2NTSP

Crystal structure of sek-hvb5.1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFNETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSLADRVNTEAFFGQGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRBC1 protein
publication title A novel loop domain in superantigens extends their T cell receptor recognition site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/immune system
total genus 55
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ntsP02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ntsP01
2XZQL 4X7TB 2Z4QA 1M7XA 1S9WB 4LHUB 3MRPB 1DN0B 2XRAL 4R3SB 1X5IA 3T0WA 5BO1H 5DC0A 2DOCA 1IAIM 4R8WH 3DBXB 2FB4H 4CW1A 1G9MH 3G08A 3BWAA 3GMLA 1QVOA 1FO0A 1DSFH 1LDPH 2AW2A 4JKPH 4N8VB 5D96C 1ZLUK 4HZLA 3RTQA 3ZHKA 1MIMH 4XAWL 5FECA 1JHKL 5BRZD 2NZ9D 1PJ9A 2DLFH 3QO0A 3LQZB 3IRPX 2ITDB 4X0KA 1ZHBA 1DR9A 2GUOA 1MIEH 5J56B 5FM5M 3LKSA 3C5ZC 4JO3L 2W0LA 4XXDB 4PJEE 4Y8AA 1QBLH 3RWGB 2AEIT 3NIGF 5GGVY 2X4TB 3MA9L 1J86A 5F1IA 4S1DD 1NC2D 3ZYIA 5EUOB 1Q0YH 3W2DH 2ZG2A 1MLBB 5IM7B 3EDFA 3UTQA 3FZUD 4Z7WF 4IJ3C 1WTLA 2V5RA 3ARDA 1I9JH 3QFDB 3U0TA 3PABA 1DFBH 3VWJB 4HWUA 1J87A 4HK3N 4PJ8B 2FX8H 4TSAH 4L8SA 1IQDA 3KYAA 2AK1H 1R5IA 3UCRA 2JCCE 1CT8B 4YAQB 4FQQB 4PREA 4XBGB 5IHZA 3FB8A 1SJXA 1HQRB 5FOJA 5BS0D 4PRAA 1ZGLM 1KCUL 3QPQC 5GRWA 3FB7A 5DD1H 2OP4L 1F11A 3BW9B 4PJFF 1ZLVK 1QLRA 3OG4B 5FYJL 5CLWA 2GY5A 1SY6L 1CN4A 3F8UB 5I2IA 2DQFB 5F9OL 4OCMC 2DIAA 3GI8L 4Q9BA 3MLUH 2LAGB 4QY8B 1GZQB 1OB1B 4MVBC 4WW2F 1AGFB 2JKXA 5I74C 4XNMB 4MA1C 1T6WA 3MV9E 5D7IB 4C56B 5DHYB 2X09A 1PW3A 2X70A 2JK5B 4PGCA 3D3VD 3HZKB 4U1KB 3ARGB 3SDCD 2A1WL 2DQJL 1WF5A 4R7NA 2XN9E 5EBLB 1AJ7L 4HWEH 4WV1B 4CU8A 4HQQL 2OI9C 3MRBB 1YJDL 3HB3D 3SDXB 1NSNL 1MY5A 2YOCA 2YPKA 3B9VA 5HGGS 2MKLC 3MJGX 3QDMD 3RVUD 2QQLL 2QQNH 5CBAA 4LSSL 4PRDA 3TJHC 3T1FA 2BRRH 3LRSA 3PHOB 1MNUL 3QUZC 1RFDL 4MD5A 3SGKA 4L4TD 1F90L 3GNML 4ZXBA 3GSXA 1A7RL 3WFBL 4XPAH 3CMGA 2VNCA 3GBLA 5F6IC 3ZKMC 4Z9KB 2ZJSL 1L7TH 4K2UH 1EEZB 1IBGH 3QIBB 3ZE1F 1ND0B 4JRWA 4MLSA 4N90E 4EIZC 4LNVA 2FR4B 4XPTL 5E2TL 5D1QB 4Z7VA 3NZ8A 4M7KH 4LSVL 5JZ7C 1FNLA 4IS6B 3F7RA 3EFDL 2Q8BL 3LEYL 2BFVL 3VWKA 3GBMH 3BAEL 3HPLA 4K7FA 3FT4B 4QRPE 4PJCE 5ISZA 1TVHA 3QEHB 5CEZE 4LLWB 4NQEB 1DQQA 1U3HA 4MCZB 1OARL 4JM4H 2ZCHH 1IC5H 2R0ZL 5EO0A 1YPZA 3QEGH 4ODHH 1REIA 2HFGL 3CFDA 3IAGC 1KIRB 4WUUD 3VFNB 4OV5A 1YQVH 4U1NA 2DI8A 2N56A 1UQSA 4LIQL 5JNYB 5E08L 1BJ1J 1AO7B 1K4DB 4Q6IC 3VXUD 4P3CH 1FNAA 2UZIL 3X11A 2BNRA 3DSFL 4KVNL 4WI4A 4U1LA 3HE6B 5JW4R 1RUKL 3VFSB 4NQCA 1YMMB 1ZTXH 1WIUA 5JR1H 4U33A 4Y2DA 2E8ZA 2J8UA 3NFNB 1H5BC 1SHMA 4XNYH 5DYOB 3BPLB 2AEPH 4HS6B 5L2KE 4S1QH 1OM3L 4NKIH 4WUKL 3QWOA 1IEHA 1C5DA 5FOBB 1AI1H 2F54B 4OCYH 3WFDL 1T2QH 1F3JB 1ZS8B 5BRZA 3WN5B 1EXUB 2RB8A 2RFXA 3FO0L 2ZCKL 3NPZB 2ZUWA 3RJQB 1V3LA 1VPOH 1XF2B 2H2SD 3OKKB 5D7JC 4ZUTB 4G8EA 3FONA 1NC2A 4JG0L 3KYNA 2YHGA 1FNFA 3IFPB 4Y5XB 4I5BB 1G7LB 4JM2F 2GAZA 1S8DA 4XVUD 2EYSA 1EAJA 3VXSB 5DGRA 4HFWA 5DJ2A 3CFCH 3OKYA 4PGBA 5DRWA 2V5MA 3QUXB 5HI5C 1IGCH 1WIOA 3CD4A 2XQBL 3WO4C 2BJML 2HA1A 1G9NC 1KTKE 3SKOB 2FJHB 1CD1B 4WHTB 3U48A 3KLSA 2CK0H 2CIIA 5HYIA 5ICYB 2W59A 2C3WA 2A9NL 2C3XA 4PGZA 3CLFH 4G80B 2JJVA 1FBIL 1A4KB 4DGIH 4UUJB 5T1MA 2MCPL 2ZUXA 3OAUH 4J3TA 3RZCB 4HS3B 4DZ8A 5CEZH 1DVFB 3UJTL 2EXWC 2FBJL 4GAGH 4MB5A 1F6LL 2Y5EA 5ALCL 3QNYB 5BS0A 1A14H 1F2QA 4M48H 1DANU 1Z0NA 2F5BH 4S2SA 4AMKL 3VD4A 4JG1L 4MDIA 1A2YB 4OLXH 2BY3A 2D0FA 3C60D 4RGMC 5IFJA 3VI3E 3GSRA 3GJEB 4NCDA 4JE4B 5GRXG 2AJVL 1BVZA 4FMFA 3ALWA 1TQBB 3MLZH 1SJVA 1NCNA 4GSDH 2QQKL 4Z7WB 3RY4A 4I2XB 4RA3A 3PP4H 3SPVB 2ICWA 2HT2C 1Q0XH 4OZIA 4G6AD 1VGKB 5C0GB 3QP3A 4LRNL 4HMDA 2BZDA 4Z7VE 1P4IH 4X6BA 1M05B 3D3VA 3TNMA 3SDCA 2J6EA 3X12A 3RPIA 1S7XB 4KKCD 4K7PX 4N0UA 1P4LB 1PD6A 5FGBC 15C8L 3MUGA 5CZKA 5C6PB 5EN2A 3HKFA 5I30H 3OAZH 4NQTA 2XZAH 5EOCJ 1F8TH 5C9JA 2X44D 5ISZE 3Q6FA 2MQCA 2PCPA 4IRSC 3L7EB 1WICA 2DJSA 3VRIB 4EZMA 3QDMA 1YPZE 5BJTB 2DQEL 4P99A 4P4KD 2W9DL 2OJZH 3MRKB 2XA8L 4PJFB 4Y5VA 3X3FL 2VZOA 4IRJB 4QXGL 4L4TA 5C9KA 3DOSA 4MA7H 1AD0B 5HHPB 3G6AB 3R8BB 3UBXA 1LNUA 5TH2B 1HI6B 3U0WL 5EH1A 1RZJL 5IQ7L 5M95B 1N8ZA 4JZJA 4LF3B 4WW2B 2P8LB 3EZ8A 2JCCF 3VRJB 2CDEB 1P7QB 4NQCE 1CZ8H 3BKYL 3QQ4A 5I1HL 5E8EB 2J8UE 1NDMB 1A7BA 1I3VA 3BPCB 4WI3A 3CXDL 3GO1L 1A7PL 5AYUH 4PJDE 5C0FA 1MF2H 4JN2B 3OR7A 1Y0LA 4NUGL 3REWA 3O6ML 4G6MH 4MJ4A 4Y16D 3OTTA 5GGVH 4L3AA 5BRZE 2EDKA 5I16B 5JW4M 3NFSL 2V2WB 4OZ4B 4YX2L 1HEZB 4DK6A 4YDJA 4JO2L 1W72H 3MNZA 3PGFH 5ECJE 1QR1A 4Z7UA 3GBNH 1DBML 1FZOB 4X8JB 3BD4A 4U05A 4P5KA 2ADJB 5I66A 1TVBA 3QEUB 3DROA 4WUUA 5KZCD 1CG9A 3L3OA 3VFMB 1NEZA 5A1AA 1TJHL 3QT2A 2YA2A 3KGRA 4KROC 5CUSH 3H3BC 3O2DL 1K9TA 4KMLB 4GFTB 5D93B 3VXUA 4ZFGH 2X4SA 5ICZB 5DEGB 2LAAA 4ZTPL 2BVPB 1K6QL 2BVOB 5J1TC 5GSVA 1B88A 3H0TB 4NO0D 2ATPA 4KJWD 2NY0C 3QHZH 2GITB 1HK6A 1VFAA 4MWFB 3VFWB 3H9YA 5I18H 4M1DL 5ID0B 1B9ZA 3NVQA 2Y1VA 3MRHA 4OLWL 4BQCA 1HXMA 3GIVA 4UB0L 4XP5L 3IGAB 5EOQH 1HSBB 2F8VA 4Q9QH 3PDOB 4TNVF 2NNAA 1NAMH 5H35A 4YBQC 2XZCH 3QG6B 3QRGH 5KVEH 3T08A 4MB3A 2FNBA 4CVXB 3MV8E 4UAOB 2JJUA 5F9AC 4XZUA 3BPOC 4XP4L 1YN6A 3WEXA 3TYGH 1NL0L 2CH8A 3DO3A 3FN3A 2B1HH 2CUHA 1W0VA 4MNQB 4NJ9L 1FGVL 4RMTA 2VLJB 1KEGH 4EBQH 3FO1B 4BFIA 5I1LB 4L3CB 3ORJA 3L6FA 3T2PA 4JGUA 3OJDA 4HXAL 3D3VE 4FQJH 1LMKA 1U9KA 1JHLL 3GMQA 1DBAH 4WEBH 1MWAH 2GI7A 2HFEA 3L7FB 4HPYH 4LSRH 5DUBA 3VCLA 2YKLH 4IBLT 4KY1L 2NX5B 5HYJE 4LLDA 5E94B 3AS1A 4JKWA 4N8CH 5FYLE 5D1XB 4HG4K 4YE4L 3VFPB 1E28B 2ICWI 4OTXL 4NNXB 4Y4FC 2AXHA 2G2RB 4OGYH 2XTLA 1N59A 3VXMB 4XP9H 1QG3A 2HMIC 1TCMA 1BD2B 1ZOXA 5FUZH 1FFOB 3RUGF 5K9KA 1NANI 1JYNA 3C60A 5AUMB 4HUWA 5HTSA 1DBJL 4JFQA 1G7QA 4HULB 3PWLB 1U8HB 5H2BA 3CFJB 3G5VA 4AQ1B 4LK4A 4WI2A 2XWTA 4JM2B 4HIEA 4JFHD 4ZQKA 4PY8J 3MV7B 2VE6A 3DMMC 5FAAA 1BIHA 2ED8A 1ZSDB 5JOEA 2VKXA 4L4JA 1MI5D 1KJVB 5E2UH 2VTFA 3BKJL 2MCG1 5BZWA 4XB8A 5T1KD 3WKNA 3WL9B 1CFVL 3UBXI 2X9XA 1DQDH 5FCUH 2F9BT 4PJIA 1BEYL 3TBWA 35C8L 3RIAK 1TZHA 1FLRL 1FL3B 5DI8A 3BSZH 2FATH 3BIKA 5EZOH 2E6QA 1AGBA 1MCKA 2VABA 3ZKXB 1S7UA 1NDGA 2CLRA 5SX4I 5C0NC 3IU4H 1A1OA 2A77L 3IDNA 3WFHB 4YQXL 1UZ6E 3QEQD 4P4KA 3FFCE 1OVZA 3UZVB 1L7IL 5IF0B 3IJSA 1BX2B 1MCIA 3IDJA 3GB7A 1I1YB 4WNQB 3WS6C 1AGEB 5CJQL 5EO1B 2O61B 5JHLH 4JPWH 3IB4A 3EJJX 1KB5A 4FQIH 1B2WL 3C5SA 1NGWB 5I8EB 1KC5H 1H8OA 2VLKE 1CTOA 4X4XB 5LVEA 1E6OH 1X5FA 3H3PL 1OAXL 1VESA 4LKXB 5I1DB 3DX6B 1WBXA 4S1SL 4UOW1 4JFZL 5DK2A 1VFBA 3RU8L 1T5XA 1KTDA 2AEQL 3DURA 2MPAH 4PJEB 4V1DE 1LEIA 3IKKA 2EDQA 1G6RL 2NXZD 2CKBL 5ID1A 1IFHL 1E4XI 5HBBA 5FB8B 3TA3D 3RDTB 3NACL 4KKLD 3FRPG 3NH7L 4Y16A 4DGYH 5MEPB 3U30B 3PL6C 2AV7B 5IHBA 3BZ4B 5IBTH 4PJ7F 4UQ2A 3HI1A 4UIMA 4UOJA 5EZIL 1IT9H 1MRFL 2P5WE 5HDOA 4NZJA 1WGOA 3UMTA 1R0AL 4NZTH 3ES6B 4EVNB 5BZDB 3D85B 3P11H 5D72L 3DI3B 4QWWD 4NRXB 1PKQA 3CVHL 3FQTA 3QCUL 1J1PL 1EGJH 4JZNA 3FN9A 3B83A 4PLJC 2IG2H 4OSUH 1WCBB 4YH6A 4F3FB 1MAMH 4FQ1L 1U8NB 3P9LB 5DD6A 1EO8L 5E8NA 2JCCB 4MNGA 5J89A 2APBA 2PYFB 4OQTA 1IGYA 2MKWA 5HGBB 5DRXA 1F00I 1CFTB 2Y06L 1RK1A 4QXUL 2OR9L 3NN8B 4NO0A 4R9HA 1T7ZA 4NHCH 5TE7H 2VDOH 4PLKC 3TZVD 4OKDA 4ZUSA 4ZFOA 5IFHH 5E2VL 5DJDB 3K74B 5EFIB 3OPZH 2AJSH 3TC9A 4JLRB 4OM1L 3EYFB 2IC2A 2C26A 3OKNB 4N1HB 1N5AB 1SBBA 1AXTH 5KVGL 2XTJE 3EYOB 3MV9B 5CGYC 2ORBH 4JQVC 2WANA 1GZPA 2NY3B 1CR9H 3ISWA 3MODH 4NYLB 4WDIB 4K8RH 5E1AB 2ZUYA 3W0WE 3G6JE 4PJDF 3MOAH 3C2SA 2XN9B 3SCMC 5J6HB 1IKFH 3JV0A 2D9CA 1ORSA 3A0OA 3D1MC 2YEZB 1IGTB 1MJ7H 3QCVL 4XMLL 1U92A 1MCEA 2VDQL 5EU3B 3MFFB 4I3RL 1L4IA 5C07E 5L2JB 1OOAA 1A9EA 2ZNWA 1YA5A 4YXLL 3RI5K 5I1KH 4ENED 4ZFZA 4DN3H 3BX7C 4JDZB 1PX3A 4NIKB 4YGVB 5CZXC 3T0ED 1CDBA 2OL3H 1XIWD 4FQXC 1FH5L 4DTGH 4L4VD 3FFDA 3GFUA 4WGWB 2BRQA 2WLZA 4HIJA 3MLYH 2IFFH 2X89D 3REVA 3SGEI 4HWBA 3UAJD 1GHFH 1ZV5A 4P23D 2ZSVB 1D5MA 3FQRA 3V5KA 5EBWA 1LO5B 2DJ4A 3C09C 4G7VL 4ODXA 1FIGL 3LKQB 2A6KB 1KEMH 3N85H 1MFCL 2BCKA 3L1OH 4KVCL 4IOSD 5JOFA 1FJ1B 5EIIA 3RWFB 2B39A 1YN7B 3EO0A 3HUJA 1LK2B 1UB5A 3GMLB 4O58H 1D5XA 1N26A 2H8PA 5IEKA 4QRPB 3CZJA 4OGAC 4PJCB 4KK6C 2GUOB 3OJMB 1BFVL 2BSSB 4L9LA 1MI5A 3NABH 3CGTA 4MAUH 4I0PD 3SGJA 5T1KA 5IMMA 2KPNA 1RIVH 2WUCH 1FV1B 2D03H 1S7RA 1AKJD 2BY1A 4MXWL 4G42B 4NZRH 4BZ2L 4AEHL 3GSNH 3LY6A 3MROA 3F58L 1UYWL 2C4FU 4UINH 1ZA6A 5FA4B 4XCNB 3KPPA 4LCUB 3ARDB 5CWSB 1T03L 2WWMC 1TZIB 3AU1A 1GGBL 5B8CC 3QEQA 4BFGA 4Z6AT 3RUGB 1N7ML 1KJ3L 1RIUH 4JY4A 3LQAL 1QEWA 1P5VA 3U9UB 3EYSH 5K9QG 4LSPH 5J11C 4OF5A 4OI7A 5L2KB 4ETQA 4L8SB 1JYVA 4HGKC 4M6AA 4RAHA 2E9IA 1F4WL 4MNGE 2NY1C 1K3IA 5CP3A 1P1ZA 3MUY1 1XCTB 4DUVA 2NCMA 3BP7A 4IOFD 3DUHA 1RJYA 1UWXK 2R1WB 1VEMA 2BSRA 3ZHDA 1NC4D 4E5XA 2APFA 2AJYL 5HI3C 3Q3GB 4X5WA 5KSAD 4AENB 1QLFA 1QLRB 5FA3A 5HPMA 5E5MA 1F4XL 2NY5L 4NNPL 4X80L 3TA3A 5IR1A 3T4AB 4YBLC 1CICC 2IPUG 3MTRA 1A7QH 2E27L 4YR6A 3C2AH 1BQLL 1LO3H 2XPGA 1RURH 1XF5B 4NKQB 1Q9KB 4LU5H 1Q9OA 2Q76A 2JLLA 1ED3B 4H5SA 2UYLA 4N5UA 3QJFA 4AH2B 4O51A 4ZUVA 1DQJB 1IGIL 5HDLA 3OJVC 4PGCB 5F7WC 3D48R 3VXQB 1V7ML 2DD8L 2B7DT 2VDPL 3ULUH 3PWJA 5F71A 4PP2B 4G43A 1NBQA 2VUYA 2P46B 4XPBL 3UYOD 2HTKC 3O3BB 3H9ZA 2DRUA 4EJ1C 3CFIC 2CQVA 3O3EA 2CIKB 3SDAD 5FO8B 3S88H 1FVCA 4P2RD 1RJLA 4PRDB 5TF0A 3T1FB 2L0DA 1C08B 4OT1L 5EBMA 5FDWB 5C0AA 5EOTB 4AZ8A 1CVRA 4JRXD 3F7YB 1UZ6F 1W72B 5F7EH 3UTOA 4MSWA 1ZT1B 3B2VL 4PGDA 5FF6A 1XGYL 3IFLL 2I5YL 2F58H 5I75C 2YA1A 3CZFA 2WIIA 4LMQI 25C8L 4UQ3B 3TZVA 2FDBP 3NZHH 3TYFA 2QADB 3CH1B 1TDQA 4NQDD 2OXGA 4XBPB 2BMKA 3RWHA 1A7OL 3ZE0E 1S5HA 1RUMH 1BF2A 1HHIB 3FB5A 2FH8A 1N4XH 3QXWA 4FMKA 4YHML 1J05A 2F74B 4HF5H 4EN3D 5CZVL 4Z7VB 3NZ8B 5H37H 4RMWA 4K3EL 5IW3A 3ZYJA 3HMXH 3HUJE 6FABH 2VZ3A 3VE0B 4JHWH 1NFKA 5CJ8A 5F7FA 1IEBA 5BW7C 4NGHL 1RUAH 4JFHE 3HPLB 3IU3B 2B4CL 5DJXA 1U95B 3FJTA 3F7PC 3T4YA 5DMYA 1KPVA 4OUOA 3BJ91 4TSCL 1TVHB 5T33L 1DQQB 1T21A 2SEBB 4XHQA 3U46A 5C0JB 4KRPC 3KLHD 5EO0B 1YPZB 1UCBL 5CJXC 4C59B 4KPHH 5LWYH 2AP2A 3L95B 5JHDD 2BDNH 1F45A 1NAMB 3JWOH 4L1DA 5CIPH 3T0EA 4OLVL 1XIWA 1YEFL 2AJUL 4F9LC 4L4VA 1IGMH 1NH6A 5ANME 5DEFB 4EDWH 2X89A 4GBXD 1MCLA 2EIZA 4K55A 2CRYA 2P47B 4LHQB 4MDJA 2F19L 4XCYA 3RWCA 1Y6NR 2EE3A 1QRNE 1S78D 4P23A 4U6XB 4H1LH 3MGOB 3QEQE 3U7AA 4EI5D 3BH8B 4NQCB 1G9MC 2D31A 4EOWH 4X4YB 4I77L 1KBGL 3JVGC 2J8UB 2Q8AH 5GGUB 3MJ9H 1F3DH 4RGOL 2NMSA 2BXYA 4PJDB 1YEKL 5HGAB 5EIQA 3QZWB 5KS9F 1FRGL 4JFYA 5JO5A 1HDMB 4WEUD 1DQLL 5BRZB 5ADPL 1N64L 2XWBB 3QI9C 1NGPH 2GEEA 4KDTC 4JRYB 3V4PH 2Z35A 1A1MB 1C7SA 4KUZL 4MJIE 4I0PA 2YUVA 3FCTB 4ZO6A 4XVJL 4IDLA 2Y25A 3KPOA 1UJ3C 3KYNB 1AKJA 1N6UA 4D0BA 5IK3B 5CGMA 1QNZH 4KDVA 2NQCA 1J8HD 1I75A 1NJ9A 1OSPH 2GAZB 3HG1D 3DV4B 4HFWB 2NR6C 5FYJD 1T0NA 4KTDL 4D9QD 5C0RL 5HYEA 5DRWB 4OCRH 2BNUA 1F02I 1I3GL 2IGFH 4P49A 5IQ9B 4X7SL 1JGVH 3CMOL 1KLUB 3D25A 2CIIB 4NFDA 2EDTA 3QUYC 1M6OA 2VQUA 1AD9A 3PDDA 4Z95L 2X4PA 2CDGB 2R0LL 4XC1L 4S2SB 2BOBA 1IAII 1NC4A 1CL7I 3L5WB 4MDIB 5FM4A 2VLLA 4LCIL 1L6ZA 4QRUB 5IFJB 1QHOA 3X14A 3MXWH 5KSAA 3C6LD 3HAEG 1T5WA 1RZ7L 3MV8B 3FOLA 4OUUA 5F7HA 3AMLA 1G7JA 5FUOL 2V17H 2IAMC 2R4SH 3ULUF 2E3VA 5DJCB 5I15L 1MQKL 3PGDB 3VFTA 5GISL 5HYFA 1KIQB 2WUBH 3D3VB 4ONGH 3SDCB 1Q94A 4HPOL 4QRSA 1S9YA 5EZJA 1IM3A 4QXTA 3WUZA 4WI8A 2AABH 1K8DB 1LK3L 2UWEA 3EOAA 4E9LA 5EC1A 2R1XB 1O5DT 1YNLL 4YLQT 5I1JL 4JKMA 5HYJB 4HMCA 4D8PB 1DUYA 2C1PA 3KPQB 3HZMB 3Q6FB 5ITBH 4LCCB 4LVHC 4TQEH 5IOPA 3SDAA 5FUCE 3TBYB 4P2RA 1AQKH 2HJKA 1G0XA 3KAAA 1AFVL 1KLGA 5FYKD 3EKCA 3IXAB 4PRPE 1H15A 4Y5VB 4JRXA 1MCJA 5FKPB 3T0EE 1EZVX 3STZB 1CFQA 3NPSC 3KYKL 1UWEH 2CMRL 1AY1H 1GGIH 1YNKH 1ORQA 3SE8L 2I9TB 5CEYA 4KGLA 4J3XA 3TVMC 1WC7A 4FZ8L 4NQDA 4YDLB 5GJTL 1QO3B 5IGXL 5L0QC 2Q6WA 5F9WC 1MH5A 3FO9A 3QQ4B 4ZOEA 1HYRC 5C6WH 3QDAA 1B4JL 5I8CA 3WXVL 4EN3A 1NKRA 5C0FB 1SYVA 3ARQA 1A47A 1NKOA 5DDHB 2XWJB 3QUKB 4I48A 4KWUA 4R7DA 2PR4H 1HIMH 2GT9A 2Z31B 4JO4H 4LEOA 4XHJC 3TO4D 1ZAGA 4PFEA 2EDFA 4QF1B 1U8IB 3KYOA 3LSOA 4XMPH 4YDJB 5FDYA 3SGDH 1EEYB 5JXED 4KZEH 5I66B 1CLOL 2X1XR 3FFCB 5JHDA 5ACZB 4AEIH 4MAYB 1CG9B 4XT1C 5FO7A 3P73B 5BV7H 1GC1H 1DEEB 5GGQH 4GW4A 1QQDA 3KPMB 5ERWB 4LSTL 4GBXA 2VLKB 3OKEA 2I07A 5IB4A 5IW1A 4NKMA 5GRJH 2FL5B 5IWLC 1T1XB 2H26B 3FQNB 4EI5A 5DD0H 2YPLD 1Y6MR 3ARFD 4GAYA 3WFEL 1D7FA 2W60A 4V1DB 3MLTB 4PJHA 4LLVA 4JR9L 3EYUH 2VERN 5FCSH 4WGVB 1XH3A 3GMMB 2FIKB 1L6XA 1I9IH 2CJUH 4G5ZH 1CF8H 2V6HA 1T1YA 4H8WH 5LQBH 3R8QA 2PO6C 1HHHB 2OL3B 4HXBL 1INDL 5TPWL 4L3EE 4GG6A 4TVSa 3P77A 3GIVB 3OSKA 2ADGB 3T0DA 5CMAA 2YD7A 4LHJB 1R3KB 3FRPA 3WHE1 1JTTA 5JDSB 1D5IL 1BECA 1Q9LB 2P5WB 4HV8B 4JVPA 4LPWA 3ZE0F 1GRWA 4OF7A 4LASL 4UT6L 4Y7MA 5JORA 4YHOL 2J2ZA 3RX8A 3P30H 5F1NB 1YN6B 4OZFH 1TITA 4HJJL 1RHHB 3MPCA 4YDIL 4FXLA 1J8HA 5F70A 3HG1A 3LS4L 4ZTOL 4BFIB 3HFMH 4NRYA 1SY6A 3WD5H 5KSBF 1B0GB 3UTTE 4DGVL 3A67L 1JNNH 2EIEA 4RAVA 4KK5C 3U1SL 5JW5B 1KG0A 1NMCC 3GMQB 3UTPD 2HFEB 1OAKL 4D9LH 3VCLB 2YZ8A 3ZTJH 1I1AD 3NA9H 1BQUA 2VR9A 4R90H 1A6ZB 4KMTL 4PY7B 4Y19D 5T3XE 1Q1JH 1QBML 3C5ZD 1NFIB 2IBZY 2W9EH 3MLPA 2JTDA 2XTJB 4I0CC 4APQC 2AKRA 2WNGA 3C60B 3ZDZF 4J12A 3C6LA 4JFQB 4R2GB 4R8WL 2FB4L 3PIQA 4WJ5A 1G9ML 3ALXA 2ZOKA 3W0WB 3G6JB 1S7WA 1LDPL 2OQJA 4P5TC 4JKPL 1WZ1H 5JMOC 2Z8WC 5SV4A 5HPOA 2DLFL 1FE8L 4ONHB 1NBZA 4U6VH 1FCCA 1MIEL 1X5XA 4LNRB 1X5HA 4X8XA 5I71B 1FAIH 3ARZA 2W1NA 5C07B 2WV3A 1NPUA 3WNKA 1ZVSB 1G7HA 1QBLL 3QIWD 3GSUA 4PJ9D 3QQ9C 1QFWH 3O9WC 2PXYD 4XRCA 3TBWB 3A6BL 1Q0YL 2CDFA 3W2DL 5E6ZA 3BIKB 2VABB 4F37F 3CSBA 3MOQA 4GMTH 2C5DC 4OD1H 4PLNC 4MD0A 1RK0B 4NWUH 1JI1A 3LCYA 4Q7DA 1I9JL 3B9KB 3WIHL 1FSKB 2HTLD 4P4KB 3Q5YA 1DFBL 3F12A 4RX4D 5IBLC 3WIFB 5HY9B 3IJSB 2K9UA 4LVNB 3X17A 4M6NH 4JFXB 3GB7B 4KHXH 4M7ZC 1EFXB 2FX8L 4TSAL 4OBRA 1KIPA 2AK1L 3SDDD 4HKXA 4HUUA 4Q6YA 3P4OA 4Q97A 1FL5A 2KQMA 4D2NA 3I6KA 3KS0H 2EXYC 5EULV 3GRWA 2AGJH 2OZ4A 4EQ3A 1KN4H 3MLXH 2AV1B 1TVDA 4LHUG 1QOKA 4HIHA 5DD1L 2V9QA 3GMRB 4DEPC 3Q5TA 3DURB 1KTDB 1LILA 4L29A 1G1YA 2X4OA 1UXSB 4I3GA 4N8VG 3EHBD 4HMEA 1T22B 3AB0B 43CAB 3MRFA 4BH8A 3GMNA 5T3XH 2ZPKH 4YUEH 3BEVB 3MLUL 1JN6B 1Z9SA 1FP5A 3TO4A 4AK1A 3JTSA 2BVQA 3TN0B 2CLVB 1A3LH 1OAQH 5C86A 3QUZD 3VDCA 2VISB 2I27N 2EE9A 4BSVB 3Q48A 1J5OH 3W9EB 5KZCB 2R23B 4HWEL 2GQHA 4XX1G 3W39A 1J8HE 3WHXA 2RJMA 2DM3A 2YSSB 5DD6B 5FYJE 1N0LA 1YEJH 4KC3B 4EUPH 3MO1A 4D9QE 3VFVA 5F9JB 4PGEB 2QQNL 1MJ8H 2BRRL 2FLRT 3IDGA 2V9RA 2YPLA 3LPFA 2J88H 4GRLB 1SEBB 2WBJC 3ARFA 1RK1B 1C12A 2KL6A 4JHZA 4UI2A 2F8OA 3IDMA 3OGCA 4C4KT 3DVGA 3SKMB 4XPAL 4S11A 3S35H 4KRMB 1XF3A 4LCYA 5JIKA 1L7TL 1MRDH 5CIPB 2A6IB 3P40A 1T66D 2ZUQB 3DXAD 4XAWH 4K2UL 2Z91A 5HYSG 2IJ0C 2KDGA 1IBGL 5E8PA 1D9KC 1CTNA 3H3KA 3VA2C 4Y5YA 4U7SA 4ZNEE 1GZPB 4M7KL 2YD2A 1HYSC 4H1LB 4JCLA 1MFNA 3EZJB 3L3JA 3PWVB 1AQDA 5MEQA 3LEVH 3GBML 4RQQA 2QJDA 4KTYA 2NYYD 3QA3A 2DQHH 3IJHA 4Z7QE 1YEEH 2QSVA 4JM4L 2ZCHL 1IC5L 5MEOA 4UBDC 4E42B 1CGUA 4ODHL 5E03A 5GRYA 1MJJA 4ZFZB 2ADFH 2DI7A 4JJHA 3V6OA 3PGCB 2IADB 1YQVL 2FX9H 3U6RA 1FYTD 4KKBC 4RWYL 1D6EA 1WWBX 2VITB 3FFDB 1I1AA 3MLSH 1Z6JT 3QIUB 1NGZB 3PWPD 4GXVH 4HIJB 2WINA 4Y19A 2JB6A 4P3CL 3GSVA 1HWHB 3VXNB 3C5ZA 3E8UH 5DZLA 3K1DA 2ZG1A 1OGAD 5I6XC 5KAQG 3LV3A 5D7JD 2GFBB 1BZQK 4ODXB 5JR1L 5C0BD 4YHPA 1AP2A 4XNYL 3GHBH 2BCKB 1GGCL 2AEPL 2OP4H 4S1QL 1F6AA 4NKIL 3KNBB 4M1CD 3AREB 3CDYA 3EO0B 3FT3A 3HUJB 1AI1L 5C1MB 1UB5B 4FTVE 4OCYL 1T2QL 2X1OA 5J7CC 3DX8B 3OR6A 4ZFFA 4QTIH 3K2UH 3DO7B 4LIQE 3CU7A 1GJIA 4PB0H 3DRQA 1CLCA 1QBBA 1VPOL 3UJIH 4BJLA 1ZLSL 4PB9H 5GS0C 5T1KB 5IMMB 3QIWA 1G6VK 1PY9A 2QBWA 4PJ9A 2HP4A 2E9JA 1HKLH 5TDOA 4DVRH 1EIBA 2PXYA 2VL5A 2EXWD 4MQXD 1JGDA 1S9XA 5ANMB 3KPPB 1JZ7A 3CFCL 1N6VA 1I7RB 1NSNH 5MI0B 1IZJA 1IGCL 4QRTB 4G9FD 1QRNB 4GLRH 3QEQB 3BP4A 1K8IB 2CK0L 3JUYA 4RX4A 4Y4HB 3BGMB 3U9PH 1MNUH 2A83A 3CLFL 1IC7H 1ZKAA 2NXYD 1SQ2N 1FC2D 3SN6N 2YBRA 4DGIL 5SX5H 3SDDA 1A1NA 2IWGA 3DPBA 2HT2D 4U2YA 1P1ZB 4GAGL 5E56A 5AZ2H 2X1PA 4I4WA 4WI7A 1BF8A 1A14L 2YPLE 2Y6SD 2F5BL 3FO2A 2IPKB 3O2DA 4KAQH 4M48L 3NCFB 4YHLH 1UKSA 4OLXL 4J4PC 2VIRB 1BIIA 4MJIB 4WU5A 5K93A 4X5WB 1KYOJ 1YNTA 3O6FD 1MELA 5FA3B 5K9QI 3HC4L 4ZPVA 5SWSD 3FRUA 3TA3B 1HH9B 3MLZL 4CBPA 4YO0A 4GSDL 2DWEB 5DD3H 3VDAA 2JIXD 1A6WH 4UIKH 3PP4L 2H32B 1Q0XL 3CDGB 4H5SB 4N0RA 2UYLB 2Y7QB 4ONFH 4FQPA 4TOYH 4K07A 3SKJH 2ZZUT 3JTTB 3F62A 4WO4C 4O2FA 4M6MH 3MBEC 4YEEA 1S7TA 1AH1A 3PWJB 1A21A 2XZAL 1F8TL 1JWSB 2DI9A 5FHAH 3K8KA 4LIQH 3LKPA 3S97C 4P5MA 5F9DC 4C57C 4Q9CA 4IIQB 3SBWC 4RFOH 2X4QA 3MV01 5CINH 2E7LC 1UVQB 1WFTA 1RJLB 4S0SD 4JO1H 2OJZL 3O3AA 5J9PB 5DUMH 3UTPE 4OFIA 4TN9A 3QH3B 3QDGD 1OCWH 4QGTA 4MA7L 5L9DH 1GCFA 2CR6A 5E6IC 2EDNA 2K7PA 3CZFB 3X3GH 3TZVB 2XY2A 4AQOA 4Y19E 5KSVA 4WW1A 4E41E 3MRGA 3KDMB 4F15B 3DXAA 3VH8B 2PETA 2JJTC 4ISVB 2BMKB 1CZ8L 3RWHB 3AXLB 1S5HB 3AVEA 3WS3A 3G5XA 3ZT5A 5AYUL 1MF2L 4G8GD 3MNVA 3SO3B 4GKSB 1IEBB 4P3WA 4G6ML 4JFOA 1JNHA 1HKFA 2HT3D 4OKVA 1KPVB 4JFEE 1RD6A 4UU9B 4ODUB 1W72L 1XR9A 5IV2A 1U8JB 4WCYH 2DQTH 2DYPD 2DTMH 3T0VA 5ALBH 4D0DB 3I50H 1BZ9A 4YHNA 4URTB 4U2ZA 1NUNB 4PRPB 1JF1A 43C9A 1QPPA 1FYTA 3NMEA 3QIBC 1XIWB 2ITCA 2R29H 4UT7H 5F7MC 4YPJA 3EOBB 1MOEA 1MVFA 2A9NH 3EO1A 5CUSL 4U1SA 1QZ1A 3PWPA 5F3HB 2VR4A 4KU1A 4XCEB 1ITCA 3MR9B 2EIZB 3AAZA 4M02A 4ZFGL 4GH7B 3EYVA 4OZFB 5BVJA 4XCYB 4YBQD 3RWCB 4LFHG 3ZDYE 3GHEH 2W0PA 1OGAA 5GQBA 2W0FB 5D7JA 4YNYA 3TPUA 4AMKH 1OPGH 5C0BA 5J1AB 1QPXA 4WFHE 4LHUD 5HHOD 1LP9E 3HPJA 1ZANH 4JKLA 2EC8A 5I18L 4RGNC 4P9HH 2OCFD 5IVNA 3LDBB 2IANE 2X5PA 5JO5B 1UM5H 5H94A 3LZFH 3MLWH 2JELH 1G7PA 1X4XA 2QQKH 1GH7A 5EOQL 4AEEA 5AD0A 4NPYA 4Q9QL 2Z35B 4ZSOA 1NAML 2XZCL 2FCBA 4I0PB 4NP4H 1I7ZB 1V05A 2WIMA 4HJ0D 1EEQA 3TH3T 4QO1A 3ZZ1A 1GL4B 3ARYA 1TPXB 1RZIB 3TYGL 3BGAA 15C8H 2B1HL 4MA8H 3S96A 4XCFH 1I1RA 4YHYB 5HHQB 1KEGL 1QTYT 4EBQL 5JIIA 1NBVH 3QUMA 3BKCH 3PHSA 2EYTA 2XV6B 1R5VA 4ORGB 1T7YA 4G9FA 2PW2A 4YFLI 1JJUA 4FQJL 2FEDD 3WN5C 1DBAL 1MWAL 4LSRL 4HPYL 3BVNB 3VWJD 32C2B 3CIQA 4C58B 2YKLL 3DX9A 1N2RA 1M6OB 1I7TA 4M8VA 4N8CL 4PJ8D 1AGCB 4CUCA 1UB6B 5MHSD 3IAQA 3ZT7A 3HNVL 1TLKA 1UEMA 1CXHA 1ES0A 3U0WH 1OD9A 3CVHA 5IQ7H 1LO4L 1P53A 1LE5A 1XZ0A 4R4FH 2Y23A 4L3EB 5EU6D 4XP9L 1AC6A 4Y5XC 4P59H 5F88A 1XGQA 5FUZL 1NC4B 3S36X 5IMKA 2VLLB 1FORH 3O6FA 2FLBT 2L4OA 1AHWC 3CXDH 5KANG 3FB6A 1KN2H 5SWSA 3HN3A 4UDTA 4XNZC 4OJFH 4Q58C 2W38A 5IIEA 3DXAE 3O6MH 4N0FA 4FNLH 2C3HA 2JIXA 2EDDA 4LSUH 1X3DA 5M7QA 5E2UL 3ULUC 3QXDB 4C56D 3UTTB 1JF5A 4GAFB 4TTDC 3MC0A 1DQDL 4LLMB 5FCUL 3ARGD 1Q94B 4BK4A 3EOAB 1B0WA 2FATL 3BSZL 4UZGA 3EJYC 5EZOL 5SWZE 2YC1B 4ODBD 3O0RH 3IU4L 3ZDXE 3P0YH 1KB9K 4F7EA 3H7BA 3ULSB 3GSQA 3SDAB 3K8MA 5F7KC 4OAWA 3OKDB 3T1WA 1A6UH 3U0PA 1AXSA 5DJYA 3RWIA 1FYTE 4NFBA 2V2XA 3QDGA 1CFQB 1VHPA 4XP6H 3KPNA 5JHLL 4JPWL 4FQIL 1U6AH 3S6CA 1ORQB 2BXZA 1XF4A 5CEYB 1KC5L 4MHHG 4YDKL 4Y4KC 2ICEB 1JGUH 2Y4SA 1D3CA 3D69B 2Q6WB 2VH5L 4J1UA 4MNHB 4EUPB 4P2CG 3ECBA 3RZWA 5I8CB 3TIEB 2MPAL 1DUZB 4HKJA 4XNXH 4WRLA 3RX5A 3DNKA 3K4ZA 2IEPA 3P9MA 4G8GA 4IOIA 2H2PD 4DGYL 3U36A 3KVQA 1RJZA 5TQ2H 4ZG1A 5IBTL 1X5ZA 5I76A 5C0EB 1IT9L 1CLYH 4MQTB 3JWOC 4NQED 4ZSOE 1NAKH 5AAWA 3W9DB 2DYPA 5FEBA 5DK0B 4NZTL 3P11L 5KN5A 2OMBA 3THMH 4J2XA 5J6GB 4PRID 3HAEH 4CAGA 2Z92B 1GGYA 1EGJL 3BN9D 3F5WA 2IG2L 3Q1SL 4OSUL 2YK1H 4GW4B 2X9WA 2OTWA 4GMSH 1X5KA 1MAML 4MCYA 4WWKC 3C5JA 2I07B 4YJZL 3QFJA 5HYQA 4NKMB 1T2JA 4O00A 3CC5A 3JWNC 3RWDA 3N06B 4GAYB 2Q20A 4Z7UF 2NLJB 5DS8A 2BX5A 4LHUA 3TLRA 3MRPA 1DN0A 1AR1C 5HHOA 2VDOL 5DTFB 5TE7L 4LLVB 2KBGA 4TVPD 1XH3B 3CX5J 3VXPB 2F54D 1T1YB 4N8VA 5IFHL 3OPZL 1IEAB 2AJSL 5F6HI 2CLZB 4BFEA 1H3GA 2DKUA 4MZ3A 3LQZA 4LRIC 1I8IB 2ITDA 1AXTL 4O9HH 3S37X 4NBZB 3M8OH 1NGXA 2ORBL 4M8QA 1CR9L 3MODL 2Z93A 2CSPA 4XXDA 3RWGA 4CVZB 1CGSH 1D6VH 2X4TA 4K8RL 4I9WD 2C4XA 1ZHNB 3MOAL 3RNQB 4K94C 5EUOA 3HS0B 1IKFL 2IPTH 2CRZA 3ZMRA 5IM7A 1J8HB 1MJ7L 3V6FB 3VXSD 3DUSA 1ZK9A 5MP6H 3CAFA 4OIAA 5A2IH 4K71B 3BQUC 1MEXL 2ZUVA 3QUXD 1NCDL 1K2DA 4ZMAT 2YUXA 1BVKB 1JRHH 5I1KL 4YQXH 4DN3L 3T0BA 2N7AA 1VACB 4G6JH 2AI0H 3VWJA 1I85A 2DB8A 2OL3L 5ICXB 3OZ9H 4PJ8A 1G9NH 4OGAD 3MLYL 2IFFL 2VAAA 4Y8DC 5KW9H 2HH0H 1DVFD 2I24N 1GHFL 1CT8A 1J11A 1KPRA 3MMEA 4XTRD 5F7UA 4GUPA 4FQQA 5EU6A 2DL9A 3D6GA 1HQRA 1MREH 4PG2A 1JIBA 1PDKA 1KEML 1CQYA 5A2JH 2LU4A 1F97A 3E2HB 3FHAA 3L1OL 2AKRB 3WHE0 3JSSA 3QDGE 4AIXA 3BW9A 4POZD 2MFNA 1NBYB 2APTA 4WJ5B 4O58L 2CKBH 5FM5O 1LP9F 2AJXH 1L0YA 1E27B 1SMOA 1NMAH 1ZT7A 4QY8A 1GZQA 1OB1A 1AGFA 1H3XA 2HJLB 1U8LA 5ETUB 3NABL 5D7IA 4MAUL 4BZ1H 5DHYA 4C56A 3V8OA 2C1OB 1G7HB 3B8SA 1R0AH 5EBGA 1RIVL 2R2CA 2WUCL 3ROOB 4U1KA 3ARGA 4G8GE 2D03L 4NZRL 4KKAC 3OAYH 1HWGB 3FMGH 3GSNL 3QCUH 1QSEB 4N0CC 4WV1A 4UINL 5ACLA 1JK8B 1FFRA 5FIEA 3EYQD 2W91A 3TF7C 3SDXA 4MD0B 2O5ZH 5EC2A 4O5LH 1FZKB 3DVFA 1YZZA 3MYJB 4O2EA 4HD9A 1KJMB 4FZEH 4P46B 4R97B 4LFHD 2E6JA 4JPVH 2LVEA 3C9NB 5I17B 3EYSL 3PHOA 4J3UA 4IEFB 2P5EE 3I85A 4CMHB 3VI4E 4TSBL 4P48A 4PJIF 3PNWB 4FTVB 3RKDC 3P4OB 1NCCH 4WHCA 3QWQB 1QA9B 3LS5H 2FJGB 1EEZA 3MRLB 4R96B 2AJ3B 1ND0A 2FR4A 2RIKA 4L29B 4FHBD 2B1AH 2XYCA 5HHOE 4KI5C 4IS6A 3GMNB 1L0QA 5DFVC 3C2AL 1LO3L 3BN3B 1RURL 3FT4A 2VWEE 1WQVT 4LU5L 3O4OB 3QEHA 4U0RC 2BVQB 4NQEA 1EUTA 4MCZA 1GC1C 4Z76B 5BV7C 2Q3AA 1OAYH 4MQ7B 1YY9D 4PRIA 3VFNA 1JZ8A 3ULUL 5I8KH 1DZBA 1X5LA 3W39B 2YN5A 5EPMB 5JNYA 2VDNH 3H7LA 3WHXB 5E7FA 3AM8A 4OLUH 1AO7A 1K4DA 2O5XH 4P2QE 4OCLC 2R4RH 4Q2ZA 5FV1L 1MUJB 2VXTH 4NN6B 4W70A 3VFVB 3S88L 5JW4Q 3LH2L 3I6GB 3HE6A 2YPLB 2F15A 4AM0B 5DMGD 3VFSA 4JANB 4M5ZH 5F7EL 3ARFB 1S9VA 3NFNA 3PWNB 3U82B 4LAQH 5F7DB 1FHGA 3B9EA 5DYOA 1LO2H 1XR8A 2F58L 3NCBB 5GZND 1QACA 2PYEE 5MHSE 3NZHL 1XGRB 3MGAA 5FOBA 3ARBB 2F54A 1HHJB 4EDXA 2PUQT 1C5CH 5DMIH 2DMKA 4NM4H 4ETYA 4PG9A 3P0VH 5EU6E 3IAPA 5LAXB 5E8PB 1RUML 4KGJA 4I18C 1N4XL 1G9EA 2D9QB 2WQ8A 3NTCH 4L5FH 4HF5L 1TZGH 2MNUA 3OKKA 3HMXL 6FABL 4HS8H 4JB9H 2F5AH 4WI9A 2BOCA 3DX7A 5MEQB 4PV9B 3IFPA 1RUAL 4RQQB 4I5BA 5C92A 5HI4C 1G7LA 1KV3A 5C0IA 1TJIH 4OLEA 3VXSA 2VLJD 1INEH 5E2WH 2B5IB 4U1JB 3TV3H 3MA7B 3R1GH 3QUXA 4C56E 5MEOB 5JLZA 3B8YA 3NIFF 5TJWK 4KPHL 4CL7A 5LWYL 3RVTC 2BDNL 2CXGA 2I60H 2MWCA 4WHTA 3V79C 3JWOL 3L3IB 4KZDL 2JJSC 5ICYA 5D96B 1IGML 1JPGB 1EO7A 2NX5D 4G80A 4EDWL 3ROLB 1A4KA 4FFVD 5GS1C 5D1XD 4HS3A 4ACPA 4Y19B 2AQ3A 1DVFA 2JB6B 4E41B 5IJKA 5L7XH 1F4WH 5DRNB 3C5ZB 5B3JF 1CDIA 4RISL 3QNYA 5ITFB 3ZE2F 4EOWL 1BD2D 2Q8AL 2NW3B 3MJ9L 2R56L 2NY2C 3WJLC 3DRTB 3GJEA 5D2NC 4U3XA 3RGVC 2UUDH 4GS7C 4JM2D 2KZWA 5B4MD 4IJ3B 3G5ZB 4Q9RH 1R3IH 4OB5H 1FNGB 4Z7WA 3MV11 4ELMF 3V4PL 4JFEB 5IMOB 4I2XA 4I13B 3MJ6A 3T3PE 3SPVA 4HCRH 5I19H 1JZ3A 1VGKA 3QUYD 5C0GA 2C3GA 3QIWB 1CDHA 3L3GB 1M05A 1S7XA 5IBUG 2CKNA 1P4LA 1V7MH 2R2BB 3AGVA 1FPTH 1QNZL 1JGDB 3PV7A 2X10A 1OSPL 5JA9A 3IETB 4NNYA 3ETBF 3CSYA 4OCRL 1JVKA 5EU7C 1K85A 3L7EA 4XPBH 5E95B 2FO4B 3BH9A 5BJTA 1V3JA 2IGFL 3RTQC 4Z7OE 2VUOA 5E8OB 1JGVL 4ZOCA 2J5LC 4X83A 4PRIE 2JB5H 4PJFA 4LPUA 3KXFE 1LP9B 1AD0A 2YBRB 2MMXA 4X6DE 2IAMD 5HHPA 3G6AA 5TH2A 4LLYA 1HI6A 5I74B 3BJLA 5J0BA 2MQ3A 3U4EB 4LEXH 2IANB 4MA1B 4RBPH 4NQSB 4LF3A 4WW2A 2P8LA 2R9HC 1Y18B 2GKIA 1PEZA 2CDEA 3FQWA 4MGXA 2D3VA 3VRJA 3FO2B 1W8NA 4JKKA 5T1DH 4PRHD 3BESR 5ESVB 5E8EA 4YXHH 3S7GA 1BIIB 1NDMA 3BGFC 3MXWL 3BPCA 1LDSA 5CZVH 3SQBA 2UY6A 3QZWG 4Z18A 2OI9B 4M7LH 4YHIB 5IROA 4JN2A 4F37K 2XQYK 4MXQC 3RDTD 3JWDC 2V17L 3RPKA 3RVVC 4PYHA 2R4SL 1ACYH 3ARVA 4MJ6B 3CFEA 4OZ4A 2OXHA 1B6UA 1IC1A 1H3WM 1HEZA 1D5BA 3GSWA 4K3DH 4X7CC 3QUZB 5C71A 1W0WB 1FZOA 4OF6A 2WUBL 4X8JA 4HJGB 3D85D 4O2FB 2ADJA 1P7KB 2AABL 5F6IB 1P69B 1E4WH 3VFMA 3TVMD 3TO2B 4OLVH 4NOBA 1MHEB 2AJUH 2X6MA 1LQSR 3KPRE 3LKPB 3PV6B 4JJ5B 2XKSA 5ITBL 3PDGA 5SWQB 4TQEL 3RVWD 5ICZA 2QHLA 1AQKL 1IC4H 5DEGA 1GPOH 4L8BB 5T5NG 2BVPA 2BVOA 3WJJA 2DQGH 3S8WA 1CE6B 4KXZI 3H0TA 3ZKNC 1AY1L 3MJ8B 1GGIL 3ULVH 2JJWA 2GITA 3D9AH 1HHKA 4MWFA 3VI4F 4DFHA 4DFIA 3HAEB 3V5DA 3NFPB 1H3TA 1SMAA 5ID0A 3QJHB 1DQLH 4JQIH 4F7CB 4R0LC 3ARUA 1HSBA 1U0QA 3MV9D 3TEUA 3PDOA 5JW4N 3QG6A 2NY3D 1BQSA 3QAZC 4KV5E 1YUHB 4F9LA 2W65B 1QSFE 4ZODA 1II4E 4XVJH 4CVXA 2LU3A 1TTGA 3MNVB 3GKWH 2VC2H 2PR4L 2X4UB 1C7TA 1HIML 2G5RA 4Q6IB 4X4ME 4JO4L 5SWZB 4JFOB 2FECI 1TQCC 4GRWH 1YEHH 3E1F1 4G7YH 4OKVB 5BOZG 4ZO9A 2VLJA 1CXEA 2RR3A 1XR9B 4ZXBC 5IV2B 5I1LA 3U4AA 4KTDH 3JV6A 1FZMA 4L3CA 2LE9A 1H5BB 1OL0A 2QADC 4KZEL 5IVOA 2G5BB 4M7LT 4ZO7A 4AEIL 1C5BH 3L7FA 1FYTB 5BV7L 1GC1L 5GGQL 1F3RB 2NX5A 3LD8B 2Q7YB 5D1XA 3VFPA 1E28A 1UACH 1WFOA 2YD5A 4LKCA 4NNXA 2EO1A 5BVJB 5JXAH 5GRJL 2G2RA 3L5IA 4Z95H 5DD0L 5JIPA 5D7JB 3VWKC 3OKLB 4U6HB 1BD2A 1T1ZB 2R8SH 4TUKH 1FFOA 2VXSH 2XOTA 5HVWA 4L8DB 5AUMA 1YEDB 1U3HC 3HPJB 3PWLA 1U8HA 4G5ZL 2CJUL 1I9IL 4R4NC 1CF8L 1R3HB 2W0KA 3CFJA 4H8WL 5LQBL 4JM2A 1B3JA 5T5FH 1N5YH 5H94B 4QRPD 4YZFE 1FVDA 4NPYB 5CEZD 1MQKH 4ZSOB 2MHAB 3EBAA 1KJVA 1G0YR 3QUYA 1RULH 3WE6B 3SE9H 3WKMH 3WL9A 1MCWW 4DKFH 5KJRH 3PP3H 2VXQH 1DBBH 3P30L 4TRPH 1KELH 4Y2DC 5DVOA 4AG4H 1G6RB 4M1GH 3HFML 2CKBB 5C2BH 3HI6H 4C83A 2XKUA 3LRHA 1MFAH 3WFHA 1JNNL 4RGMB 1JBJA 1RZGB 3UYRH 3RL1A 3KHOA 1FDLH 2NZ9C 3RY6A 4BSJA 4D9LL 4PRBB 5E7BA 5IF0A 1N2RB 5K59F 1BX2A 1CFSB 1I1YA 3NA9L 4H25B 1T4KB 4WNQA 1AGEA 3HRPA 4R90L 5EO1A 3TP4A 2IAMA 3QISA 2O61A 2Y72A 1Z3GH 3LN5B 3HE7D 1ES0B 1NGWA 4DK3A 3FQXB 4X4XA 2W9EL 4LKXA 4LGPB 5BXFB 2Q3ZA 3DX6A 5I1DA 1YYMH 4NN5C 4FFZH 1PG7H 3VXOA 3CK0H 1EJOH 1EMTH 3W81A 3PQYD 3RWJB 3F6IA 4IRSB 3RDTA 4U6TA 4WIQA 5MEPA 2AV7A 4U6VL 1KNOA 3OGOE 3BZ4A 1FAIL 1FN4B 3QCTH 3S3PA 3CX5K 2AK4D 3ES6A 4EVNA 4CU6A 4K7PY 5BZDA 3D85A 2VDLH 4D9RE 1QFWL 2FRGP 2FO1A 5EZLB 4NRXA 4QLRA 3TVMA 2OR8A 1EO5A 2I9LB 4DKAA 4JREC 1WCBA 2EDWA 4GMTL 4FQ2H 4OD1L 4F3FA 5C70A 1U8NA 1UJTA 2KQNA 2P48B 3BEWB 4N0YH 3H42H 4NWUL 3T65B 4ZOAA 2JCCA 5IB1B 3ULVF 1QSZA 2PYFA 3GSQB 4RMRA 4OAWB 5GGTH 3WIIH 5D5ME 1AXSB 1EJ6A 4Z7OF 1T80A 4M6NL 3NN8A 3SHSA 3QDGB 4PP1D 1QKZH 2NX5E 3RAJH 1TXKA 5DHVH 4X6DF 3BD5A 3PXHA 5DJDA 1ZHLB 1INDH 4JPKH 2AGJL 1KN4L 3MLXL 4J8RB 3GJFH 4JLRA 3OKNA 4J1UB 5I1IL 1BD2E 4GRWF 4Q0XH 3EYOA 3MV9A 3HB3C 2Q7NA 3OQ3B 5TDNB 4NWTH 1MJUL 5GGSY 2HJFB 4KROB 1DP0A 5CHNA 3MFGB 3RVUC 2X4NB 3IF1B 4LASH 5E1AA 5T3XL 4F80A 2ZPKL 4H26B 4RIRB 4YUEL 3GSOA 5F6HJ 4FFWD 1M7DA 2ZNXA 4MHHI 3U36B 1A4JA 3LIZH 1RJZB 3I84A 1G84A 2IBGA 1IGTA 5I76B 4F9PA 2VLMD 3MFFA 1OAQL 5EU3A 5L2JA 5FYKH 1UKQA 4IHOA 5GS2H 2NY0B 3A67H 1PEWA 4JZJC 4B5EA 4NC1C 3BHBB 1J5OL 1B4RA 3MRCB 4JDZA 1SM3H 3FQUB 3V4UH 2P5EB 4YGVA 2OLDA 1ZVHA 4P9MH 1YEJL 1MHCB 3C5JB 1D9KD 2OZ4H 4RFNC 3VD7A 3M1BB 3LHPL 1KJ2H 2ZSVA 4R4BB 3GIZH 2J88L 5DJ8A 1EHNA 2GW5A 3LKQA 1OF2A 2A6KA 3BPOB 5J13C 5DS8B 4P2YA 2RCSH 3UC0H 4WFFD 3H6JA 5HHOB 3S35L 1FJ1A 2HFFA 3RWFA 4OQ1A 1YN7A 3H8NA 4MD4B 1LK2A 1MRDL 3BE1H 1XAUA 5AWNH 1DEDA 4UBDD 4RNRB 4QRPA 3B9DA 3KLDA 1FE8H 4PJCA 1OTSC 2YUZA 3BZFA 3DETC 4JRYD 1MAJA 3OV6A 4PRHE 2BSSA 1NGXB 4M8QB 1OGTB 2HVKB 1N6QH 2Z93B 4C54A 1BQHB 2EH7L 4KV5F 3RIFF 5IMLB 1FV1A 3LEVL 4G42A 3A6BH 5A40E 1DQMH 4KHTH 4Y4FB 3SEPA 2VXVH 4JQXA 3FOMA 4YWGH 2ATKB 5IHUH 2DQHL 3MQIA 5FA4A 1QR4A 3N1FC 3DUSB 4XCNA 3JZ7A 4P2QB 3VFGH 1YEEL 1M4KA 4LCUA 3WO3B 3TCLB 1K2DB 5CWSA 1HCVA 1TZIA 3WIHH 4GG6F 4NCC2 2ADFL 3RUGA 1SEQH 3U7YH 2FX9L 5H37G 3KPLA 3U9UA 2BSED 5D1ZC 3MLSL 4ERSL 5L2KA 4A2LA 2UY7A 5K9JL 4GXVL 1FNSH 2PYEB 4K3HA 2VAAB 1FFNB 3DMMB 3HE7A 2H2SC 2RQ8A 3CXHJ 3E8UL 1KPRB 1GGUA 1XCTA 1U3ZA 3MMEB 1U58A 4WENB 4GUPB 5EU6B 3TT1H 3O2VH 2R1WA 5HYSB 1JNJA 4TULL 4XVUC 4P3DB 3GHBL 1K5NA 5ELIA 5D7LD 3Q3GA 3BXNB 2VDMH 4AENA 4RDQF 1CIDA 1OD7A 1F42A 3MV8D 3PQYA 3T4AA 4P2OC 1ZT7B 4QTIL 3K2UL 4QCIB 3EDKA 5SX5K 1XF5A 4BH7B 1Q8MA 4PB0L 3WFCH 1U8LB 1Q9KA 3UJIL 4NJAH 1ED3A 2NY4C 4YZFF 2AK4A 4PB9L 4H1LG 4YXKH 5DQDH 3RVXC 4AH2A 3HHRB 4BZYA 1DQJA 1HKLL 4DVRL 3VXQA 4QHUB 1AIFB 4ZS6D 1A8JH 3STLB 2NW2A 5F21B 1L9NA 5HYJD 4PP2A 4QHLB 3AS3A 5FYLD 1GOGA 4J3SA 1W0YT 4AIOA 4O2CB 5IVXF 5EC2B 1JYXA 2EZ0C 2VRAA 1X6LA 3QNZA 1A02N 1LEGB 2MJWA 3O3BA 5J1SC 4O2EB 2CIKA 5FO8A 4KUCD 1OTTD 1JCKA 1C08A 3V52H 2WWKO 5FDWA 1N3NA 5EOTA 3DWTA 3U9PL 3F7YA 1W72A 4PYGA 1MVUB 1ZT1A 1IC7L 1CD9B 3MRMB 3PL6B 4F58H 4G6AC 4HGWB 4UQ3A 4XCCH 1R3JA 3CH1A 4CJ1A 2YPVH 5AZ2L 2EDJA 4KKCC 4PJ7A 1OT1A 3VGFA 2DBJA 4KAQL 4NBXB 3JV5A 4XBPA 5IW6A 5FHBH 4YHLL 4LSQH 2D7MA 2I26N 2ARJA 3MRDA 1HHIA 4MX7A 5GZOD 3P4MB 2F74A 3PUCA 3MCLH 4ESKA 2YRLA 3Q6GH 4OD3H 4MA3A 1CGTA 2GJJA 3C08H 2DLGA 4HLJA 4QXWA 1MCPH 3LKRB 3VE0A 1Z2KA 5I9QC 2Z31D 4K23H 1RUQH 1OSZB 3QO1B 1QFWM 3IU3A 3IVKB 1U95A 5DD3L 5E70A 2PKDA 1A6WL 4UIKL 1HQ4B 4OFVA 4F8QA 4ONFL 4TOYL 2SEBA 3SKJL 5C0JA 1AGDB 1Z9LA 3QNXA 3TIDB 3INUH 4M6ML 4KRLB 1T20B 1HE7A 2OBGA 3L95A 4ZDHB 3FFCD 4J3OC 4PRIB 4CADA 1OW0A 4MAYD 5J12C 1NAMA 4U7KA 4RWYH 3KXFB 3QSKB 4XGZB 4X6DB 5FHAL 5DEFA 3V0VB 5DGQA 4K8RD 4FQCL 3HR5A 5E9DD 4RFOL 4Q2ZB 1D9KA 2VLKD 5CINL 1ODAA 2IQ9H 1NLBL 4HEPG 4JO1L 1WLHA 5F7YC 4GG8A 4U6XA 3MGOA 3RUGE 3BH8A 2PN5A 4Y16C 3CFKB 5DUML 3I3DA 4ZUUB 4X4YA 1S9VB 5B39B 4PV8B 5D5MF 5GGUA 5L9DL 1OCWL 3SCMB 4V1DD 1GGCH 1XR8B 4UV4H 4PJDA 3X3GL 5HGAA 3QZWA 1A6PA 3ME0A 4EDXB 4G9DA 3M45A 4JHAH 1HDMA 3MCKB 2IPUK 4PG9B 2XWBA 4X7EC 3UJJH 2A6DA 2P8PA 4JRYA 4PTUA 5J4MA 1A1MA 2P5WD 1J8KA 5INCB 1ZLSH 3ET9F 4HC1H 4LQFH 1E0OB 4FQXB 3FCTA 4K3JH 4YK4C 2XQYG 3E0GA 2BOCB 3PQYE 3DX7B 5IK3A 2AXFB 2HLAB 4KJPD 5T3ZH 3UO1H 4K7PH 3D0LB 3KPRB 2EYRB 2V5YA 1CS6A 1MCQA 5C0IB 4KJWC 3C09B 3DV4A 4WCYL 3IFNH 1BLNB 2AK4E 2DQTL 2DTML 4B41A 5ALBL 5JLZB 3I50L 5CLTA 3DECA 4WFGD 5IQ9A 1EEUA 1VFOA 2GK2A 4NO2B 3L9RB 1KLUA 1MAKA 4QHMB 4UT7L 2R29L 2E9WA 3O8XD 3KJ6H 2VQTA 2EDRA 1KT2B 1VGEH 4F33B 9CGTA 4M62H 3GHEL 4LVOC 3ZTNH 2NY6C 2CDGA 4CU7A 3TBSB 1CDUA 1OPGL 2XTJD 1QFOA 3L5WA 3BO8A 3MRQB 4G3YH 5D7LA 4KH2A 4QRUA 1QSFB 1ZANL 4R2GD 3MV8A 4P9HL 4NDMB 3HC4H 3W0WD 3VH8G 4DW2H 5DUPL 2MTPA 2C4FT 5B38B 1IZKA 1UM5L 2YR3A 4GXUN 1PAMA 3LZFL 4N5ED 4PJ7E 3MLWL 2JELL 4HWNA 5B8CB 4JZOB 4AJ0A 5DJCA 3PGDA 5C07D 1V3MA 4NP4L 5FM8A 1RZ8A 3S4SB 1KIQA 3ZL4L 2P7TA 2X9YA 5J11B 5GRVL 5DT1H 1K8DA 1NFDF 5KG9B 2R1XA 3ILQD 2NY1B 4MA8L 4XCFL 1MCNA 5HYJA 4D8PA 3EIFA 4TNWF 1YY8B 1NBVL 3KPQA 4NNYB 3HZMA 3U7WH 3BKCL 1KXVC 1HXYB 3CSYB 2VLME 4LCCA 3BH9B 1B0RB 3B9KD 3TBYA 3JUZA 2Q87A 4U1GC 4QRRB 4EXPX 1OQXA 3IXAA 3GK8H 5FKPA 4YBLB 1CICB 2Y07H 3STZA 1EFXD 4L9LC 2OTUA 1MHPH 4OZFG 4LLYB 3SGJC 4GRMB 2I9TA 5C0DB 3ULUD 4R4FL 2EO9A 1EGJA 1BP3B 3G5YA 4QGYA 1QO3A 4TTDD 3FQWB 1VB9A 1JYWA 4P59L 5CSZA 3ZKSD 5JQ6H 1Z5LB 1T83A 3E6HA 3DLQR 1FORL 5F7NC 4DN4H 2EKJA 4WFFE 5DQJB 5LBSL 2XFXB 4KK8D 1MFEL 1KN2L 1VCAA 3ZTJG 5LGJA 4OJFL 4LDOB 5DDHA 2XWJA 3QUKA 3SBWA 2B0SH 4JY6B 4S1RH 2Z31A 4FNLL 3CFEB 3QUMH 4UDUB 4Y1AD 2VSCA 5D9SB 4LSUL 5DHVB 4QF1A 1D5BB 1U8IA 4JRYE 3GSWB 4LLQB 3TN0D 4PJGF 4XAKD 1EEYA 1IILE 4U1HB 3GJFB 2WWKT 3FFCA 3UTZB 5ACZA 4MAYA 1JPTL 3P73A 4Y4KD 5DR5H 1DEEA 3O0RL 5ENWB 5E5UB 5BQ7B 4D3CH 3KPMA 5ERWA 5IB2B 3EDEA 1E4JA 1J0HA 3P0YL 4JFPB 5E9DA 5IJVA 3L3HA 2VLKA 2NXZC 4DCQA 1I7UB 3D87B 5DJ0B 2FL5A 1UZ8B 1A6UL 1T1XA 2H26A 3FQNA 3IKCB 3AUVA 1UGNA 3VMPA 2W92A 4XWGH 4GRLD 3IXTB 2M2DA 4NRZB 1I9RH 4XP6L 4V1DA 4QNPE 3K3QA 3MLTA 1U6AL 4JY5H 4TUJB 2HG5B 1HHKB 2O5YH 5FYJU 1BJ8A 2FIKA 1FVEB 3A6CH 3GMMA 3V5DB 1UKTA 1V3KA 4PD4J 4A6YH 3HZYA 1JGUL 1HHHA 1T04B 2OL3A 4QWWC 4OFPA 4KRPB 3UXFA 4U31A 3VGHA 5ESAB 3HLAB 3BYYA 2ADGA 3MSPA 3S5LB 1R3KA 4NT6A 5C3LD 1LO0L 2C3VB 5JDSA 2DBLH 5F3BB 2P5WA 1Q9LA 4HV8A 4XNXL 5D7LE 1KJ2B 4RFEA 1ZHKB 2L7JA 2QKIB 2A6JB 4LPTA 4CNIB 5I1GL 5HGHA 4OZGE 4X6CE 5F1NA 2DM7A 3QPXH 1RHHA 3ARRA 5TQ2L 1CLYL 4DUWA 1ZMYA 1NAKL 1F4YL 1JNLH 1S3KH 1I1FB 3JV6B 1FZMB 4JFFD 1B0GA 4NQXB 3THML 4F15C 5D5MB 4LBEB 5JW5A 5CEXB 4BQBA 4XB7A 1DE4B 3T0AA 5D4QA 2YK1L 2VZVA 4GMSL 1IJ9A 3O8XA 5KS9A 3QIUD 1O7VA 3QI9B 4Z0BH 3V0WH 4NC0B 4X6FB 5MEND 1A6ZA 3HNVH 4PY7A 1EAPB 4M61B 1IM9B 3HRZB 3MLRH 4LKCB 2ZKHH 1LO4H 3GSNA 1NFIA 4J23A 4PJXE 2GSGB 5GGRY 4RAUB 3MUHL 4PJAF 1UJ3B 2GCYB 1HOCA 4QHNB 4NQVA 3SJVB 3O2WH 3ARED 4LPXA 1WWAX 5FUCC 3W0WA 3G6JA 3W82A 4S0TD 3BQUD 2VN7A 4WHYH 4EUPG 1H0DB 3VGEA 2X41A 4ONHA 1FVDB 5FYKU 3T0EC 4O9HL 4LNRA 3M8OL 1FNHA 2OX5A 5C07A 2ZSWA 3QUYB 5GIRA 1ZVSA 4M6OH 1CGSL 1NCBL 3UAJC 1D6VL 3QXVA 3BKMH 5JUEH 1ADQH 3DHJA 4IMKA 1WBYB 5HD8D 4P23C 1I1CA 4NOFA 2IPTL 2E9BA 5GS0H 1FGNL 3RL2B 5MP6L 1RK0A 4C83B 4DKDC 4N9OB 1JRHL 3B9KA 1QRND 1T2XA 2WP3O 3RL1B 3FTGB 4G6JL 3OXRB 3Q5OA 2AI0L 4Y4HD 3O11B 5HY9A 3WIFA 3OZ9L 4U7MA 2VOTA 4JFXA 1EFXA 3QQ3B 1G9NL 2IAMB 3NAAH 2FGWH 5KW9L 4I0PC 5EO9B 2HH0L 3OAYK 4CDHA 2EH8H 5DVNA 5E9DE 1M71A 1DLFH 3N50A 4YDKH 2Z8VC 5D6CA 4OFYD 3RIAF 1WFUA 1PZ5B 1MREL 2AV1A 5B21A 2VH5H 4PRHB 4KKAD 3GMRA 4MJID 4QT5A 4OIIH 3QDJE 3VXOB 1UXSA 1NFDB 1T22A 43CAA 3BEVA 2AJXL 1KPUA 1P6FA 4LVHB 5HHMB 1NMAL 1JN6A 2FX7H 1KNOB 4Y1AA 5D6DA 4G8IA 1G1CA 5DWUH 3TN0A 3ZYOA 2CLVA 3F7VB 4BZ1L 5CJOH 1RZFH 2YRPA 4HFUH 4LL9A 3T2QA 5I1AB 3NPSB 3T3ME 2VISA 4BSVA 1YEIH 4IOFC 3GMOB 5GHWH 3W9EA 3FMGL 3TVMB 5BCAA 2R23A 4Y4KA 3SE4A 1FFPB 1QD0A 3Q1SH 3L5JA 1ZXQA 3KR3H 3P4NB 3FAXA 5L0QB 1H3VA 1JWUA 3HMXA 2O5ZL 2R69H 2YXFA 2YSSA 5F9WB 4B53A 3HA0A 4LARH 4O5LL 5KSAC 2D2OA 5F9JA 3K1KC 4XVSH 4PGEA 1UWXH 2GJZA 4FZEL 3ULVC 4V2BA 1X7QB 5JTWA 2DMCA 1BJ1H 2XIDA 4OCSL 4WFGE 1EZVY 4GRLA 1SEBA 4JPVL 3GUTA 4RGNE 1KTRL 1IVLA 5KS9E 3SKMA 2BSTB 1NCCL 5J3HC 2ICCA 5CIPA 2A6IA 5M94B 3LS5L 5HDQH 2UVFA 5IT2H 3RFZC 1RPQA 4AL8H 4NFCA 1VEPA 4F8TA 4FABH 3CXHK 2B1AL 1TMCB 2AXGB 3MRRB 4H1LA 5CHNB 1I4FA 3SDAC 3PWVA 1WWCA 3GSOB 2VN4A 3MJ9A 1M7DB 3WCYA 4BFBD 1A4JB 5I1CH 2C7UB 1IAOB 1PFCA 5DFWH 3SY0A 3T04D 1AC0A 2PW1A 5AG8A 4HIXH 2QQQA 2HN7B 3X13B 4JFFA 1MEXH 4WU7A 1OT2A 1NCDH 1OAYL 4E42A 4IHOB 2VLRD 1JPFB 1MCFA 4PRPD 3PGCA 4PBXA 5I8KL 5CCKH 2IADA 8CGTA 3HCVA 1A9BA 4F7PB 2VITA 1PQZB 4ALAH 1NMBH 2VDNL 3QIUA 1NGZA 4OLUL 5MENA 4EN3C 2EICA 2O5XL 4X99A 5E4EC 2R4RL 1YC7A 2VXTL 7FABH 1KTLA 3VXNA 4OD2A 3W11D 3CDCA 1P4BH 5LG1A 4Z5RB 5DJ8B 1OAUL 2GFBA 1NGYB 3H9HB 4JCMA 4M5ZL 1OF2B 3VJ6B 3VXTB 4LAQL 1LO2L 3KNBA 3EFFB 4CRPA 5T5NF 3AREA 2HFFB 4H88H 3KLHC 1BVLB 4QNPF 2ZUUA 1C5CL 5DMIL 3BQUA 3ULUE 2YD1A 4OLYH 4NM4L 3P0VL 3DX8A 1MFDH 1YECH 5CAYB 5GJSH 4PRNB 5KSBA 4A2MA 3DO7A 4MJ5B 3BZFB 3FAWA 5C09D 1H8NA 1NMCB 3NTCL 4L5FL 3AS2A 1TZGL 5HGDA 4GBXC 1IAIL 1BFSA 4HS8L 4JB9L 2F5AL 3L3KB 1S78C 1U93B 3OB0H 4EI5C 1WUNT 4R26L 3D5OF 1LEKB 4OZGF 2B20A 3FOMB 5ANMA 1X4YA 3SE3A 4X6CF 1FNEB 1TJIL 4Y1AE 3BPNC 4ORZC 2UUDK 1INEL 5E2WL 3TV3L 3R1GL 1I7RA 2D7OA 5GGSB 4APQB 4XAKE 4QRTA 1QRNA 2NY2D 3TT3H 4X5XB 3PE9A 4YFEA 2I60L 1K8IA 2QLVB 4Y4HA 4M43H 4P5TB 3KPLB 3BGMA 4WEMB 5GRUH 3QRFM 3I3BA 4TSBH 4JPIB 1DL7H 2XY1A 4KK9D 4KJQC 3HE7B 3CPLB 1AE6H 3E6FB 4FA8A 5L7XL 3TJEH 5D71H 4OFYA 1WITA 3WDHA 1U58B 4L3ED 4HLZG 3TFKD 3D39D 1MLCB 2IPKA 4PJXF 2W9LA 3PHQB 1JWMB 2NTFA 3O9WB 3H9SD 3JV4A 1K5NB 4CN1A 2VIRA 2BY2A 3BMVA 4MJIA 1T0MB 2DICA 2X4RB 4QOKE 3WUWG 2VDKH 4BM7A 5DLMH 3UBXG 3PQYB 3HC0A 2H9GB 1HH9A 2FHBA 3LKOB 5JW3H 4Q9RL 1R3IL 1A6VH 4OB5L 2DWEA 3I75A 4OZHE 2X40A 1CBVH 3BP6B 4N68A 1H3PH 2H32A 3CDGA 1FZJB 2AK4B 4HCRL 4ZYKB 2Y7QA 5I19L 5CILH 1Q9WB 3UTTD 5CFHA 4M7ZB 1A3QA 3JTTA 1T7VA 1EHXA 2WZPD 1WTGT 2FZ3A 5KTEH 1FPTL 3QXAB 5LKNA 2V9TA 1GYAA 1S7VB 2KH2B 3IRZA 2AAVA 1KCKA 2NW2B 2OK0H 5AEAA 1JWSA 1EHLH 3HMWH 1V7NH 4GKZB 1CCZA 1KCRL 5EU4B 3C6LC 5T3XD 1PSKH 4IIQA 3QNZB 4EEEA 3BMWA 4JFFE 1BAFH 4DEPB 1UVQA 3KYMB 3LH2H 3ZO0A 1MRCH 3VGAC 4KKNA 2JB5L 1N3NB 5J9PA 5L8LB 2PTVA 4MXQD 1UXWA 5CBEA 3QH3A 4HGMA 5FXCH 3DTXB 5MENE 4LEXL 1R3JB 1IQWH 4HHAB 3KDMA 5CKAA 1F4AA 3EGSB 4PJ7B 3VH8A 2GTWB 2ERJC 4ISVA 5IW6B 5T1DL 3AXLA 2ARJB 3MRDB 4YXHL 4MX7B 3B2UC 1UEYA 3GDBA 4MA3B 4M7LL 5DO2D 1JE6A 1IKNA 4GKSA 3UTSD 1XF1A 2A74B 3C6SB 5IBUB 1ACYL 2QSTA 1J0IA 4XI5C 1VKXB 5KSBE 3Q2CA 1A5FL 2WW8A 4CMHC 4K3DL 1XFPA 4ODUA 4UU9A 3OG6B 1U8JA 2WBJB 2UZYB 3PWUB 4FQLH 4MZ2A 3QNXB 4D0DA 1INQB 3LVEA 1P2CA 3MOBH 3LPGA 4PRPA 4ZAKC 3VFUB 3T3MF 1LHZA 3VG0H 4CADB 1E4WL 1NUGA 2R1YB 4KZDH 2EDOA 2HKFH 4Z0XB 3EOBA 5HJ3B 3V4VH 5F3HA 2GHWB 4XCEA 3MR9A 3HR5B 1JFQH 4NSKB 1D9KB 5L88H 3VFRA 4OZFA 1IC4L 3KPSE 4JEGB 4GG8B 1GPOL 2DTSA 4RISH 1I3UA 2EDLA 2W0FA 1ZVYA 2DQGL 2XXMB 4PS4H 3ZDZE 3TO4C 3HI5L 1EVTC 5J1AA 2R56H 1RV6X 3ULVL 3D9AL 3G6DH 1LE9B 1MWAB 4G9DB 1H8SA 1OP5H 3CFBB 4JQIL 1TNMA 2ED7A 1J12A 1JPSH 2A6DB 5FK9B 2P8PB 4PTUB 5C09A 2XA3A 3FHQA 3IDXH 3BRFA 1EVUA 4HAFA 1I7ZA 5D70H 1QLEH 4GXUM 3AY4C 2YD4A 3GKWL 2VC2L 3TCXA 1RZIA 5DD5L 4X4ZA 1EERB 1ERNA 1YEHL 4G7YL 5I6XB 5GS3A 5HHQA 2XICA 3VDBA 4K94H 3K0WA 4ORGA 3WMSA 4HT1H 1ZWIB 3DJ9A 1W8OA 3MZTA 4MS8D 1C5BL 3RBSA 1Y6KR 3BVNA 32C2A 1T3FB 4CDGC 4OGXH 1RHFA 1PY4A 2FYYB 5TE4H 4X9GA 4Y5YC 1AGCA 3PP3K 1UB6A 1CU4H 4ZUWA 1UACL 3PG2A 5JXAL 4L3EA 2F53E 3D39A 4TUOA 4TTGA 3LPWA 5FGSA 3VG9C 4KI5E 2P44B 4L1HA 4YIQB 2R8SL 3H9SA 4TUKL 2VXSL 3BO8B 5D7LB 3O45B 3AS0A 4U4BA 4DVBA 4OZGB 1TETH 4U3CA 5T5FL 4X6CB 1N5YL 5DMKB 3BD3A 3V6OC 5HDBE 5IEHB 3UPCA 3CDFA 1X5YA 1I1AC 3SGDI 5CS7A 3I2CH 3QXDA 4PD4K 3UTTA 1RZ8B 2P7TB 1RULL 3ELAT 3EJZC 3SE9L 3TBTB 3WKML 2HRPL 4JDVB 4XMKH 1DBKH 4LLMA 4DKFL 3AFLA 5KJRL 2VXQL 1DBBL 1OTUD 1S9KC 1QYGH 1QSED 4NO3B 4TRPL 1KELL 5EUKA 3MBXH 4ZS7L 2VMFA 2YC1A 4AG4L 1SJEB 4IM8A 2R0KH 1OLLA 5EDXA 1JPST 4M1GL 5C2BL 3G9AB 3HI6L 4W4OC 1MCOH 4BKLA 4M5YL 2Y5TA 1P7HL 1MFAL 2B8OT 3ULSA 4PJXB 4ODSL 2Z9TA 3OKDA 1U91A 3NBNA 2VLRE 3UYRL 4P46D 1FDLL 4M4PA 3UPRB 2E7CA 1WZLA 3C8HA 3L5HA 4D0CA 2OTUB 1RZJC 3MRJB 1Z3GL 2LTQC 3NCYP 2IH1B 4U1MB 3QIWC 4FTVD 4PJ9C 1TCRA 3D2UB 2ICEA 3I3EA 4KMQA 2PXYC 2FEEL 3G5YB 4QEGA 3R0NA 3UDWC 4WO4B 3D69A 3S3SA 5CSZB 1YYML 5HVHC 4X6EB 1EBPA 1ZT4B 4MNHA 3IYLW 3MBEB 3K81A 4EUPA 3E6HB 4FFZL 3TIEA 1DUZA 1PG7L 3VGBA 3CK0L 1WAAE 1WT5A 1EJOL 1EMTL 1MPAH 5LGJB 5JQHC 2HTLC 3UTSA 4LGRB 3BP5B 3MACH 4U6YB 4YC2C 1Q38A 4H0GA 1U3YA 2DLHA 4PJBE 2DQIH 3QCTL 4OZHF 5C0EA 5C09E 3W9DA 3SDDC 5DK0A 3GJFK 5EA0H 1DJSA 2X42A 2VDLL 5E6IB 1MY7A 4KTEH 4NQUA 4NUJB 5J6GA 1BMGA 1T89A 2Z92A 3CLEH 3EO9H 1CFNB 5JMRA 3STBA 4OM0L 4FQ2L 5EWIH 5DJZB 4N0YL 5GXBB 3H42L 2LV4A 2HT4D 4R0LA 3L3HB 5DA0B 5E9DB 5IJVB 1NGQH 4DCQB 3EHBC 3K2MC 1FCGA 1QP1A 5D2LE 5GGTL 3S34H 3WIIL 4DQOH 3QULA 4JGMA 4YHZH 5D2NE 3KLAB 1C1EH 1MCCA 2NLJA 1QKZL 3QDJB 4XP1H 3RAJL 5DTFA 2ZUTA 4XXCA 4XNUH 4CN4A 5JOPE 3ARBD 3I02A 3VXPA 4HUVA 3HZYB 2X05A 4NKOB 4JPKL 2QHRH 1IEAA 2CLZA 1AR2A 3CH8A 3D39E 1I8LC 2K3TA 1I8IA 4JAMB 4NT6B 4Q0XL 4NZDA 1TENA 3H9SE 1PBYA 2OM5A 4NWTL 4RFEB 1UENA 1B6DA 4HAGA 4CVZA 5HVGB 1QFWI 5HGHB 1KB9J 1ZHNA 3RNQA 3EAKA 1URLA 5IKCB 3HS0A 5EU7E 3LIZL 4PTTB 4N1EA 2X7LB 1A22B 3V6FA 4GOSA 2V5TA 3N1QC 4X7FC 2GTZB 2AS5M 5FYKL 3VW3L 1BVKA 1T66C 1VACA 3EW3B 4RGNB 1SM3L 3V4UL 2IH3B 4Z78A 3CCHB 2EIDA 4BA8A 5ICXA 4P9ML 5AYQA 3RNKB 3O8XB 1U8MB 5KS9B 3KJ4C 3A6OA 1OTSD 2D4DA 3GRWL 1A64A 2OZ4L 3DETD 4E41D 5IESH 5A16B 3GSNB 1KJ2L 2X1WL 3MNWB 5HHXH 3TBVB 1BFTA 3GIZL 1CXLA 3J7HA 4U3HA 4P4RB 1XT5A 1U8QB 5F93C 1J9CT 2NYYC 3ZYZA 4MB4A 3F7QA 5I0DA 2M1KA 2RCSL 4ZNEA 1HOCB 3UC0L 4NQVB 1NBYA 2FJFB 3BE1L 5AWNL 2GSIB 1E27A 1L9MA 1XGUB 4XBEH 1JHTA 4DKEH 1R3LB 4HKBB 2HJLA 4RZCB 3SKUD 2R15A 4JFED 5ETUA 3ZKQD 2WLYA 2ZSWB 3LD8C 4UILH 1N6QL 1DLHB 5GIRB 2C1OA 5D1ZD 3MCG1 7CGTA 3B6SB 3ROOA 1XGPB 1J0KA 1VADB 1A7NH 1ROWA 5DXWA 1DQML 5ADOH 4KHTL 1QSEA 3UTSE 2VXVL 2FHFA 5CSGA 5AAMA 3B5TA 4YWGL 1JK8A 4M9OA 5IHUL 3ZT6A 3VFGL 2ZP0T 2V7HA 4M7JH 4M1CC 1FZKA 4NC2B 3QPQD 4UTBH 3OXSB 3MYJA 3IS1X 1KJMA 2APXA 1AHWB 4P46A 1SEQL 5F96H 3U7YL 5JPMB 3C9NA 5I17A 1EDQA 3LN4B 4XNZB 1HHGB 1EV2E 1QFPA 4WFHD 4P2OD 4YDVB 1FNSL 4LLUB 1FO0H 4I3SL 4MVBD 5ILTH 1QFUH 3PNWA 3D0VB 1T0PB 4DAGH 1J0YA 4FTVA 1M71B 2IAND 4CMMB 2NY4D 4X9HA 5D6CB 2ZUSA 3RVXD 1QA9A 3TT1L 2FJGA 1OP3H 3O2VL 4MQXC 5C2UB 3MRLA 2DQUH 4R96A 2MSPA 2AJ3A 3V2AR 5I1IH 4KI5F 1PYWB 2EEDA 4AYFA 4QT5B 4G6FB 1EK3A 2VDML 5CJBA 3SKNB 3V6ZA 1MJUH 3DVIA 4G6KH 4FXKA 2VR5A 4X98A 1PGRB 4JDTH 4TNWK 4MJ2A 4LCWD 4LVEA 2EZ0D 1KPUB 5GGRB 1BPVA 2G75B 2BNQD 4Y1AB 3TJHD 3WFCL 2EDYA 5HDBF 4NJAL 2NXYC 4M93C 4G8IB 1BQHG 5IG7B 4YXKL 4XWOC 2AQ1A 5DQDL 1DDHB 3JWDH 1MCSA 4Z76A 1CK0H 3TPKA 5JXEA 1BBDH 2XT1B 1O0VA 4QRQA 4Y2OA 2LQRA 4MQ7A 3WNPA 1Z9MA 3ZKMD 1N0XH 1WFNA 2Y6SC 1BZ7B 4Y4KB 4PJEF 1SJHB 5EPMA 1JWUB 4OF3A 2RGSA 2EDXA 4QYOB 3O6FC 1D5ZB 1MUJA 1YMHB 1CLZH 2UZXB 3LHPH 1R24A 2GJZB 3I6GA 3OKOB 2DM2A 3V52L 5JZ7D 4AM0A 1UC6A 5D7KD 3GUTB 4JANA 2E8YA 5CD5C 3PWNA 1KACB 1TTUA 4QOKB 5F7DA 4PR5B 1FL6B 1P84J 4F58L 4KQ3H 4XCCL 1JTOA 1XGRA 5E5RB 3WUWA 3ARBA 1HHJA 2QR0B 2YPVL 4L9DA 4NZUH 4OFDA 4DZBB 4OZHB 2HLFC 1KXQE 4GW5B 4HK0A 2LABA 5FKAB 5LJYH 5LAXA 5FHBL 3MYZA 4LSQL 2BNRE 3FT2B 2Q1EA 2EKSB 4NO5A 3QXUA 4XH2B 1FAKT 3MCLL 1IE5A 3Q6GL 4OD3L 3CSPA 2EH7H 3LKNB 3C08L 2R2EB 1I4FB 1VFMA 1MCPL 3OHXB 1MFBH 1WAAF 4WWKB 5DSCA 3KWWB 4PV9A 4K23L 2ADIA 1RUQL 3VXRD 1BM3H 5SWZD 1S7QB 1S7SA 2HFTA 4HZAA 5C7XH 5I73C 3SY0B 1XGTB 2PW1B 1K3ZA 4U1JA 1M7IB 3MA7A 2PTTB 3VA6A 3DIFB 4PJBF 4JFFB 4WU7B 3INUL 4GLRI 3BDBA 5IFAL 2NPLX 3ALPA 3B3IB 3IT8D 3L3IA 3HCVB 3B5HA 1A9BB 1QSEE 1BGXH 4BSWB 3HZVB 1JPGA 1U8PB 4ERSH 5K9JH 1F6FB 3GZKA 1U8OB 2BY0A 2LU7A 3ROLA 3AC0A