2NU1E

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I and Tyr18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu1E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu1E01
4D7FA 5FPSA 3CENA 1GBBA 4ABEA 4YOJA 4X6MA 3L3TA 3GDSA 1EX3A 1RTKA 2I6QA 3QTVH 2G8TA 3BTME 1K9OE 1O39A 1RRKA 3VGCC 1BUIA 3RXCA 2FOFA 3A8BA 3UOUA 2GZ9A 5JYIA 2WPIS 2Z9IA 3HKIB 3ZVBA 3MO6A 2ZHWH 2P95A 4WF8A 3NK8A 4INLA 1Y3YA 3BIUH 1DWBH 2O8UA 1O2SA 3BTGE 4B76A 4ZHLU 2ZF0H 2AMQA 1MQ5A 2HRVA 2GD4B 2BDIA 1C9TA 1TBRH 1CA0B 1BA8B 1PPHE 2A4OA 2SGQE 1AD8H 8LPRA 5LH8A 5DJ7A 3UUZA 2Z3DA 1Y3UA 2WV5A 1ETTH 2G5NA 1ZTLA 3E6PH 1B0FA 3GYLB 1HAVB 1TBZH 5ABWA 3ZVFA 1ELGA 5FAHA 5A8XA 1GBJA 3DFLA 1Y3VA 1AVGH 2PUXB 3QUMP 5HGGA 1GHXH 1ELVA 3SUFA 1A2CH 1TOMH 2ZGHA 3BG4B 3FZZA 1IAUA 1F0TA 3KQBA 4BTUB 4Y79A 1IQEA 1MZAA 2CHAC 1MTVA 4IMZA 3T62A 1GMCF 1YPHC 1PQ7A 1NFWA 1O2OA 1DE7H 1HNEE 1P3EA 2ZIQH 2XTTB 1OWEA 3P17H 2FTMA 1FLEE 2Z6BD 2C3SA 2KAIB 2GCTB 1SBWA 1YKTA 2ZHQH 1C5TA 2OBQA 5EU8A 4XSKU 1FUJA 1T32A 1K28D 4AFUA 4CRGA 1GBLA 3PM3A 1AWFH 1FJSA 3PMJA 3FZDA 1OYTH 4MDSA 4FUIA 1O2PA 2PLXA 2BVSH 5HM2A 1GBHA 1O3OA 1BBRK 1GCTC 2VGCB 3SJ9A 1QBOA 3OYPA 3D23A 1F7ZA 4HFPB 1KSNA 5GJ4B 4QT8C 2Z3EA 3AAVA 2GVFA 3PTNA 3KN2A 1BMAA 2J92A 5FBIA 2VWNA 3LPRA 3ZV9A 3ZZ8A 1CT4E 1LVYA 3RXUA 1NC6A 3KQEA 1TGTA 3LC5A 2AYWA 3E1XB 1O2VA 5T6GA 1EAUA 1BIOA 1RGQA 4XOJA 5DK1A 1GVLA 2BVRH 3L33A 7ESTE 4X1NU 1MTNC 3F1SB 1HDTH 2DUCA 3RXRA 4X1QU 2JETC 2FPZA 4ZUHA 4RN6A 1FY4A 4AYYB 3GY7A 1S0QA 4Y7AA 1C4V2 4TWWA 2HWLB 2AMPA 1C2HA 3E90B 1ESAA 1KTTB 3QK1A 4X1RU 4F49A 1S0RA 3PMHB 4AGKA 2J95A 2IPHA 1A46H 2PGQB 1SGPE 2ZGJA 3MU0A 1FNIA 4KP0A 1QBNA 5B6OA 1C2DA 4MQAA 1CSOE 1C2JA 1XX9A 2FP7B 1L2EA 3TITA 2ZPQA 3A7ZA 2A4GA 1V2VT 4YOGA 1C1NA 2XBVA 1VR1H 4GAWA 1GJ4H 2Y5GA 3GY8A 1EB1H 3OSYA 1QB6A 1KLTA 1GWAA 1CA8B 4E7RG 1IHTH 3SJKA 4ASHA 4SGBE 1IQMA 1NFXA 3TLOA 4NG9H 1GHWH 1C2GA 3F9FA 2AERH 1GDNA 1C2LA 2PWXA 4IGDA 1O5BB 5ETXA 4D8NA 5GWZA 2XCFA 3KL6A 5JB8S 1E37B 2V3HH 1BMMH 2HPPH 4MNVA 1LO6A 2G5VA 2A5IA 3F9GA 1AIXH 1J15A 3VB4A 2ZNKH 1TIOA 4MTBA 4ABDA 1O3BA 5A0AE 1ZJKA 1QJ6B 3V7TA 4WH8A 1MTSA 1DSUA 4U30A 4ABAA 1GI5A 4B74A 3ZV8A 4FVBA 3BIVH 1LQEA 1DT2A 2WUCA 7KMEH 2D1JA 3Q76A 1DWEH 3GYMA 2VIWA 1ACBE 5GCHG 3VB3A 3C27B 4GSOA 1HXEH 1BMNH 4LK4A 4Z0KA 4BAQB 4X1SU 4A7IB 2SGPE 3O8RA 2OBOA 3RMMH 3SQEE 4U01A 1OPHB 1XUGA 2Y5HA 1KY9A 3HGPA 2A1DB 1DXWA 3BTTE 3QLPH 2NU4E 1HAHH 1HFDA 5EODA 1PYTD 2AH4X 4OS7A 1BRCE 2ODYB 2ZEBA 4CHAC 2SNVA 1AE5A 2C8ZB 1VCWA 1GBKA 1ANEA 1GI9B 2VH6A 1EOLA 1ZSKA 4O03A 4Z6AH 5ESBA 2R9PA 4R8TB 3NXPA 1PFXC 1GMHG 2W5EA 2WYGA 4K1EA 2BLQA 2FX4A 7LPRA 1QL8A 3SNDA 5JBTA 3ZZ9A 2G4UA 3RXJA 1UK3A 3H5CB 4H6TA 1Z7KA 1ZR0A 5TJXA 1CT2E 1K1MA 1L4DA 2ZDAH 2C8WB 1YCPM 1ABIH 4MPUA 3RMLH 2P3TB 3PO1C 1NO9H 2BXTH 2H5DA 5E8EH 1HAVA 2F9BH 3ELAH 5EW2H 1O2RA 1V2WT 1WAYB 3IWMA 2O9QA 1UTQA 1C1SA 2AS9A 1SGQE 2FYQA 4A1XA 1GGDB 5L2YH 3RXGA 3OTJE 2GT8A 1JWTA 4DT7B 2VVCA 4CBNA 4DW2U 1HRTH 1HAIH 2ZKSA 2SNWA 2ZI2H 4FUGA 3P8GA 4X8VH 1IQJA 8KME2 1PPFE 1QTFA 3BTWE 3WY8A 1DICA 4B71A 1ZSJA 1ZTJA 3SV7A 3T26A 3RLYH 2QA9E 4ABHA 1CVWH 2XBYA 4K2YA 2PKSC 5DP4A 2KAIA 1S83A 2FOGA 3ATIA 1TNJA 4ABGA 3I78A 1OP8A 3E91A 3ESTA 2SGFE 4MNYA 1TX7A 1A3EH 1BTPA 4JZEH 3CS7A 4KTUA 4THNH 4B2BA 3E0PB 1MU6B 2UWOA 5GIBA 4HI3A 1BITA 3A83A 3UTUH 5DKMA 1RIWB 1O3PB 3P95A 1UJ1A 3BTHE 1K1PA 2BD3A 1GHAF 2OLGA 3MH7A 1NRNH 4TPIZ 1WYKA 1GJ8B 1WTHD 1C5PA 1C9PA 1HAGE 1O2ZA 2ZZUH 1G3BA 2BD7A 1SC8U 4D7GA 3VB6A 2VIDA 1T31A 3GY6A 4U2WA 1YCPH 1SGFA 1THSH 3PB1E 5FX6A 1YYY1 1GJCB 2C93B 2F83A 2FTLE 4O3UA 6CHAB 2BB4A 3H7TA 2B0FA 1QY6A 3LOXA 1XUJA 1FAKH 1OSSA 1FIWA 5EW1H 1NU7B 2ZFFH 1ANCA 1J16A 1BT7A 2FIRH 1BBRE 1UCYK 1NS3A 3MOCA 4FUJA 1SGNE 4AX9H 4BXWA 2PV9B 1O3IA 4YZUA 3M7TA 2ZWLH 1ZOMA 3E3TA 1EOJA 3BTKE 1EP6A 3SUEA 3SJOA 1UTLM 1GJ5H 2ZTYA 1GJAB 3TGKE 3EAJA 4A1VA 1SLUB 1V2JT 4NCYA 3F68H 2VU8E 1TGNA 1EKBB 2VIVA 1B7XB 1D9IA 2F91A 4PROA 8ESTE 2XC4A 1P10A 4WMFA 3A7YA 4CR9A 1LKBA 1A0HB 4UFGH 4AFQA 2XWAA 4YESB 3VXEH 1VITG 1L1GA 1AMHA 2FI3E 3M5NA 2BDAA 5A8ZA 3ODDA 1GHBF 1S84A 1C5UA 1D3DB 2STBE 2ZDMA 4BTIB 4YT7H 1HJAC 1BJVA 2WPJS 4AOQA 1THPB 4NFFA 1GJ6A 1IQNA 1KYNA 2NU2E 2Z9LA 2R0LA 4J2YB 2BDHA 2CV3A 1O2WA 4IN1A 2CHAB 2W3KA 3A80A 1YM0A 2AEIH 5AFYH 1SGEE 1S5SA 1VCPA 3W94A 3QZQA 3LIWA 3D49H 4X2YA 1F0SA 1MMJN 3RC6A 2Z9GA 3LGUA 3ATKA 4OS4A 1LHCH 2G51A 1MD8A 2ZU4A 2P3UB 1MAYA 4Y76A 1C1PA 2BY6X 1ANBA 3DUXH 2Y80A 3UNQA 4A1TA 3DD2H 4UEHH 1XVMA 3T25A 3U8TH 2SGEE 3M37A 1HIAB 1QR3E 1TMBH 3PMAB 3HKJB 5CE1A 2TPIZ 3RU4T 1C4Y2 4YT6H 5I25A 1GG6B 5EPYA 3O8BA 1ZTKA 4ZAEA 4IC6A 5HXFA 1Y5BT 4GHQA 4Y8XA 3B9FH 1CHGA 4X8TH 1SG8B 2ANYA 3Q3XA 4KTSA 1FPHH 2A7CA 1T4VH 3RXHA 1VITH 3A87A 1O3JA 2LPRA 1YLCA 1D6RA 1YPEH 3ZZCA 1WTGH 4XE4A 3IG6B 2BZ6H 3MNSA 3C1KA 3EDXB 1O0DH 1GVKB 1NZQH 3PWCA 2JETB 3DHKH 2P59A 9LPRA 2HGTH 4IMQA 4WJG2 1HGTH 4K1SA 4Y6DA 4JYVH 6GCHF 1SGCA 1IQLA 1FY8E 3UIRA 2AIPA 1UTOA 1H8IH 1O3EA 3I77A 1Z6JH 1FI8A 1HCGA 1TX6A 3VXFH 1RTFB 2FOHA 4ISIH 5F8ZA 1C1TA 1P02A 1C2EA 3RP2A 1W7XH 3ZVDA 2QXHA 1D3QB 2FOCA 2XNIA 3ZZBA 1OP0A 3TJNA 3RC4A 4OS1A 1V2UT 4U32A 1IQIA 5C2ZA 1KXEA 2ASUB 2BYAX 4K69A 2AIQA 3K2UA 3G01A 4FU8A 1TALA 1GHYH 1SR5C 2BHGA 1P11E 1BOQA 4AB9A 3M36A 1O5EH 1FMGA 1F2SE 1O5AB 1K22H 4UFDH 1O3GA 1HAYB 3GOVB 3U98H 1OOKB 4WMEA 2OC0A 2ALVA 3M5LA 4X8SH 2QXIA 3NKKA 1PPZA 1E35B 1TRYA 5A0CA 5A8YA 1O5DH 3FANA 3M7UA 1P9UA 1EJAA 3LGVA 2FWWA 2TIOA 3ZVGA 1DXPA 3M7QA 3OY5U 3SNCA 5JDUB 1SQTA 2R3YA 3SQHE 4Q2KA 1YPLH 2A4RA 3RDZA 3RXTA 2D26C 4K5ZA 5JPMH 3SUDA 2PKAB 3QGNB 5JBAS 1A0JA 3SGQE 2ZU3A 5K0HA 2HALA 3K6YA 1J14A 1AFQB 1WUNH 3A8AA 1CE5A 4RSPA 2ZU1A 4FU7A 2GTBA 1LHFH 4ABIA 1Z8IB 1ARCA 1QCPA 3KEEA 1XKAC 2SFAA 2QF3A 2BLVA 1UVUH 1T8NA 2VJ1A 4CHAB 4HGCA 1TQ7B 1FY5A 1MKXK 2QY0B 5DP3A 5LGOA 2K1QA 2ZG0H 3V0XA 4ZHMU 2ODPA 2ZPSA 1N8OB 1IQFA 1KLJH 1A5GH 1W7GH 3LH1A 3P8OA 2AFQB 4KGAA 2JH6D 3EYDA 1NESE 3KQDA 3S7KB 3T2NA 4X2WA 3LC3A 5A0BA 3SNEA 1WU1A 1UCYH 4IBLH 3STIA 4CRAA 4D76A 2R0KA 4I8GA 1GI0A 1O5CB 1F0UA 4WH6A 3SO3A 2GMTC 3QX5H 1GHZA 1EXFA 2VINA 4OS6A 2PHBA 1ELTA 3LGIA 1C5LH 2F3CE 2VNTA 2FZZA 3P92A 5EPNA 2BXUH 1JBUH 1K1OA 1YCPK 4ZMAH 2G81E 1UMAH 4OGYA 1UVOA 1DSTA 1BRUP 4AG1A 1TMTH 4WXIA 4TYDA 3SU4A 4BAHB 4DIIH 3SV8A 1HYLA 1MTUA 4ZKOU 2W7SA 1PQ8A 5L2ZH 1QGFA 1QRWA 4BTTB 5GXPA 1GI7B 2FLBH 2BQWB 4Y11E 2BY7X 2Y5FA 2YOLA 1F5RA 2J2UA 4AGJA 1MQ6A 1L0ZA 2GCHF 4ZROA 2TBSA 1SLXB 3ENSB 8GCHG 2BDYA 2OP9A 2ZTXA 4JZDH 3RC5A 4VGCB 5LPRA 2QXJA 2H9HA 2FS9A 1HIAA 2D8WA 4JCNA 1HBTH 2BD8A 1QL9A 2BX4A 1LQDB 1PQ5A 5LPFA 4X2XA 5T3HA 1C5QA 2YNBA 5E0HA 1O2HA 2ZFRH 3A81A 2F9NA 2P94A 4DVAU 2G52A 3SHAH 1EPTB 5L30H 4J1YA 1LPZB 3TK5A 1ANDA 3TGIE 2A2XH 1A1RA 1GMDF 4XFQA 3QZRA 2SGDE 1P2NA 2ZCKP 3GDUA 2EA3A 1EP5A 1LMWB 3R3GB 2Y6TA 1SGDE 1PPEE 2Z94A 4FUCA 1MU8B 1GHAG 4KTCA 3RMOH 3SW2B 5IYTA 3ZYEA 3KHVA 3PLBA 5AVDA 1CU1A 3I29A 1BHXB 3Q00A 1C5VA 2FM2A 3IITA 4DCDA 1BTZA 1WV7H 2Z7FE 2ANKH 3S0NA 3U9AH 1EJNA 2GX4A 1QA7A 1AQ7A 1ETRH 3TVJB 4OS5A 5SGAE 3MWIU 7GCHG 2ESTE 5K7RA 3P6ZB 3RXEA 1TE0A 1N1LA 1S85A 3BF6H 4HZHA 3TK6A 4JZ1A 1NU9A 1GI2A 1ZHRA 1GBDA 2HVXA 1G32B 1ARBA 5DGJA 1SFIA 5EOKA 4UE7H 3A7XA 3FP7E 3SOSA 1HUTH 3BV9B 4YM9A 4IN2A 5T6FA 1H9IE 3K6ZA 2XCNA 3RXAA 3UREA 2F9PA 1KXBA 1T8LA 3SZNA 5HYOA 1T7CA 1BMLA 4NA9H 1AB9C 1C2KA 2VVUA 1QQ4A 3RXBA 2CGAA 3SNBA 1O32A 2O8WA 1HB0B 1C4U2 5CHAB 1FN6A 1V2MT 1Y3WA 3RU4D 2HNTE 3TH3H 2F9VA 3DA9B 1NFYA 3SORA 3QN7A 2R3UA 1Z6EA 3STJA 4FUFA 2AMDA 1NRSH 4LXBH 5EQQA 3M61U 2VIQA 1XMNB 2HOBA 3KQCA 1GHBG 1GPZA 2PKAA 1ELEE 3L6PA 1AGJA 3MO9A 4XDEA 1IHSH 2BM2A 3BEUA 4MNXA 3UPEA 2A7JA 1JRSA 3RLWH 1BB0B 1TPOA 3HATH 3SJ8A 4LZ1H 2ZCHP 2ZGBH 2AGGX 1EUFA 1SGYE 3TJVA 1CA0C 2ZFTA 3P70B 1B5GH 1ZHMA 1TONA 1BDAA 2ILNA 1C1MA 1P2MA 1SVPA 1GBIA 1QJ1B 5F03A 2A0QB 5BRRE 4ESTE 3NPSA 3A7VA 3MYWA 1O2MA 1F5LA 1CGIE 1T8MA 3B23B 3URDA 3VB5A 1O5GH 1HV7A 2J9NA 4NWKA 1P06A 3FAOA 3BG8A 4DIHH 3ZZ5A 1AVWA 3PTBA 1ZPBA 2IJOB 3E8LA 2VH0A 1LVBA 2NWNA 2CF9H 3PV4A 3BG4C 2BDGA 1HPGA 1G30B 2WPMS 3MH5A 4K1TA 2OCVB 4CRFA 5AF9H 5HM9A 1ZGIA 2PW8H 5H4IB 1CBWB 2PTCE 1O2LA 4NWLA 1MKXH 1P2QA 1CQQA 1O3CA 3QWCH 1IQGA 1O37A 5GDSH 2GKVE 3RUOA 3ZZAA 1LCYA 3S9CA 2G55A 3ATMA 2GCTC 3F9EA 1P2JA 3GCHB 1A7SA 1O2GH 2AGIX 2ZDNA 1LDTT 2ZFSA 3SU5A 3EA8A 3MNCA 2OINA 1GDQA 3JZ2B 1Y3XA 1MUEB 4LZ4B 1LPGB 2ZDVH 5DG6A 1DM4B 3ODFA 3A7WA 1O3FA 3FP6E 1D6WA 5C1UA 1A5IA 1ESTA 3SU6A 1MTWA 2OQ5A 2QF0A 3OY6U 5FCKA 1B0EA 2FDAA 4Q7YA 1QL7A 2A5KA 5E2OA 3DT0H 2ZCLP 1DX5M 2WPLS 4B1TA 3S69A 2BY9X 4MPVA 2BD2A 2ZQ2A 1KDQB 1MBMA 3FFGA 3U8OH 3S9AA 1OKXA 3A82A 3LGTA 1QJ7B 2I6SA 2GDDA 4D9RA 1A61H 3GISB 3Q3YA 4CRCA 1AO5A 1C2MA 1HLTH 3LU9B 1F92A 2BVXH 1C1VH 1HJ9A 3GCOA 2O8LA 1AI8H 3VGCB 1TPSA 1GCDA 1KXCA 5DPAA 1LKAA 2BQ7B 1ZYOA 3O8DA 1GI8B 3SU3A 1EPTA 4FXGH 2NU0E 1CGJE 3M3TA 3Q77A 1D4PB 1O5FH 3VB7A 4DOQA 5LPEA 2QN5T 2P8OC 2B9LA 4FUHA 2Q6FA 3D62A 1D3PB 4ABJA 1K21H 4ABBA 1TGSZ 1PPGE 4JK6A 1TOCB 2BD5A 3LJOA 1OWJA 4FU9A 5E2PA 2CXVA 2O8MA 2UWPA 3A85A 2W7UA 4TPYA 4JYUH 1PQAA 2PR3A 5J4QA 1Y5AT 1SOTA 1SQOA 3RXIA 2Z9JA 4DG4A 1SOZA 2FOEA 1EAIA 2QAAA 1FY1A 3KNXA 1YBWA 5TCAA 3A84A 1C5OH 2TGAA 4R0IA 2A31A 1K2I1 5DP7A 2QXGA 2FI5E 1ZRKA 1OXGA 1O30A 3PYHA 2GMTB 1PPCE 1QB9A 4OGXA 1C5NH 3UNRA 1C5ZB 1Z1JA 1F0RA 1J9CH 1O3MA 1Y8TA 2BQ6B 1V2PT 5E0GA 3TU7H 2C8YB 1HJ8A 1GMHF 4ISHH 1YGCH 3MU1A 3MNXA 3RXFA 1Z8RA 1O3AA 1INCA 2ZU5A 3BTFE 1LTOA 2D2DA 1W0ZU 3QO6A 3B8JA 2GP9B 3T28A 3BN9A 3NCLA 4NZLA 2FOMB 3GY2A 1GCTB 2NU1E 2H1UA 1RS0A 2ZGXH 4NGAH 1UK2A 1O36A 5FPTA 1YPMH 3K65B 1G2LA 1G2MA 3PMBB 1GMCG 2EI8A 2PFEA 3FP8E 2Q6GA 3ZZ7A 3QDZB 4CREA 3SU1A 5PTPA 1XUKA 1AWHB 1GI6A 1MTNB 3OU0A 3LGWA 4JYTA 2ANWA 5HMAA 1VCQA 5C5OA 3UWIA 5AHGH 1XVOA 1C1RA 2H9EH 3SGBE 3V12A 2LNCA 3TK9A 3QGJA 3U69H 1K1LA 2OD3B 3CP7A 3A7TA 1W12U 1DLEA 4GLYA 4I8HA 4DY7B 1QBVH 1DFPA 4DGJA 2RCEA 1S6HA 1ELAA 4Q7ZA 1GGDC 4CBOA 1ZMLA 1MCTA 1W8BH 4CH8B 4YO9A 2GCHG 5FBEA 1EJMA 1BZXE 3MU8A 5C3NA 2QV1A 1K1IA 4NA8A 5ESTE 2C8XB 5EGMA 3T5FH 4X1PU 6LPRA 1SMFE 4B75A 1NPMA 1GBFA 1CHOF 3SGAE 4ISOA 4FUEA 2TGPZ 3SBKA 5I46H 2FS8A 3S7HB 2FYRA 3V3MA 4F4OC 1IQHA 1KTSB 4CH2B 1TRMA 1IOEA 2BDCA 1BCUH 3NUMA 1SPJA 2ZECA 2ZDLA 3UFAA 4GHTA 3E16B 1O38A 1O3HA 5FPYA 4FUBA 4RKOB 2SGAA 2C90B 1G36A 1JXPA 1FPCH 1E38B 2QC2A 3JZ1B 1Y5UT 2Z9KA 3AW1A 1ESBA 3SU2A 1P09A 2Q1JA 1HAPH 5EQSA 1XXFA 3D65E 5JBBS 1DS2E 1GBAA 2EEKA 2Y7ZA 1BTYA 1KXFA 1RIWC 2CF8H 1C2FA 1O2YA 1GMDG 3MI4A 1P05A 3F6UH 2CN0H 3A89A 4X6OA 2XBXA 2ZO3H 3ZVAA 4I8KA 5AFZH 5TCCA 5IDKA 1XKBC 1GVZA 1OX1A 1V2KT 3SV6A 3EA9A 4ZXXH 1EB2A 2OQUA 1YPKH 6CHAC 4Q80A 2FXRA 1UVPA 1KDQA 2Y81A 2THFB 3MMGA 4B73A 4ZH8A 2RA0A 1QQUA 4A6LA 3VPKA 4CRDA 3RM0H 2ZPRA 5C67A 4CRBA 4Y10E 4GUXA 2A2QH 2OC8A 1P3CA 3KCGH 4CR5A 1E36B 1VITF 5FXLA 3KIDU 3PLKA 2ZA5A 1Q31A 3BTQE 4GCHF 2ZHFH 1MKWK 5E0JA 4YOIA 3RMNH 1SL3A 2W3IA 1O3KA 1VJAU 2FX6A 1SFQB 1J8AA 2XWBI 3TH2H 1P9SA 5DP8A 3RXQA 4JZIA 2ZP0H 1ELCA 1ID5H 1YPHE 4TY6A 2BZAA 4AZ2B 1WSSH 4ZKSU 3M3VA 2HLCA 1L4ZA 1ZMJA 4IW4E 1EZQA 3ZYDA 2UWLA 2JH5D 1ABJH 1GBTA 2A5AA 1FXYA 3CS0A 1QIXB 2ODQA 6ESTA 3PO1B 1SHHB 3QTOH 1MBQA 3AVZA 1XUIA 1UCYE 1AU8A 3GCTF 1NRRH 3DFJA 4FVDA 2FLRH 2ZFPH 3MHWU 1TNIA 1SHYA 1UK4A 2WINI 1FDPA 1O2UA 5JBCS 3EA7A 1WCZA 4BXSA 1T8OA 2XW9A 2YNAA 2ANMH 3BSQA 2XC0A 1YPGH 4K3JA 2UUYA 4TWYA 4ABFA 1K1JA 2QCYA 1L1NA 2RDLA 3HGNA 2PKSB 2TRMA 1K1NA 3UQOA 2PTNA 1LPKB 5EG4A 3LONA 1FY3A 5BPEA 1CGHA 3ATLA 4K60A 2BDBA 3RXSA 4AFSA 1Z1IA 3SNAA 4BAKB 3P8FA 1C5RA 2BOHB 3K9XB 3UY9A 1WOFA 1SLVB 3SV2H 1DVAH 1GG6C 4I7YH 1XUFA 1BRAA 1O3DA 1QA0A 4IS5A 1EAXA 1GHVH 2BMGB 1F5KU 1C5XB 2WPHS 4X6NA 2OC7A 5EXNA 3TJOA 1GI3A 1EASA 4I32A 2GZ8A 1V3XA 2FOBA 2P16A 1CO7E 1P57B 3BTEE 1SGIB 3ATWA 5C20A 2QYIA 2UUFB 1AKSB 1W14U 1BTXA 3O8CA 2B7DH 1A5HA 5F6MA 4UFFH 4UONA 1VGCC 1RXPA 1V2NT 2ZU2A 3AW0A 1JRTA 1TGBA 1TB6H 1HAZB 2RA3A 2TGTA 2H6MA 1SGTA 1TNKA 1SQAA 1TRNA 2M5TA 4E06H 1EQ9A 3TPIZ 1XXDA 1AZZA 2H2ZA 1YF4A 4MVNA 1O2KA 1TQ0B 3GDVA 1HAOH 1V2OT 3RXDA 1H9LB 1YC0A 3TNSA 4AORA 1NFUA 2HPQH 5EXMA 2P8OB 3TH4H 1BTUA 4A92A 1RD3B 2V0BA 3LH3A 1NRQH 2NU3E 3LJJA 2GV7A 1MCVA 1TPAE 5FHTA 5EXLA 4K8YA 1DDJA 1THRH 1TPPA 3A8DA 5FCRA 1TBQH 4BAOB 1C5SA 1V2LT 2CMYA 3BEFB 3S9BA 1DOJA 1AUTC 3ZZ3A 1AHTH 3PROA 4NSYA 2VB0A 4NZQA 1HJAB 5A2MH 5J4SA 2OUAA 1JOUB 2C4FH 2R2MB 1X7AC 2V3OH 3NWUA 1YPJH 1GI1A 1GJBB 2OC1A 1O2IA 1FAXA 2H9TH 4INHA 1ETSH 4XBCA 1SB1H 3MU4A 1DUAA 1FV9A 1PPBH 2G4TA 4XBDA 1LVMA 1P12E 3RXPA 2QIQA 4MPXA 3MFJA 3UNSA 3NZIA 3PLPA 1UTPA 4WXVA 3LGYA 1P2KA 2XRCA 1RTLA 3RXLA 4Y8ZA 1SGFG 4AB8A 3M3SA 4BNRA 1ZGVA 3PWBA 4RKJB 3TIUA 1DWDH 1AFQC 1EAWA 1NY22 3MH4A 1UVSH 3SV9A 3ZZDA 3EGKH 3N7OA 1G37A 1GBEA 1AUJA 2ULLA 3AAUA 1O31A 3GY3A 3V13A 5L6NH 4AYVB 4TY7A 3SJIA 3TGJE 5CMXH 2F9OA 1P2IA 1O35A 1P04A 4O3TA 1MH0A 2ZFQH 4NA7A 3HPTB 2J38A 2GGVB 1TMUH 3SN8A 1O2TA 3A88A 1TA2A 1Z8JB 2FOAA 1N8OC 2HNTC 1GJ9B 3RU4E 5A09A 1LHEH 4X6PA 3ZZ4A 2XXLA 1EZXC 2R2WU 1VJ9U 1AFEH 4K8BA 4WWYA 4BOHA 1S81A 4YLUA 1TFXA 1O33A 3UOPA 1QNJA 1GJ7B 1C1UH 1MKWH 3SI4H 1O34A 3LKWA 1GI4A 1Z71A 3UWJH 1O2NA 9ESTA 3M5MA 3SHCH 1W13U 4A5TS 5F8TA 3SI3H 3URCA 1DPOA 1BRBE 4NSVA 4AG2A 4ISLA 3MU5A 1AZ8A 2DE9A 2FI4E 4Y7BA 4INKA 8GCHF 1A3BH 2B8OH 2Z3CA 2VWOA 1W2KH 4XBBA 1O2XA 4NIYA 2PSYA 1S82A 1DY9A 1N6XA 4M7GA 4X0WU 3ITIA 1C1OA 1ZLRA 2IN2A 2J34A 3U8RH 2STAE 3GCNA 1E34B 1V2TT 1EATA 4ZHAA 2RG3A 4H4FA 2ZTZA 2A7HA 3T27A 1NROH 2XYAA 1TYNA 3Q3KA 3U1IB 1PYTC 1C5MD 2HNTF 2VGCC 3ZVEA 1UHBB 1WBGB 4I8LA 2BOKA 2JKHA 1D3TB 1NM6A 2VWLA 4DJZB 2BY5X 3R0FA 2TGDA 6GCHG 1OWKA 4Y71A 1Z8GA 2GV6A 4D9QA 1JIMA 2GZ7A 1EZSC 3UR6A 3SU0A 1OYQA 1ZJDA 2BD4A 4MNWA 3BEIB 4VGCC 1QRZA 4KELA 1GL1A 3RXVA 1Q3XA 5C1YA 1SLWB 4WVPE 1NRPH 3TJUA 5DP9A 4JMYA 1FN8A 1ZPCA 2V35A 2OTVA 3TNTA 2Q6DA 1W3CA 4DURA 3GY4A 1CHOG 3BTDE 3MNBA 2J94A 1P8VC 1EPTC 4NIVA 1E0FD 1BJUA 4Y8YA 2P93A 7GCHF 3SUGA 1GL0E 1TNHA 1NN6A 1BBRH 1DWCH 2AGEX 1TX8A 4NFEA 4GPGA 1AKSA 1H4WA 2ZGCA 2FMJA 1UVTH 1ZZZA 1P01A 2GT7A 1TAWA 3EQ0H 4UFEH 5DO4H 1ORFA 2FO9A 4IC5A 3FVFB 3RM2H 3VEQB 3ZZ6A 1N6YA 4AN7A 2JH0D 4H6SB 1UTNA 2A45B 2DE8A 5EQRA 2VIPA 3W95A 5GCHF 1V2RT 2BD9A 4B2CA 2FESH 1O2JA 3GICB 5T6DA 3UR9A 3UQVA 1TNLA 2V6NA 1QURH 1KXDA 2WUBA 1H9HE 2WPKS 2ZHDA 2A4QA 3MTYA 1QRXA 2ALPA 2O8TA 1W10U 1LHGH 4JK5A 1M9UA 3RXOA 2PSXA 1OWIA 2BX3A 5FX5A 2BTCE 1RFNA 2EC9H 3MH6A 2IOTA 1BTWA 1WQVH 4MPWA 1W0YH 2WV4A 4GCHG 1BTHH 1P0SH 4KKDA 1MD7A 4UD9H 1OWHA 1FONA 1ZMNA 1HAXB 3RXMA 5GPIB 1TABE 1WQSA 2J4IA 1CT0E 1TA6A 1LVOA 1O3NA 1P03A 1P2OA 1Q2WA 1QFKH 1T4UH 2Y82A 1G3DA 3RXKA 1W11U 1FQ3A 1OWDA 2F9UA 1DANH 1S6FA 2CJIA 4WMDA 1GJDB 2EI6A 5CHAC 1G9IE 1DITH 1QHRB 2ZQ1A 2UUKB 4HTCH 1AE8H 1OS8A 2H5CA 5G4BA 2FEQH 4X2VA 1C5YB 1C2IA 1BHXF 1HXFH 4YLQH 3HK6B 4BAMB 1EZUC 3HK3B 2P3FH 5DP5A 4ZXYH 1KLIH 4I31A 1UTMA 1LHDH 4I33A 1YLDA 1G3EA 3GCTG 2ZHEH 1C1QA 1UTJA 1TNGA 1TLDA 4OS2A 5JB9S 1DUEA 2ZC9H 1V2ST 3GY5A 4LOYH 4AFZA 4I8JA 1ZPZA 1FZZA 1H8DH 2Y7XA 3ZVCA 4MG3A 1JMOH 2PUQH 2BLOA 2VWMA 1QB1A 2G00A 4Y0ZE 1XM1A 5DP6A 1SI5H 1C1WH 1G3CA 1O2QA 1GBMA 1AN1E 4YTAA 3EE0B 1RJXB 4NIWA 3T29A 1A0LA 2GDEH 1MZDA 3U1JB 1JIRA 4X8UH 1U6QA 4E05H 1IQKA 1YP9A 4FUDA 2ZDKA 4SGAE 1SSXA 1KXAA 1H1BA 1VGCB 4ZKRU 4Y0YE 2W26A 3A8CA 1MAXA 4O97A 3H7OA 1DLKB 2UUJB 1ELDE 1TWXB 1XUHA 4JZFH 1KIGH 2OXSA 4H42U 3OX7U 2B5TB 1V2QT 1CBWC 3LDXH 1O3LA 2A32A 2WYJA 1UO6A 4MLFB 4Q7XA 4NIXA 2XC5A 3LT3A 2BLWA 3MO3A 5F8XA 1TGCA 1UTKA 1ELBA 2VVVA 2FODA 1AVXA 1GDUA 1GBCA 4O9VA 3GCHC 2XBWA 1ELFA 2EI7A 1J17T 1V6DA 1VZQH 1NTPA 2PGBB 1AY6H 1ZHPA 1ZRBA 1Y59T 3KF2A 3M5OA 1A4WH 4BANB 2BY8X 2VIOA 4WY3A 3AASA 3M35A 1PJPA 3KGPA 3P8NA 1DY8A 4B2AA 1BQYA 1FIZA 1SGRE 1C5WB 1L1JA 1ZSLA 5C5NA 1UHBA 3A86A 4ISNA 4E7NA 3F9HA 5C1XA 2QGRA 3VFEA 1NT1A 4GVUA 1AB9B 4UDWH 3E0NB 1OP2A 4ZKNU
chains in the Genus database with same CATH superfamily
4D7FA 5FPSA 3CENA 1GBBA 4ABEA 4YOJA 4X6MA 3L3TA 3GDSA 1EX3A 1RTKA 2I6QA 3QTVH 2G8TA 3BTME 1K9OE 1O39A 1RRKA 3VGCC 1BUIA 3RXCA 2FOFA 3A8BA 3UOUA 2OK5A 2GZ9A 5JYIA 2WPIS 2Z9IA 3HKIB 3ZVBA 3MO6A 2ZHWH 2P95A 4WF8A 3NK8A 4INLA 1Y3YA 3BIUH 1DWBH 2O8UA 2LP6A 1O2SA 3BTGE 4B76A 4ZHLU 2ZF0H 2AMQA 1MQ5A 2HRVA 2GD4B 2BDIA 1C9TA 1TBRH 1CA0B 1BA8B 1PPHE 2A4OA 2SGQE 1AD8H 8LPRA 5LH8A 5DJ7A 3UUZA 2Z3DA 1Y3UA 2WV5A 1ETTH 2G5NA 1ZTLA 3E6PH 1B0FA 3GYLB 1HAVB 1TBZH 5ABWA 3ZVFA 1ELGA 5FAHA 5A8XA 1GBJA 3DFLA 1Y3VA 1AVGH 2PUXB 3QUMP 5HGGA 1GHXH 1ELVA 3SUFA 1A2CH 1TOMH 2ZGHA 3BG4B 3FZZA 1IAUA 1F0TA 3KQBA 4BTUB 4Y79A 1IQEA 1MZAA 2CHAC 1MTVA 4IMZA 3T62A 1GMCF 1YPHC 2WV9A 1PQ7A 1NFWA 1O2OA 1DE7H 1HNEE 1P3EA 2ZIQH 2XTTB 1OWEA 3P17H 2FTMA 1FLEE 2Z6BD 2C3SA 2KAIB 2GCTB 1SBWA 1YKTA 2ZHQH 1C5TA 1H8ED 2OBQA 4FOUC 5EU8A 4XSKU 1FUJA 1T32A 1K28D 4AFUA 4CRGA 1GBLA 3PM3A 1AWFH 1FJSA 3N7DA 3PMJA 3FZDA 1OYTH 4MDSA 4FUIA 1O2PA 2PLXA 2BVSH 5HM2A 1GBHA 1O3OA 1BBRK 1GCTC 2VGCB 3SJ9A 1QBOA 3OYPA 3D23A 1F7ZA 4HFPB 1KSNA 5GJ4B 4QT8C 2Z3EA 3AAVA 2GVFA 3PTNA 3KN2A 1BMAA 2J92A 5FBIA 2VWNA 3LPRA 3ZV9A 3ZZ8A 1CT4E 1LVYA 3RXUA 1NC6A 3KQEA 1TGTA 3LC5A 2AYWA 3E1XB 1O2VA 5T6GA 1EAUA 1BIOA 1RGQA 4XOJA 5DK1A 1GVLA 2BVRH 3FKSD 3L33A 7ESTE 4X1NU 2RFKC 1MTNC 3F1SB 1HDTH 3F0OA 2DUCA 5KGOA 3RXRA 4X1QU 2JETC 2FPZA 4ZUHA 4RN6A 1FY4A 4AYYB 3GY7A 1S0QA 4Y7AA 1C4V2 4TWWA 2HWLB 2AMPA 1C2HA 3E90B 1ESAA 1KTTB 3QK1A 4X1RU 4F49A 1S0RA 3PMHB 4AGKA 2J95A 2IPHA 1A46H 2PGQB 1SGPE 2ZGJA 3MU0A 1FNIA 4KP0A 1QBNA 5B6OA 1C2DA 4MQAA 1CSOE 1C2JA 1XX9A 2FP7B 1L2EA 3TITA 2ZPQA 3A7ZA 2A4GA 1V2VT 4YOGA 1C1NA 2XBVA 1VR1H 4GAWA 1GJ4H 2Y5GA 3GY8A 1EB1H 3OSYA 2WZQA 1QB6A 1KLTA 1GWAA 1CA8B 5DSFA 4E7RG 1IHTH 3SJKA 4ASHA 4SGBE 1IQMA 1NFXA 2KM0A 2IPQX 3TLOA 4NG9H 1GHWH 1C2GA 3F9FA 2AERH 1GDNA 1C2LA 2PWXA 4IGDA 1O5BB 5ETXA 4D8NA 5GWZA 1K0HA 2CK3D 2XCFA 3KL6A 2W6ID 5JB8S 1E37B 2V3HH 1BMMH 2HPPH 4MNVA 2KCPA 1LO6A 2G5VA 2A5IA 3F9GA 1AIXH 1J15A 3VB4A 2ZNKH 1TIOA 4MTBA 4ABDA 1O3BA 5A0AE 1ZJKA 1QJ6B 3V7TA 4WH8A 1MTSA 1DSUA 3KQ5A 4U30A 4ABAA 1GI5A 4B74A 3ZV8A 4FVBA 3BIVH 1LQEA 1DT2A 2WUCA 7KMEH 2D1JA 3Q76A 1DWEH 3GYMA 2VIWA 1ACBE 5GCHG 3VB3A 3C27B 4GSOA 1HXEH 1BMNH 4LK4A 4Z0KA 4BAQB 4X1SU 4A7IB 2SGPE 3O8RA 2OBOA 1VKYA 3RMMH 3SQEE 4U01A 1OPHB 1XUGA 2Y5HA 1KY9A 3HGPA 2A1DB 1DXWA 3BTTE 3QLPH 2NU4E 1HAHH 1HFDA 5EODA 3F2FA 1PYTD 2AH4X 4OS7A 1BRCE 2ODYB 2ZEBA 4CHAC 2KFWA 2SNVA 1AE5A 2C8ZB 5C94A 2AHME 1VCWA 1GBKA 1ANEA 1GI9B 2VH6A 1EOLA 1ZSKA 1W0JD 4O03A 4Z6AH 5ESBA 2R9PA 4R8TB 3NXPA 1PFXC 1GMHG 2W5EA 2WYGA 4K1EA 2BLQA 2FX4A 3PRBA 7LPRA 1QL8A 3SNDA 5JBTA 3ZZ9A 2G4UA 3RXJA 1UK3A 3H5CB 4H6TA 1Z7KA 1ZR0A 5TJXA 1CT2E 1K1MA 1L4DA 2ZDAH 2C8WB 1YCPM 1ABIH 4MPUA 3RMLH 2P3TB 3PO1C 1NO9H 2BXTH 2H5DA 5E8EH 1HAVA 2F9BH 3ELAH 5EW2H 1O2RA 1V2WT 1WAYB 3IWMA 2O9QA 2J5UA 1UTQA 1C1SA 2AS9A 2QF4A 1SGQE 2FYQA 4A1XA 1GGDB 5L2YH 3RXGA 3OTJE 2GT8A 1JWTA 4DT7B 2VVCA 4CBNA 4DW2U 1HRTH 1HAIH 2ZKSA 2SNWA 2ZI2H 4FUGA 3P8GA 4X8VH 1IQJA 8KME2 1PPFE 1QTFA 3BTWE 3WY8A 1DICA 4B71A 1ZSJA 1ZTJA 3SV7A 3T26A 3RLYH 2QA9E 4ABHA 1CVWH 2XBYA 4K2YA 2PKSC 5DP4A 2KAIA 1S83A 2FOGA 3ATIA 1TNJA 4ABGA 3I78A 1OP8A 3E91A 3ESTA 2SGFE 4MNYA 1TX7A 1A3EH 1BTPA 4JZEH 3CS7A 3OAAD 4KTUA 4THNH 4B2BA 3E0PB 1MU6B 2UWOA 5GIBA 4HI3A 1BITA 3A83A 3UTUH 5DKMA 1RIWB 1O3PB 3P95A 1UJ1A 3BTHE 1K1PA 2BD3A 1GHAF 3F0PA 2OLGA 3MH7A 1NRNH 4TPIZ 1WYKA 1GJ8B 1WTHD 1C5PA 1C9PA 1HAGE 1NBME 1O2ZA 2ZZUH 1G3BA 2BD7A 1SC8U 4D7GA 3VB6A 2VIDA 1T31A 3GY6A 4U2WA 1YCPH 1SGFA 1THSH 3PB1E 5FX6A 1YYY1 1GJCB 2C93B 2F83A 2FTLE 4O3UA 6CHAB 2BB4A 3H7TA 2B0FA 1QY6A 3LOXA 1XUJA 1FAKH 1OSSA 1FIWA 5EW1H 1NU7B 2ZFFH 1ANCA 2YMSD 1J16A 1BT7A 2FIRH 1BBRE 1UCYK 1NS3A 3MOCA 4FUJA 1SGNE 4AX9H 4BXWA 2PV9B 1O3IA 4YZUA 3M7TA 2ZWLH 1ZOMA 3E3TA 1EOJA 3BTKE 1EP6A 3SUEA 3SJOA 1UTLM 1GJ5H 5EJ1A 2ZTYA 1GJAB 3TGKE 3EAJA 5EJZA 4A1VA 1SLUB 1V2JT 4NCYA 3F68H 2VU8E 1TGNA 1EKBB 2VIVA 1B7XB 1D9IA 2F91A 4PROA 8ESTE 2XC4A 1P10A 5EJLA 4WMFA 3A7YA 4CR9A 1LKBA 1A0HB 4UFGH 4AFQA 2XWAA 4YESB 3VXEH 1VITG 1L1GA 1AMHA 2FI3E 3M5NA 2BDAA 5A8ZA 3ODDA 1GHBF 1S84A 1C5UA 1D3DB 2STBE 2ZDMA 4BTIB 4YT7H 1HJAC 1BJVA 2WPJS 4AOQA 1THPB 4NFFA 1GJ6A 1IQNA 1KYNA 2NU2E 2Z9LA 2R0LA 4J2YB 2BDHA 2CV3A 1O2WA 4IN1A 2CHAB 2W3KA 3A80A 1YM0A 2AEIH 5AFYH 1SGEE 1S5SA 1VCPA 2KZ4A 3W94A 3QZQA 3LIWA 3D49H 2YMSC 4X2YA 1F0SA 1MMJN 3RC6A 2Z9GA 3LGUA 3ATKA 4OS4A 1LHCH 2G51A 1MD8A 2ZU4A 1YY3A 1MAYA 2P3UB 4Y76A 5HIYA 1C1PA 2BY6X 1ANBA 3DUXH 2Y80A 3UNQA 4A1TA 3DD2H 2QE7D 3NRLA 4UEHH 1XVMA 3T25A 3U8TH 2SGEE 3M37A 1HIAB 1QR3E 1TMBH 3PMAB 3HKJB 5CE1A 2TPIZ 3RU4T 1C4Y2 4YT6H 5I25A 1GG6B 5EPYA 3O8BA 1ZTKA 4ZAEA 4IC6A 5HXFA 1Y5BT 4GHQA 4Y8XA 3B9FH 1CHGA 4X8TH 1SG8B 2ANYA 3Q3XA 4KTSA 1FPHH 2A7CA 1T4VH 3RXHA 5HIZA 1VITH 3A87A 2V3MA 1O3JA 2LPRA 1YLCA 1D6RA 1YPEH 3ZZCA 1WTGH 3DCLA 4XE4A 3IG6B 2BZ6H 3MNSA 3C1KA 3EDXB 1O0DH 1GVKB 1NZQH 3PWCA 2JETB 3DHKH 2P59A 9LPRA 2HGTH 4IMQA 4WJG2 1HGTH 4K1SA 4Y6DA 4JYVH 5CHBA 1SGCA 6GCHF 1IQLA 2LELA 1FY8E 3UIRA 2AIPA 1UTOA 1H8IH 1O3EA 3I77A 1QZ8A 3W1EA 1Z6JH 2EQNA 1FI8A 1HCGA 1TX6A 3VXFH 1RTFB 2FOHA 4ISIH 5F8ZA 1C1TA 1P02A 1C2EA 3RP2A 1W7XH 3ZVDA 2QXHA 1D3QB 2FOCA 1EFRD 2EY4C 2XNIA 3ZZBA 1OP0A 3TJNA 3RC4A 4OS1A 1V2UT 4U32A 1IQIA 5C2ZA 1KXEA 2ASUB 2BYAX 4K69A 2AIQA 3K2UA 3G01A 4FU8A 4M9FA 1TALA 1GHYH 1SR5C 2BHGA 1P11E 1BOQA 1E79D 5F53A 4AB9A 3M36A 1O5EH 1FMGA 1F2SE 1O5AB 1K22H 4UFDH 1O3GA 1HAYB 3GOVB 3U98H 1OOKB 4WMEA 2OC0A 2ALVA 2VBCA 3M5LA 2GJGA 4X8SH 2QXIA 3NKKA 1PPZA 1E35B 1TRYA 5A0CA 5A8YA 1O5DH 3FANA 3M7UA 1P9UA 1EJAA 3LGVA 2FWWA 2TIOA 3ZVGA 1DXPA 3M7QA 3OY5U 3SNCA 5JDUB 1SQTA 2R3YA 3SQHE 4Q2KA 1YPLH 2A4RA 3RDZA 3OE7D 3RXTA 2D26C 4K5ZA 2KCOA 5JPMH 3SUDA 2PKAB 3QGNB 5JBAS 1A0JA 3SGQE 2ZU3A 5K0HA 2HALA 3K6YA 1J14A 1AFQB 1WUNH 3A8AA 1CE5A 4RSPA 2ZU1A 4FU7A 2GTBA 1LHFH 4ABIA 1Z8IB 1ARCA 1QCPA 3KEEA 1XKAC 2SFAA 2QF3A 2BLVA 1UVUH 1T8NA 2VJ1A 4CHAB 5B6LA 1H8HD 4HGCA 1TQ7B 1FY5A 1MKXK 2QY0B 5DP3A 5LGOA 2K1QA 2ZG0H 3V0XA 4ZHMU 2KR7A 2ODPA 2ZPSA 1N8OB 1IQFA 1KLJH 1A5GH 1W7GH 3LH1A 3P8OA 2AFQB 4KGAA 2JH6D 3EYDA 3OEED 1NESE 3KQDA 3S7KB 3T2NA 4X2WA 3LC3A 3F2HA 5A0BA 3SNEA 1WU1A 2RDEA 1UCYH 4IBLH 3STIA 4CRAA 5HKKD 4D76A 2R0KA 4I8GA 1GI0A 1O5CB 1F0UA 4WH6A 3SO3A 2GMTC 3QX5H 1GHZA 1EXFA 3KYFA 2VINA 4OS6A 2PHBA 3MQKC 1ELTA 3LGIA 1C5LH 2F3CE 2VNTA 2FZZA 3P92A 5EPNA 2BXUH 1JBUH 1K1OA 1YCPK 4ZMAH 2G81E 1UMAH 4OGYA 1UVOA 1DSTA 1BRUP 4AG1A 1TMTH 4WXIA 3DSOA 4TYDA 3SU4A 4BAHB 4DIIH 3SV8A 1HYLA 1MTUA 4ZKOU 2W7SA 1PQ8A 5L2ZH 1QGFA 1QRWA 4BTTB 5GXPA 1GI7B 2FLBH 2BQWB 4Y11E 2BY7X 2Y5FA 4XD7D 5C17A 2YOLA 1F5RA 2J2UA 4AGJA 1MQ6A 1L0ZA 2GCHF 4ZROA 2TBSA 1SLXB 3ENSB 4B6FA 8GCHG 2WHXA 2BDYA 2OP9A 2ZTXA 4JZDH 3RC5A 4VGCB 5LPRA 2QXJA 2H9HA 2FS9A 1HIAA 2D8WA 4JCNA 1HBTH 2BD8A 1QL9A 2BX4A 1LQDB 1PQ5A 5LPFA 4X2XA 5T3HA 1C5QA 2YNBA 5E0HA 1O2HA 2ZFRH 3A81A 2F9NA 2P94A 4DVAU 2G52A 3SHAH 1EPTB 5L30H 4J1YA 1LPZB 3TK5A 1ANDA 3TGIE 2A2XH 1A1RA 1GMDF 4XFQA 3QZRA 2SGDE 1P2NA 2ZCKP 3GDUA 2EA3A 1EP5A 1LMWB 3R3GB 2Y6TA 1SGDE 1PPEE 2Z94A 4FUCA 1MU8B 1GHAG 2L74A 4KTCA 3RMOH 3SW2B 5IYTA 3ZYEA 3KHVA 3PLBA 5AVDA 5C0TA 1CU1A 3I29A 1BHXB 3Q00A 1C5VA 2FM2A 3IITA 1E1RD 4DCDA 1BTZA 1WV7H 2Z7FE 2ANKH 3S0NA 3U9AH 1EJNA 2GX4A 1QA7A 1AQ7A 1ETRH 3TVJB 4OS5A 5SGAE 3MWIU 7GCHG 2ESTE 5K7RA 3P6ZB 3RXEA 1TE0A 1N1LA 1S85A 3BF6H 4HZHA 3TK6A 4JZ1A 1NU9A 2JIZD 1GI2A 1ZHRA 1GBDA 2HVXA 4P00A 1G32B 1ARBA 5DGJA 1SFIA 5EOKA 4UE7H 3A7XA 3FP7E 3SOSA 4XRNA 1HUTH 3BV9B 4YM9A 4IN2A 5T6FA 1H9IE 3K6ZA 2XCNA 3RXAA 3UREA 2F9PA 1KXBA 1T8LA 3SZNA 5HYOA 1T7CA 1BMLA 4NA9H 1AB9C 1C2KA 2VVUA 1QQ4A 3RXBA 2CGAA 3SNBA 1O32A 2O8WA 1HB0B 4HG6A 1C4U2 5CHAB 1FN6A 1V2MT 1Y3WA 3RU4D 2HNTE 3TH3H 2F9VA 3DA9B 1NFYA 3SORA 3F3BA 3QN7A 2R3UA 1Z6EA 3STJA 4FUFA 1E1QD 1UW7A 2AMDA 1NRSH 4LXBH 5EQQA 3M61U 2VIQA 1XMNB 2HOBA 3KQCA 3AK5A 1GHBG 1GPZA 2PKAA 1ELEE 3L6PA 1AGJA 3MO9A 4XDEA 1IHSH 2BM2A 3BEUA 3OFND 4MNXA 3UPEA 2A7JA 1JRSA 3RLWH 1BB0B 1TPOA 3HATH 3SJ8A 4LZ1H 2ZCHP 2ZGBH 1YLNA 2AGGX 1EUFA 1SGYE 2K0QA 1CA0C 2ZFTA 3P70B 1B5GH 1YWUA 1TONA 1ZHMA 3TJVA 1BDAA 2ILNA 1C1MA 1P2MA 1SVPA 1GBIA 1QJ1B 2KCAA 4ZCNA 5F03A 2A0QB 5BRRE 4ESTE 3NPSA 3A7VA 3MYWA 1O2MA 1F5LA 1CGIE 1T8MA 3B23B 3URDA 3VB5A 1O5GH 3PV2A 1HV7A 2J9NA 4NWKA 1P06A 3FAOA 3BG8A 4DIHH 3ZZ5A 4ACBA 1AVWA 3PTBA 1ZPBA 2IJOB 3E8LA 2VH0A 1LVBA 2NWNA 2CF9H 3PV4A 3BG4C 2BDGA 1HPGA 1G30B 2WPMS 3MH5A 4K1TA 2OCVB 4CRFA 5AF9H 5HM9A 1ZGIA 2XNDD 2PW8H 3OTPA 5H4IB 2KCYA 1CBWB 2PTCE 1O2LA 4NWLA 1MKXH 1P2QA 2JJ1D 1CQQA 1O3CA 3QWCH 1IQGA 1O37A 5GDSH 2GKVE 3RUOA 2M2AA 3ZZAA 1LCYA 3S9CA 2G55A 3ATMA 2GCTC 3F9EA 1P2JA 3GCHB 3H09A 1A7SA 1O2GH 2AGIX 2ZDNA 1LDTT 2ZFSA 2F43B 3SU5A 3EA8A 3MNCA 2OINA 1GDQA 3JZ2B 1Y3XA 1MUEB 4LZ4B 1LPGB 2ZDVH 5DG6A 1DM4B 3ODFA 3A7WA 1O3FA 3FP6E 1D6WA 5C1UA 1A5IA 1ESTA 3SU6A 1MTWA 2OQ5A 2QF0A 1S6LA 3OY6U 5FCKA 1B0EA 2FDAA 4Q7YA 1QL7A 2A5KA 5E2OA 3DT0H 2ZCLP 1DX5M 2WPLS 4B1TA 3S69A 2BY9X 4MPVA 2BD2A 2ZQ2A 1KDQB 1MBMA 3FFGA 3U8OH 3S9AA 1OKXA 3A82A 3LGTA 4DT4A 4Z1MD 1QJ7B 2I6SA 2GDDA 4D9RA 1A61H 3GISB 3Q3YA 4CRCA 1AO5A 1C2MA 1HLTH 3LU9B 1F92A 2BVXH 1C1VH 1HJ9A 3GCOA 2O8LA 1AI8H 3VGCB 1TPSA 1GCDA 1KXCA 2V7QD 5DPAA 1LKAA 2BQ7B 1ZYOA 3O8DA 1GI8B 3SU3A 1EPTA 4FXGH 3WW7A 2NU0E 1CGJE 3M3TA 3Q77A 1D4PB 1O5FH 3VB7A 4DOQA 5LPEA 2QN5T 2P8OC 2B9LA 4FUHA 2Q6FA 3D62A 1D3PB 4ABJA 1K21H 4ABBA 1TGSZ 1PPGE 4JK6A 1TOCB 2BD5A 3LJOA 1OWJA 4FU9A 5E2PA 2CXVA 2O8MA 2UWPA 3A85A 2W7UA 4TPYA 4JYUH 4FETA 1PQAA 2PR3A 5J4QA 1Y5AT 1SOTA 1SQOA 3RXIA 2Z9JA 4DG4A 1SOZA 2FOEA 1EAIA 2QAAA 1FY1A 3KNXA 1YBWA 5TCAA 3A84A 1C5OH 2TGAA 4R0IA 2A31A 1K2I1 5DP7A 2QXGA 2FI5E 1ZRKA 1OXGA 1O30A 3PYHA 2GMTB 1PPCE 1QB9A 4OGXA 1C5NH 3UNRA 1C5ZB 1Z1JA 1F0RA 1J9CH 1O3MA 1Y8TA 2BQ6B 1V2PT 5E0GA 3TU7H 2C8YB 1HJ8A 1GMHF 2J98B 4ISHH 1YGCH 3MU1A 3KYGA 3MNXA 3RXFA 1Z8RA 1O3AA 1INCA 2ZU5A 3BTFE 1LTOA 2D2DA 1W0ZU 3WWFA 3QO6A 3B8JA 2GP9B 4RI0A 3SZEA 3T28A 3BN9A 3NCLA 4NZLA 2FOMB 3GY2A 1GCTB 2NU1E 2H1UA 1RS0A 2ZGXH 4NGAH 1UK2A 1O36A 5FPTA 1YPMH 3K65B 1G2LA 1G2MA 3PMBB 1GMCG 2EI8A 2PFEA 3FP8E 3N99A 2Q6GA 3ZZ7A 2W6JD 3QDZB 4CREA 4RT0A 4TT3D 3SU1A 5PTPA 1XUKA 1AWHB 1GI6A 1MTNB 3OU0A 3LGWA 4JYTA 2ANWA 5HMAA 1VCQA 5C5OA 3UWIA 5AHGH 1XVOA 1C1RA 2H9EH 3SGBE 3V12A 2LNCA 3TK9A 3QGJA 3U69H 1K1LA 2OD3B 3CP7A 3A7TA 1W12U 1DLEA 4GLYA 4I8HA 4DY7B 1QBVH 1DFPA 3WWBA 4DGJA 2RCEA 1S6HA 1ELAA 4Q7ZA 1GGDC 4CBOA 1ZMLA 1MCTA 2IJD1 1W8BH 4CH8B 4YO9A 2GCHG 5FBEA 1EJMA 1BZXE 3MU8A 5C3NA 2QV1A 1SKYE 1K1IA 4NA8A 5ESTE 2C8XB 5EGMA 3T5FH 4X1PU 6LPRA 1SMFE 4B75A 1NPMA 1GBFA 1CHOF 3SGAE 4ISOA 4FUEA 2TGPZ 3SBKA 5I46H 2FS8A 4TSFD 3S7HB 2FYRA 3V3MA 4F4OC 1IQHA 1KTSB 4CH2B 1TRMA 1IOEA 2BDCA 1BCUH 3NUMA 1SPJA 2ZECA 2ZDLA 3UFAA 4GHTA 3E16B 1O38A 1O3HA 5FPYA 4FUBA 4RKOB 2SGAA 2C90B 1G36A 1JXPA 1FPCH 1E38B 2J97A 2QC2A 1Y5UT 2Z9KA 3JZ1B 3AW1A 1ESBA 3SU2A 1P09A 2Q1JA 5FL7D 1HAPH 5EQSA 1XXFA 3D65E 5JBBS 1DS2E 3EE7A 1GBAA 2EEKA 2Y7ZA 4I86A 1BTYA 1KXFA 1RIWC 2CF8H 1C2FA 1O2YA 1GMDG 3MI4A 1P05A 3F6UH 2CN0H 3A89A 4X6OA 2XBXA 2ZO3H 3ZVAA 4I8KA 4ASUD 5AFZH 5TCCA 5IDKA 1XKBC 1GVZA 1OX1A 1V2KT 3SV6A 3EA9A 4ZXXH 1EB2A 5KEDA 1W0KD 2OQUA 3F2GA 1YPKH 4B6EA 6CHAC 4Q80A 2FXRA 1UVPA 1KDQA 2Y81A 2THFB 3MMGA 4B73A 4ZH8A 2RA0A 1QQUA 4A6LA 3VPKA 4CRDA 3RM0H 2ZPRA 5C67A 4CRBA 4Y10E 4GUXA 2A2QH 2OC8A 1P3CA 3KCGH 4CR5A 1E36B 1VITF 5FXLA 3KIDU 3PLKA 2ZA5A 1Q31A 3BTQE 4GCHF 2ZHFH 1MKWK 5E0JA 4YOIA 3RMNH 1SL3A 2W3IA 1O3KA 1VJAU 2FX6A 1SFQB 1J8AA 1KMHB 2XWBI 3TH2H 1P9SA 5DP8A 3RXQA 4JZIA 2ZP0H 1ELCA 1ID5H 1YPHE 2L6OA 4TY6A 2BZAA 4AZ2B 1WSSH 4ZKSU 3M3VA 2HLCA 2JDID 1L4ZA 1ZMJA 4IW4E 1EZQA 3ZYDA 2UWLA 4Q4LA 2JH5D 1ABJH 1GBTA 2A5AA 1FXYA 3CS0A 1QIXB 2ODQA 6ESTA 3PO1B 1SHHB 3QTOH 1MBQA 3AVZA 1XUIA 1UCYE 1AU8A 3GCTF 1NRRH 3DFJA 4FVDA 2FLRH 2ZFPH 3MHWU 4YXWD 1TNIA 1SHYA 1UK4A 2WINI 1FDPA 1O2UA 5CDFE 5JBCS 3EA7A 1WCZA 2F4LA 4BXSA 1T8OA 2XW9A 2YNAA 2ANMH 3BSQA 2XC0A 1YPGH 4K3JA 2UUYA 4TWYA 4ABFA 1K1JA 2QCYA 1L1NA 2RDLA 3HGNA 2PKSB 2TRMA 1K1NA 3UQOA 2PTNA 1LPKB 5EG4A 3LONA 1FY3A 5BPEA 1CGHA 3ATLA 2J98A 4K60A 5IK2D 2BDBA 3RXSA 4AFSA 1Z1IA 3SNAA 4BAKB 3P8FA 1C5RA 2BOHB 3K9XB 3UY9A 1WOFA 1SLVB 3SV2H 1DVAH 1GG6C 4I7YH 1XUFA 1WXRA 1BRAA 1O3DA 1QA0A 4IS5A 1EAXA 1GHVH 2BMGB 1F5KU 1C5XB 2WPHS 4X6NA 2OC7A 5EXNA 3TJOA 1GI3A 1EASA 5EIYA 4I32A 2GZ8A 1V3XA 2FOBA 2P16A 1CO7E 1P57B 3BTEE 1SGIB 3ATWA 5C20A 2QYIA 2UUFB 1AKSB 1W14U 1BTXA 3O8CA 2B7DH 1A5HA 5F6MA 4UFFH 4UONA 1VGCC 1RXPA 1V2NT 2ZU2A 3AW0A 1JRTA 3CNRA 1TGBA 1TB6H 1HAZB 2RA3A 2TGTA 2H6MA 1SGTA 1TNKA 1SQAA 1TRNA 2M5TA 4RT1A 4E06H 3U28C 1EQ9A 3TPIZ 1XXDA 1AZZA 2H2ZA 1YF4A 4MVNA 4F48B 1O2KA 1TQ0B 5GNDA 3GDVA 1HAOH 1V2OT 3RXDA 1H9LB 1YC0A 3TNSA 4AORA 1NFUA 2HPQH 5EXMA 2P8OB 3TH4H 1BTUA 4A92A 1RD3B 2V0BA 3LH3A 1NRQH 2NU3E 3LJJA 2GV7A 3UAIC 1MCVA 1TPAE 5FHTA 5EXLA 4K8YA 1DDJA 1THRH 1TPPA 3A8DA 5FCRA 1TBQH 4BAOB 1C5SA 1V2LT 2CMYA 3BEFB 3S9BA 1DOJA 1AUTC 3ZZ3A 1AHTH 3PROA 4NSYA 2VB0A 4NZQA 1HJAB 3UB0A 5A2MH 2XOKD 5J4SA 2OUAA 1JOUB 2C4FH 2R2MB 1X7AC 2V3OH 2KX4A 3NWUA 1YPJH 1GI1A 1WDIA 1GJBB 2OC1A 1O2IA 1FAXA 4OM9A 2H9TH 4INHA 1ETSH 4XBCA 1SB1H 3MU4A 1DUAA 1FV9A 1PPBH 2G4TA 4XBDA 2YMSB 1LVMA 1P12E 3RXPA 2QIQA 4MPXA 3MFJA 3UNSA 3NZIA 3PLPA 1UTPA 4WXVA 3LGYA 1P2KA 2XRCA 1RTLA 3RXLA 4Y8ZA 1SGFG 4AB8A 3M3SA 4BNRA 1ZGVA 3PWBA 4RKJB 3TIUA 3OEHD 1DWDH 1AFQC 1EAWA 1NY22 3MH4A 1UVSH 3SV9A 3ZZDA 3EGKH 2PP6A 3N7OA 1G37A 1GBEA 1AUJA 2ULLA 3AAUA 1O31A 3GY3A 3V13A 5L6NH 4AYVB 1SQRA 4TY7A 3SJIA 3TGJE 5CMXH 2F9OA 1P2IA 1O35A 1P04A 4O3TA 1MH0A 2ZFQH 4NA7A 3HPTB 2J38A 2GGVB 1TMUH 3SN8A 1O2TA 3A88A 1TA2A 1Z8JB 2FOAA 1N8OC 2HNTC 1GJ9B 3RU4E 4AC9A 5A09A 1LHEH 4X6PA 3ZZ4A 2XXLA 1EZXC 1OHHD 2R2WU 1VJ9U 1AFEH 4K8BA 4WWYA 4BOHA 1S81A 4YLUA 1TFXA 1O33A 5DN6D 3UOPA 1QNJA 1GJ7B 1C1UH 1MKWH 3SI4H 1O34A 3LKWA 1GI4A 1Z71A 3UWJH 1O2NA 9ESTA 3M5MA 1COWD 3SHCH 1W13U 4A5TS 5F8TA 3SI3H 3URCA 1DPOA 1BRBE 4NSVA 4AG2A 4ISLA 3MU5A 1AZ8A 2DE9A 2FI4E 4Y7BA 4INKA 8GCHF 1A3BH 2B8OH 2Z3CA 2VWOA 1W2KH 4XBBA 1O2XA 4NIYA 2PSYA 1S82A 1DY9A 1N6XA 4M7GA 4X0WU 3ITIA 1C1OA 1ZLRA 2IN2A 1NBMD 2J34A 2STAE 3U8RH 3GCNA 1E34B 1V2TT 1EATA 4ZHAA 2RG3A 4H4FA 2ZTZA 2A7HA 1FX0B 3T27A 1NROH 2XYAA 1TYNA 3Q3KA 3U1IB 1MABB 1PYTC 1C5MD 2HNTF 2VGCC 3ZVEA 1UHBB 1WBGB 4I8LA 2BOKA 2JKHA 1D3TB 1NM6A 2VWLA 4DJZB 2BY5X 3R0FA 2TGDA 6GCHG 1OWKA 4Y71A 1Z8GA 2GV6A 4D9QA 1JIMA 2GZ7A 1EZSC 3UR6A 3SU0A 1OYQA 1ZJDA 2BD4A 4MNWA 3BEIB 4VGCC 1QRZA 4KELA 5T1VA 1GL1A 3RXVA 1Q3XA 5C1YA 1SLWB 4WVPE 1NRPH 3TJUA 5DP9A 4JMYA 1FN8A 1ZPCA 2V35A 2OTVA 3TNTA 2Q6DA 1W3CA 4DURA 3GY4A 1CHOG 3BTDE 3MNBA 2J94A 1P8VC 1EPTC 3FN8A 4NIVA 1E0FD 1BJUA 4Y8YA 2P93A 7GCHF 3SUGA 1GL0E 1TNHA 1NN6A 1BBRH 3FOAA 1DWCH 2AGEX 1TX8A 4NFEA 4GPGA 1AKSA 1H4WA 2ZGCA 2FMJA 1UVTH 1ZZZA 3FO8D 1P01A 2GT7A 1TAWA 3EQ0H 4UFEH 5DO4H 1ORFA 2FO9A 4IC5A 4Q63A 3FVFB 3RM2H 3VEQB 3ZZ6A 1N6YA 4AN7A 2JH0D 4H6SB 1UTNA 2A45B 2DE8A 5EQRA 2VIPA 3W95A 5GCHF 1V2RT 2BD9A 4B2CA 2FESH 1O2JA 3GICB 2WSSD 5T6DA 3UR9A 3GS9A 3UQVA 1TNLA 2WPDD 2V6NA 1QURH 1KXDA 2WUBA 1H9HE 2WPKS 2ZHDA 2A4QA 3MTYA 1QRXA 2ALPA 2O8TA 1W10U 1LHGH 4JK5A 1M9UA 3RXOA 2PSXA 1OWIA 2BX3A 5FX5A 2BTCE 1RFNA 2EC9H 3MH6A 2IOTA 1BTWA 1WQVH 4MPWA 1W0YH 2WV4A 4GCHG 1BTHH 1P0SH 4KKDA 2HVYB 1MD7A 4UD9H 1OWHA 2JJ2D 1FONA 1ZMNA 1HAXB 3RXMA 5GPIB 1TABE 1WQSA 2J4IA 3PV5A 1CT0E 1TA6A 1LVOA 1O3NA 1P03A 1P2OA 1Q2WA 1QFKH 1T4UH 2Y82A 1G3DA 3RXKA 1W11U 1FQ3A 1OWDA 2F9UA 1DANH 1S6FA 2CJIA 4WMDA 1GJDB 2EI6A 5CHAC 1G9IE 1DITH 1QHRB 2ZQ1A 2UUKB 4HTCH 1AE8H 1OS8A 2H5CA 5G4BA 2FEQH 4X2VA 1C5YB 1C2IA 3VG8A 1BHXF 1HXFH 4YLQH 3HK6B 4BAMB 1EZUC 3HK3B 2P3FH 5DP5A 4ZXYH 1KLIH 4I31A 1UTMA 1LHDH 4I33A 1YLDA 1G3EA 3GCTG 2ZHEH 1C1QA 4F55A 1UTJA 1TNGA 1TLDA 4OS2A 5JB9S 1DUEA 2ZC9H 1V2ST 3GY5A 4LOYH 4AFZA 4I8JA 1ZPZA 1FZZA 1H8DH 2Y7XA 3ZVCA 4MG3A 1JMOH 2PUQH 2BLOA 2VWMA 1QB1A 2G00A 4Y0ZE 1XM1A 5DP6A 4ACAA 1SI5H 1C1WH 1G3CA 4P02A 1O2QA 1GBMA 3N7EA 1AN1E 4YTAA 3EE0B 1RJXB 4NIWA 3T29A 1A0LA 2GDEH 1MZDA 3U1JB 1JIRA 4X8UH 3ZIAD 1U6QA 4E05H 1IQKA 1YP9A 4FUDA 2ZDKA 4SGAE 1SSXA 1KXAA 1H1BA 1VGCB 3DSGA 4ZKRU 4Y0YE 5KECA 2W26A 3A8CA 1MAXA 4O97A 3H7OA 1DLKB 2UUJB 1ELDE 1TWXB 1XUHA 4JZFH 1KIGH 2OXSA 4H42U 3OX7U 2B5TB 1V2QT 1CBWC 3LDXH 1O3LA 2A32A 2WYJA 1UO6A 4MLFB 4Q7XA 4NIXA 2XC5A 2K8IA 3LT3A 2BLWA 3MO3A 5F8XA 1TGCA 1BMFD 1UTKA 3SYJA 1ELBA 2VVVA 2FODA 1AVXA 1GDUA 1GBCA 2HLDD 4O9VA 3GCHC 2XBWA 3DSPA 1ELFA 2EI7A 1J17T 1V6DA 1VZQH 1NTPA 2PGBB 1AY6H 1ZHPA 1ZRBA 1Y59T 3KF2A 3M5OA 1A4WH 3PRDA 4BANB 2BY8X 2VIOA 4WY3A 3AASA 3M35A 1PJPA 3KGPA 3P8NA 1DY8A 4B2AA 1BQYA 1FIZA 1SGRE 1C5WB 1L1JA 1ZSLA 5C5NA 1UHBA 3A86A 4ISNA 4E7NA 3F9HA 2QF5A 5C1XA 2QGRA 3VFEA 1NT1A 4GVUA 5C0UA 1AB9B 4UDWH 3E0NB 1OP2A 4ZKNU
chains in the Genus database with same CATH topology
4D7FA 5FPSA 3CENA 1GBBA 4ABEA 4YOJA 4X6MA 3L3TA 3GDSA 1EX3A 1RTKA 2I6QA 3QTVH 2G8TA 3BTME 1K9OE 1O39A 1RRKA 3VGCC 1BUIA 3RXCA 2FOFA 3A8BA 3UOUA 2GZ9A 5JYIA 2WPIS 2Z9IA 3HKIB 3ZVBA 3MO6A 2ZHWH 2P95A 4WF8A 3NK8A 4INLA 1Y3YA 3BIUH 1DWBH 2O8UA 1O2SA 3BTGE 4B76A 4ZHLU 2ZF0H 2AMQA 1MQ5A 2HRVA 2GD4B 2BDIA 1C9TA 1TBRH 1CA0B 1BA8B 1PPHE 2A4OA 2SGQE 1AD8H 8LPRA 5LH8A 5DJ7A 3UUZA 2Z3DA 1Y3UA 2WV5A 1ETTH 2G5NA 1ZTLA 3E6PH 1B0FA 3GYLB 1HAVB 1TBZH 5ABWA 3ZVFA 1ELGA 5FAHA 5A8XA 1GBJA 3DFLA 1Y3VA 1AVGH 2PUXB 3QUMP 5HGGA 1GHXH 1ELVA 3SUFA 1A2CH 1TOMH 2ZGHA 3BG4B 3FZZA 1IAUA 1F0TA 3KQBA 4BTUB 4Y79A 1IQEA 1MZAA 2CHAC 1MTVA 4IMZA 3T62A 1GMCF 1YPHC 1PQ7A 1NFWA 1O2OA 1DE7H 1HNEE 1P3EA 2ZIQH 2XTTB 1OWEA 3P17H 2FTMA 1FLEE 2Z6BD 2C3SA 2KAIB 2GCTB 1SBWA 1YKTA 2ZHQH 1C5TA 2OBQA 5EU8A 4XSKU 1FUJA 1T32A 1K28D 4AFUA 4CRGA 1GBLA 3PM3A 1AWFH 1FJSA 3PMJA 3FZDA 1OYTH 4MDSA 4FUIA 1O2PA 2PLXA 2BVSH 5HM2A 1GBHA 1O3OA 1BBRK 1GCTC 2VGCB 3SJ9A 1QBOA 3OYPA 3D23A 1F7ZA 4HFPB 1KSNA 5GJ4B 4QT8C 2Z3EA 3AAVA 2GVFA 3PTNA 3KN2A 1BMAA 2J92A 5FBIA 2VWNA 3LPRA 3ZV9A 3ZZ8A 1CT4E 1LVYA 3RXUA 1NC6A 3KQEA 1TGTA 3LC5A 2AYWA 3E1XB 1O2VA 5T6GA 1EAUA 1BIOA 1RGQA 4XOJA 5DK1A 1GVLA 2BVRH 3L33A 7ESTE 4X1NU 1MTNC 3F1SB 1HDTH 2DUCA 3RXRA 4X1QU 2JETC 2FPZA 4ZUHA 4RN6A 1FY4A 4AYYB 3GY7A 1S0QA 4Y7AA 1C4V2 4TWWA 2HWLB 2AMPA 1C2HA 3E90B 1ESAA 1KTTB 3QK1A 4X1RU 4F49A 1S0RA 3PMHB 4AGKA 2J95A 2IPHA 1A46H 2PGQB 1SGPE 2ZGJA 3MU0A 1FNIA 4KP0A 1QBNA 5B6OA 1C2DA 4MQAA 1CSOE 1C2JA 1XX9A 2FP7B 1L2EA 3TITA 2ZPQA 3A7ZA 2A4GA 1V2VT 4YOGA 1C1NA 2XBVA 1VR1H 4GAWA 1GJ4H 2Y5GA 3GY8A 1EB1H 3OSYA 1QB6A 1KLTA 1GWAA 1CA8B 4E7RG 1IHTH 3SJKA 4ASHA 4SGBE 1IQMA 1NFXA 3TLOA 4NG9H 1GHWH 1C2GA 3F9FA 2AERH 1GDNA 1C2LA 2PWXA 4IGDA 1O5BB 5ETXA 4D8NA 5GWZA 2XCFA 3KL6A 5JB8S 1E37B 2V3HH 1BMMH 2HPPH 4MNVA 1LO6A 2G5VA 2A5IA 3F9GA 1AIXH 1J15A 3VB4A 2ZNKH 1TIOA 4MTBA 4ABDA 1O3BA 5A0AE 1ZJKA 1QJ6B 3V7TA 4WH8A 1MTSA 1DSUA 4U30A 4ABAA 1GI5A 4B74A 3ZV8A 4FVBA 3BIVH 1LQEA 1DT2A 2WUCA 7KMEH 2D1JA 3Q76A 1DWEH 3GYMA 2VIWA 1ACBE 5GCHG 3VB3A 3C27B 4GSOA 1HXEH 1BMNH 4LK4A 4Z0KA 4BAQB 4X1SU 4A7IB 2SGPE 3O8RA 2OBOA 3RMMH 3SQEE 4U01A 1OPHB 1XUGA 2Y5HA 1KY9A 3HGPA 2A1DB 1DXWA 3BTTE 3QLPH 2NU4E 1HAHH 1HFDA 5EODA 1PYTD 2AH4X 4OS7A 1BRCE 2ODYB 2ZEBA 4CHAC 2SNVA 1AE5A 2C8ZB 1VCWA 1GBKA 1ANEA 1GI9B 2VH6A 1EOLA 1ZSKA 4O03A 4Z6AH 5ESBA 2R9PA 4R8TB 3NXPA 1PFXC 1GMHG 2W5EA 2WYGA 4K1EA 2BLQA 2FX4A 7LPRA 1QL8A 3SNDA 5JBTA 3ZZ9A 2G4UA 3RXJA 1UK3A 3H5CB 4H6TA 1Z7KA 1ZR0A 5TJXA 1CT2E 1K1MA 1L4DA 2ZDAH 2C8WB 1YCPM 1ABIH 4MPUA 3RMLH 2P3TB 3PO1C 1NO9H 2BXTH 2H5DA 5E8EH 1HAVA 2F9BH 3ELAH 5EW2H 1O2RA 1V2WT 1WAYB 3IWMA 2O9QA 1UTQA 1C1SA 2AS9A 1SGQE 2FYQA 4A1XA 1GGDB 5L2YH 3RXGA 3OTJE 2GT8A 1JWTA 4DT7B 2VVCA 4CBNA 4DW2U 1HRTH 1HAIH 2ZKSA 2SNWA 2ZI2H 4FUGA 3P8GA 4X8VH 1IQJA 8KME2 1PPFE 1QTFA 3BTWE 3WY8A 1DICA 4B71A 1ZSJA 1ZTJA 3SV7A 3T26A 3RLYH 2QA9E 4ABHA 1CVWH 2XBYA 4K2YA 2PKSC 5DP4A 2KAIA 1S83A 2FOGA 3ATIA 1TNJA 4ABGA 3I78A 1OP8A 3E91A 3ESTA 2SGFE 4MNYA 1TX7A 1A3EH 1BTPA 4JZEH 3CS7A 4KTUA 4THNH 4B2BA 3E0PB 1MU6B 2UWOA 5GIBA 4HI3A 1BITA 3A83A 3UTUH 5DKMA 1RIWB 1O3PB 3P95A 1UJ1A 3BTHE 1K1PA 2BD3A 1GHAF 2OLGA 3MH7A 1NRNH 4TPIZ 1WYKA 1GJ8B 1WTHD 1C5PA 1C9PA 1HAGE 1O2ZA 2ZZUH 1G3BA 2BD7A 1SC8U 4D7GA 3VB6A 2VIDA 1T31A 3GY6A 4U2WA 1YCPH 1SGFA 1THSH 3PB1E 5FX6A 1YYY1 1GJCB 2C93B 2F83A 2FTLE 4O3UA 6CHAB 2BB4A 3H7TA 2B0FA 1QY6A 3LOXA 1XUJA 1FAKH 1OSSA 1FIWA 5EW1H 1NU7B 2ZFFH 1ANCA 1J16A 1BT7A 2FIRH 1BBRE 1UCYK 1NS3A 3MOCA 4FUJA 1SGNE 4AX9H 4BXWA 2PV9B 1O3IA 4YZUA 3M7TA 2ZWLH 1ZOMA 3E3TA 1EOJA 3BTKE 1EP6A 3SUEA 3SJOA 1UTLM 1GJ5H 2ZTYA 1GJAB 3TGKE 3EAJA 4A1VA 1SLUB 1V2JT 4NCYA 3F68H 2VU8E 1TGNA 1EKBB 2VIVA 1B7XB 1D9IA 2F91A 4PROA 8ESTE 2XC4A 1P10A 4WMFA 3A7YA 4CR9A 1LKBA 1A0HB 4UFGH 4AFQA 2XWAA 4YESB 3VXEH 1VITG 1L1GA 1AMHA 2FI3E 3M5NA 2BDAA 5A8ZA 3ODDA 1GHBF 1S84A 1C5UA 1D3DB 2STBE 2ZDMA 4BTIB 4YT7H 1HJAC 1BJVA 2WPJS 4AOQA 1THPB 4NFFA 1GJ6A 1IQNA 1KYNA 2NU2E 2Z9LA 2R0LA 4J2YB 2BDHA 2CV3A 1O2WA 4IN1A 2CHAB 2W3KA 3A80A 1YM0A 2AEIH 5AFYH 1SGEE 1S5SA 1VCPA 3W94A 3QZQA 3LIWA 3D49H 4X2YA 1F0SA 1MMJN 3RC6A 2Z9GA 3LGUA 3ATKA 4OS4A 1LHCH 2G51A 1MD8A 2ZU4A 2P3UB 1MAYA 4Y76A 1C1PA 2BY6X 1ANBA 3DUXH 2Y80A 3UNQA 4A1TA 3DD2H 4UEHH 1XVMA 3T25A 3U8TH 2SGEE 3M37A 1HIAB 1QR3E 1TMBH 3PMAB 3HKJB 5CE1A 2TPIZ 3RU4T 1C4Y2 4YT6H 5I25A 1GG6B 5EPYA 3O8BA 1ZTKA 4ZAEA 4IC6A 5HXFA 1Y5BT 4GHQA 4Y8XA 3B9FH 1CHGA 4X8TH 1SG8B 2ANYA 3Q3XA 4KTSA 1FPHH 2A7CA 1T4VH 3RXHA 1VITH 3A87A 1O3JA 2LPRA 1YLCA 1D6RA 1YPEH 3ZZCA 1WTGH 4XE4A 3IG6B 2BZ6H 3MNSA 3C1KA 3EDXB 1O0DH 1GVKB 1NZQH 3PWCA 2JETB 3DHKH 2P59A 9LPRA 2HGTH 4IMQA 4WJG2 1HGTH 4K1SA 4Y6DA 4JYVH 6GCHF 1SGCA 1IQLA 1FY8E 3UIRA 2AIPA 1UTOA 1H8IH 1O3EA 3I77A 1Z6JH 1FI8A 1HCGA 1TX6A 3VXFH 1RTFB 2FOHA 4ISIH 5F8ZA 1C1TA 1P02A 1C2EA 3RP2A 1W7XH 3ZVDA 2QXHA 1D3QB 2FOCA 2XNIA 3ZZBA 1OP0A 3TJNA 3RC4A 4OS1A 1V2UT 4U32A 1IQIA 5C2ZA 1KXEA 2ASUB 2BYAX 4K69A 2AIQA 3K2UA 3G01A 4FU8A 1TALA 1GHYH 1SR5C 2BHGA 1P11E 1BOQA 4AB9A 3M36A 1O5EH 1FMGA 1F2SE 1O5AB 1K22H 4UFDH 1O3GA 1HAYB 3GOVB 3U98H 1OOKB 4WMEA 2OC0A 2ALVA 3M5LA 4X8SH 2QXIA 3NKKA 1PPZA 1E35B 1TRYA 5A0CA 5A8YA 1O5DH 3FANA 3M7UA 1P9UA 1EJAA 3LGVA 2FWWA 2TIOA 3ZVGA 1DXPA 3M7QA 3OY5U 3SNCA 5JDUB 1SQTA 2R3YA 3SQHE 4Q2KA 1YPLH 2A4RA 3RDZA 3RXTA 2D26C 4K5ZA 5JPMH 3SUDA 2PKAB 3QGNB 5JBAS 1A0JA 3SGQE 2ZU3A 5K0HA 2HALA 3K6YA 1J14A 1AFQB 1WUNH 3A8AA 1CE5A 4RSPA 2ZU1A 4FU7A 2GTBA 1LHFH 4ABIA 1Z8IB 1ARCA 1QCPA 3KEEA 1XKAC 2SFAA 2QF3A 2BLVA 1UVUH 1T8NA 2VJ1A 4CHAB 4HGCA 1TQ7B 1FY5A 1MKXK 2QY0B 5DP3A 5LGOA 2K1QA 2ZG0H 3V0XA 4ZHMU 2ODPA 2ZPSA 1N8OB 1IQFA 1KLJH 1A5GH 1W7GH 3LH1A 3P8OA 2AFQB 4KGAA 2JH6D 3EYDA 1NESE 3KQDA 3S7KB 3T2NA 4X2WA 3LC3A 5A0BA 3SNEA 1WU1A 1UCYH 4IBLH 3STIA 4CRAA 4D76A 2R0KA 4I8GA 1GI0A 1O5CB 1F0UA 4WH6A 3SO3A 2GMTC 3QX5H 1GHZA 1EXFA 2VINA 4OS6A 2PHBA 1ELTA 3LGIA 1C5LH 2F3CE 2VNTA 2FZZA 3P92A 5EPNA 2BXUH 1JBUH 1K1OA 1YCPK 4ZMAH 2G81E 1UMAH 4OGYA 1UVOA 1DSTA 1BRUP 4AG1A 1TMTH 4WXIA 4TYDA 3SU4A 4BAHB 4DIIH 3SV8A 1HYLA 1MTUA 4ZKOU 2W7SA 1PQ8A 5L2ZH 1QGFA 1QRWA 4BTTB 5GXPA 1GI7B 2FLBH 2BQWB 4Y11E 2BY7X 2Y5FA 2YOLA 1F5RA 2J2UA 4AGJA 1MQ6A 1L0ZA 2GCHF 4ZROA 2TBSA 1SLXB 3ENSB 8GCHG 2BDYA 2OP9A 2ZTXA 4JZDH 3RC5A 4VGCB 5LPRA 2QXJA 2H9HA 2FS9A 1HIAA 2D8WA 4JCNA 1HBTH 2BD8A 1QL9A 2BX4A 1LQDB 1PQ5A 5LPFA 4X2XA 5T3HA 1C5QA 2YNBA 5E0HA 1O2HA 2ZFRH 3A81A 2F9NA 2P94A 4DVAU 2G52A 3SHAH 1EPTB 5L30H 4J1YA 1LPZB 3TK5A 1ANDA 3TGIE 2A2XH 1A1RA 1GMDF 4XFQA 3QZRA 2SGDE 1P2NA 2ZCKP 3GDUA 2EA3A 1EP5A 1LMWB 3R3GB 2Y6TA 1SGDE 1PPEE 2Z94A 4FUCA 1MU8B 1GHAG 4KTCA 3RMOH 3SW2B 5IYTA 3ZYEA 3KHVA 3PLBA 5AVDA 1CU1A 3I29A 1BHXB 3Q00A 1C5VA 2FM2A 3IITA 4DCDA 1BTZA 1WV7H 2Z7FE 2ANKH 3S0NA 3U9AH 1EJNA 2GX4A 1QA7A 1AQ7A 1ETRH 3TVJB 4OS5A 5SGAE 3MWIU 7GCHG 2ESTE 5K7RA 3P6ZB 3RXEA 1TE0A 1N1LA 1S85A 3BF6H 4HZHA 3TK6A 4JZ1A 1NU9A 1GI2A 1ZHRA 1GBDA 2HVXA 1G32B 1ARBA 5DGJA 1SFIA 5EOKA 4UE7H 3A7XA 3FP7E 3SOSA 1HUTH 3BV9B 4YM9A 4IN2A 5T6FA 1H9IE 3K6ZA 2XCNA 3RXAA 3UREA 2F9PA 1KXBA 1T8LA 3SZNA 5HYOA 1T7CA 1BMLA 4NA9H 1AB9C 1C2KA 2VVUA 1QQ4A 3RXBA 2CGAA 3SNBA 1O32A 2O8WA 1HB0B 1C4U2 5CHAB 1FN6A 1V2MT 1Y3WA 3RU4D 2HNTE 3TH3H 2F9VA 3DA9B 1NFYA 3SORA 3QN7A 2R3UA 1Z6EA 3STJA 4FUFA 2AMDA 1NRSH 4LXBH 5EQQA 3M61U 2VIQA 1XMNB 2HOBA 3KQCA 1GHBG 1GPZA 2PKAA 1ELEE 3L6PA 1AGJA 3MO9A 4XDEA 1IHSH 2BM2A 3BEUA 4MNXA 3UPEA 2A7JA 1JRSA 3RLWH 1BB0B 1TPOA 3HATH 3SJ8A 4LZ1H 2ZCHP 2ZGBH 2AGGX 1EUFA 1SGYE 3TJVA 1CA0C 2ZFTA 3P70B 1B5GH 1ZHMA 1TONA 1BDAA 2ILNA 1C1MA 1P2MA 1SVPA 1GBIA 1QJ1B 5F03A 2A0QB 5BRRE 4ESTE 3NPSA 3A7VA 3MYWA 1O2MA 1F5LA 1CGIE 1T8MA 3B23B 3URDA 3VB5A 1O5GH 1HV7A 2J9NA 4NWKA 1P06A 3FAOA 3BG8A 4DIHH 3ZZ5A 1AVWA 3PTBA 1ZPBA 2IJOB 3E8LA 2VH0A 1LVBA 2NWNA 2CF9H 3PV4A 3BG4C 2BDGA 1HPGA 1G30B 2WPMS 3MH5A 4K1TA 2OCVB 4CRFA 5AF9H 5HM9A 1ZGIA 2PW8H 5H4IB 1CBWB 2PTCE 1O2LA 4NWLA 1MKXH 1P2QA 1CQQA 1O3CA 3QWCH 1IQGA