TK5 B;  3BJ5 A;  2AJQ B;  2X8C A;  4V1A p;  2OAD A;  1S3D A;  2HSN A;  3FK8 A;  1K0D A;  2V2G A;  2B5E A;  3EWL A;  1HNA A;  2OE1 A;  5KN2 A;  2HYX A;  1B9Y C;  4MP4 A;  1PX6 A;  3HYP A;  5D9T A;  5DAL B;  3ERW A;  3IHG A;  5LCZ A;  2H0I A;  4XHM A;  4RI7 A;  3UBK A;  1TW9 A;  2L5L A;  3EIN A;  1THX A;  3F4S A;  4GXZ A;  5KN1 A;  2B5X A;  3IDV A;  4JR4 A;  1PX7 A;  5D96 A;  4IW9 A;  1Z6N A;  2VD1 A;  3KP8 A;  2FHE A;  1TI3 A;  4MF5 A;  3C8E A;  3GTU A;  4ML6 A;  4F0B A;  2DJK A;  4NAX A;  5ID2 A;  1SK1 A;  2CZ3 A;  2X49 A;  2YNX A;  5HQP A;  1EOH A;  6GSU A;  4TN8 A;  4N0V A;  2CT6 A;  1QFN A;  4K0N A;  2EFE A;  2P5Q A;  1GTU A;  5J41 A;  2A2S A;  4L8E A;  4MJA A;  3N5O A;  1NW2 A;  2YJH A;  3HD5 A;  4OCF A;  2LTK A;  1XWB A;  2I4A A;  2C8U A;  4DSQ A;  1EGR A;  1W89 A;  3W6G A;  1EEM A;  1U87 A;  1SVL A;  1ILO A;  1XW6 A;  2CV4 A;  3M3M A;  2E2G A;  3HJM A;  1R7H A;  3GX0 A;  2GSQ A;  1KNG A;  4HI7 A;  1V40 A;  1WP0 A;  2K9F A;  1G6Y A;  2AHE A;  3ERG A;  2VIM A;  5HR3 A;  3ERF A;  1Y6E A;  1X5C A;  2MZC A;  2IIY A;  1SKS B;  2HZE A;  3IRA A;  4XTS A;  2LQQ A;  2IFQ A;  3L9S A;  3ZL5 A;  4CHS A;  5J4Y A;  4ZBB A;  6GSV A;  1VF2 A;  5DAK B;  1U6T A;  2MMO A;  4ACS A;  4W66 A;  1XW9 A;  3DYR A;  3CMI A;  3QAV A;  3MYD A;  3GUS A;  2C0D A;  3PPU A;  1S3A A;  1UC7 A;  1MD4 A;  1ZL9 A;  5GSS A;  3GH9 A;  3KP9 A;  3WD6 A;  1XWC A;  5EVO A;  4NHZ A;  2FGX A;  4WR5 A;  1O7U A;  1TK8 B;  3PH9 A;  2J23 A;  2EIQ A;  2CX3 A;  4LMW A;  1GTA A;  4XS4 A;  2IPA A;  3MSZ A;  4OO4 A;  5IIZ A;  1T8E B;  4JE1 A;  3UOM A;  5IOW A;  1GRX A;  5D8I A;  3NIV A;  1FW1 A;  1BQ7 A;  2RUE A;  1X5E A;  4EIQ A;  1A2J A;  2BJX A;  1K3Y A;  4PGT A;  2R4V A;  2CAI A;  2C3T A;  4DSS B;  3O3T A;  3M9K A;  1O73 A;  1TRS A;  1VGL A;  2XC2 A;  3EU4 A;  2H0H A;  4MZW A;  1KEB A;  1XCC A;  1K0A A;  4I8B A;  5ECO B;  2D2Z A;  3IHQ A;  4E8E A;  3KCM A;  2VKZ G;  4KND A;  2A4V A;  4ZL7 A;  5ECN B;  4ICY A;  4YH2 A;  2YWO A;  4PTS A;  4CY6 A;  2YCD A;  1ZYP A;  2HQT A;  1OE8 A;  5GAN D;  1EOG A;  2HRK A;  3FR6 A;  3GL5 A;  4G2E A;  3KIJ A;  1WPI A;  5EY6 A;  4HJM A;  4HZ4 A;  4PUR A;  3TJB A;  3ME8 A;  3VPT A;  1R5A A;  3CRU A;  4MCU A;  1URM A;  2EC4 A;  3A2V A;  5A5K A;  2ZCT A;  5IPG A;  1TK0 B;  2V32 A;  5JCU A;  4X43 A;  2R5G A;  3WYW A;  2LEG A;  4G0L A;  2JSZ A;  1YY7 A;  1SJ6 A;  4K7I A;  4XRA A;  2WCI A;  1BED A;  1AAZ A;  5E4W A;  3C1R A;  2WGR A;  1FG4 A;  4MNN A;  2HSN B;  5FT3 A;  1M99 A;  4N30 A;  3TDG A;  2I9H A;  1A2M A;  2OE3 A;  5F05 A;  4Q5F A;  2JSY A;  9GSS A;  3TJG A;  1V57 A;  3GV1 A;  5CRE A;  4ECJ A;  1T00 A;  5IMA A;  2GZZ A;  4EKZ A;  4X0X A;  1AUC A;  4HU9 A;  1NSW A;  3RPP A;  3LYK A;  3LEF A;  4KW6 A;  1TXX A;  4NWY A;  2PBJ A;  2TIR A;  3MWH A;  2ALB A;  3S9F A;  2LJK A;  1M2D A;  2RM5 A;  4WR4 A;  1SD8 A;  1YKA A;  2NDO A;  1WWJ A;  2A4H A;  3CBU A;  2IMI A;  1DUG A;  1M9A A;  3GTU B;  2LS5 A;  5ECI B;  4ISD A;  4G9H A;  3UL3 A;  2O85 A;  4HDE A;  5ID2 B;  2GSS A;  2K6V A;  4V2M A;  3TRQ A;  2V41 A;  1FVJ A;  3GHA A;  3QDN A;  4JU5 A;  1Z5Y E;  5AN1 A;  19GS A;  4MZB A;  1C72 A;  1SJI A;  3UEM A;  3CWG A;  1SL2 B;  3Q19 A;  4WET A;  4GSN A;  4IQA A;  2OJL A;  3ZTL A;  2L6C A;  3LSZ A;  2H73 A;  3VK9 A;  2YWM A;  2VM1 A;  5ELA A;  1SVM A;  3F6D A;  3QAG A;  1UN2 A;  1GNE A;  2VLT A;  1XWA A;  3RHB A;  3GMF A;  1OVN A;  3DVX A;  3UIW A;  3WGD A;  2H19 A;  2ON7 A;  1RW1 A;  1X0R A;  2GST A;  2HZE B;  2FWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...