2NU1E

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I and Tyr18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
molecule keywords Streptogrisin B
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu1E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu1E01
4Y6DA 2VIVA 3UWJH 2Y5GA 5E2OA 3EQ0H 2J94A 1AZZA 4CRFA 1HAIH 4K5ZA 2G81E 3GYLB 4NZQA 1AWHB 1EPTA 1LHGH 4WF8A 1BRBE 4Q80A 2V3HH 1X7AC 1Y3VA 1MBMA 1GJDB 5C67A 1D3TB 2ZGXH 2O8LA 1MMJN 3BG4B 4TY7A 2F3CE 3JZ1B 1IQLA 1ARBA 1GWAA 2CHAB 2PTCE 2VIPA 1C2HA 4ZKNU 1HLTH 1YCPH 1NRRH 5CHAB 2XXLA 2FPZA 3D49H 1VITG 1A4WH 1O2UA 1ACBE 1J16A 2ZDAH 3NK8A 1V2JT 4H4FA 5AF9H 1EZUC 1FQ3A 1RIWB 5JBAS 1MTUA 1C5LH 4CRGA 1BOQA 1F5KU 3V7TA 3PV4A 3PO1C 2BD9A 2ZFPH 1LO6A 2CF8H 4JYVH 2BM2A 2ZC9H 3RXRA 1MTSA 1S82A 5TJXA 1DY8A 3M3TA 2GMTC 4BXWA 3E1XB 4JK6A 3L33A 1YPEH 1GJ5H 1QRWA 1HFDA 1O2HA 2XBWA 1CU1A 2RA3A 1EJAA 1F0SA 1AVWA 3HGNA 4HTCH 1DUAA 1NRSH 3SNEA 1QRZA 2Z9KA 2GCHF 4NSYA 1P09A 1BA8B 2JH5D 1O5FH 2OC1A 1O3PB 5EG4A 1HV7A 1T4UH 3TNSA 2IN2A 4K8YA 1TFXA 1BTHH 3LU9B 3URDA 7ESTE 2BTCE 1Z8GA 4GPGA 2FS9A 4K2YA 1C1MA 1ELCA 2ZPSA 2A4OA 2ILNA 1Y59T 1AZ8A 1YLCA 1P11E 1O32A 1CHGA 4X6MA 5A0CA 3SU4A 1P10A 1MAXA 1BMLA 1MQ5A 1SB1H 2WUBA 2GP9B 4BTTB 3RXDA 2QXGA 2NU2E 1BTPA 3GY5A 1O2ZA 3M5MA 2ZGCA 3P8NA 1CA0C 4KTCA 2G5VA 3UPEA 3I29A 5FXLA 1H8DH 3TJUA 2ZPQA 3HKIB 1O38A 2VIWA 4B2BA 3BEIB 3SV6A 5CE1A 4KGAA 3U8OH 2GT7A 2XWBI 3K9XB 4Q2KA 1DXPA 1KIGH 5IYTA 4AYVB 1SC8U 4I8JA 2QA9E 3TK6A 1O36A 2OINA 2UUYA 2A5IA 2STBE 4XDEA 2WPJS 1QCPA 1K2I1 1CGIE 1O3LA 4RKOB 1XMNB 3PMAB 5E0HA 1WYKA 1P04A 1V2RT 4ISIH 2TIOA 2G4UA 5JBTA 4WMEA 1HAZB 3PROA 3RXBA 1FN6A 4WH6A 2R0KA 4IS5A 2GCTC 1GHVH 3BG8A 2FO9A 3A7XA 3U69H 1EKBB 1UTPA 1QQUA 1EZSC 2BOKA 1ZHRA 2ZI2H 2FMJA 1SGDE 1W10U 3UQOA 3RLWH 1P0SH 5E0GA 3SW2B 2BX4A 4WMFA 4XOJA 4B73A 2Y6TA 3I78A 1SQTA 4K69A 3ZZ9A 4ABIA 1KSNA 1TB6H 3RXHA 2ZA5A 1BTWA 1PPBH 4MDSA 1GI4A 5JB8S 1AFQB 3VGCB 1UHBB 1CT2E 1MKWK 3BEUA 2BYAX 5IDKA 1ZHPA 2PUQH 1C5UA 4MPWA 3ZZ3A 1OWKA 1CT0E 3A8BA 4IMZA 2VGCC 2BY7X 1BT7A 4MLFB 4KTSA 3F6UH 2J92A 1K9OE 2H9EH 1RRKA 3SJIA 1QBOA 1E37B 4FUGA 4ZROA 3ZVDA 1XUKA 2HVXA 4OS4A 1TNJA 4OS1A 1HXEH 3BTWE 2Y7XA 1ZSKA 2GDDA 1EAXA 2YNBA 4O97A 1GGDC 1J9CH 3MNSA 4FUCA 3QWCH 5K0HA 1AI8H 2ZDNA 1GBKA 1QNJA 2KAIA 4Y76A 1UTOA 2AH4X 2H5CA 4YOIA 1SHYA 3A87A 1XUIA 2Q1JA 1BRUP 1SHHB 4K3JA 3OU0A 2SGDE 1O2OA 3UQVA 4I8KA 1EP6A 5HYOA 3SQEE 3M5LA 3A81A 2J9NA 4MPUA 5GWZA 1O2YA 1SGFA 3K6YA 3EA9A 5HM9A 1B0EA 2PR3A 3B8JA 3ODFA 4ABEA 2LPRA 1YPJH 3T26A 3QUMP 1QL7A 2YOLA 2A4RA 2P8OC 3MHWU 4WXIA 1MU6B 3LT3A 3GCOA 1TPSA 3RXCA 4CH8B 2PKSB 1EJNA 4WWYA 3KF2A 1Q3XA 1RS0A 1Z1IA 4ABAA 4U32A 1ANBA 1TYNA 3STIA 1EZQA 4DGJA 2FX4A 1EAUA 3NCLA 1KLIH 5L6NH 3HATH 1EZXC 1C1OA 1Z8IB 2R9PA 1HIAB 3DFJA 3V13A 2HNTF 5HMAA 2FODA 1D3QB 2FI4E 1LCYA 3SHAH 2VWLA 4LOYH 1TGBA 1QB9A 1C4Y2 3LC5A 1O3NA 1ETTH 4OS5A 4AGJA 2Z9LA 2BLOA 1UTMA 3S9AA 3QTVH 3S69A 2Y7ZA 2D2DA 1C5VA 1P12E 1BITA 4GSOA 3PTBA 1C2LA 1L1JA 2ZF0H 3ATLA 3G01A 1UK3A 3TH4H 1S6HA 4DOQA 1CVWH 1Y5UT 1SGCA 3A8AA 5EXNA 1GVZA 4IW4E 1Z6EA 2A0QB 1TNKA 3M3VA 1C5OH 1OYTH 1BBRE 5AVDA 4AORA 1L0ZA 5T6DA 3KQDA 1PPFE 2BVXH 2O8MA 2H2ZA 2F9VA 1WOFA 2PW8H 2CJIA 2RA0A 3A7WA 4DIIH 1GBMA 1SQAA 3RXLA 1YBWA 1C5XB 1HNEE 4ISNA 4Y7BA 2PKAB 3I77A 2PKSC 2H9TH 1CO7E 1QURH 1KXBA 3GISB 2B0FA 1HAOH 1LHEH 3LH3A 2BD2A 2P3TB 3BTTE 1V2ST 1S85A 2GX4A 3AW1A 1OWHA 4YLQH 2GKVE 4X1RU 2OQ5A 1ELFA 2D1JA 5GJ4B 1GHXH 1GBHA 3UIRA 2OD3B 2B8OH 4H42U 3M35A 1BHXB 1XM1A 2XWAA 1CHOG 2RG3A 4H6TA 5C20A 1HAGE 1VCQA 2BD5A 2XBYA 4ASHA 1QQ4A 3MNBA 1ELTA 2VH0A 3LGIA 1CA0B 1ZSJA 1O2QA 1CSOE 1TPOA 2FDAA 2FX6A 1TA2A 2CXVA 3DFLA 4FXGH 3RXUA 1OSSA 1SLUB 4UFFH 1PPEE 1QHRB 3E16B 3JZ2B 5FBIA 3F68H 1OKXA 4GCHG 1TABE 3BTQE 5EQSA 1HDTH 1G2MA 3SI3H 5C5NA 2ZPRA 3M7QA 4MNXA 3A89A 3KIDU 4TYDA 1K1MA 1SMFE 2CN0H 1MKWH 1FAXA 1FZZA 2ASUB 1ANEA 2R2WU 2Z3EA 2H9HA 3PYHA 4INHA 4TWYA 1AGJA 2OTVA 1KDQB 2Z6BD 2ZWLH 3KN2A 5C5OA 4DY7B 3O8DA 1V2PT 2TGAA 3SV7A 1O35A 1TOCB 2W26A 1QJ6B 4HGCA 3RXIA 2QXHA 1G32B 3AVZA 4I8HA 3RXSA 1TA6A 1AMHA 1JOUB 1BQYA 4I31A 1ABIH 3Q3KA 2ZDLA 1E36B 1BRCE 1DANH 5FCRA 3E0PB 3GCNA 1EB1H 2AGGX 1KTTB 1MTWA 1SSXA 4VGCC 3MNCA 4X1NU 3ZV8A 1GBDA 4CBOA 1AFQC 2W7SA 3LGTA 4ABFA 1V2LT 3VPKA 1GI1A 4NFEA 5GCHF 1INCA 1LVYA 1TLDA 3QK1A 3AAUA 3M5OA 1WAYB 5A8YA 1TGCA 2TPIZ 3PWBA 2SGEE 1BMNH 2ZHDA 6GCHG 2SGPE 3RXOA 1IHSH 2BDYA 3ZVFA 1W2KH 4AFQA 2BVRH 1V2NT 4NIXA 2B7DH 3TITA 1WCZA 2G4TA 2AERH 4FUJA 4XFQA 3Q76A 2QN5T 2QV1A 4ZH8A 3AASA 5G4BA 1GDQA 2A7HA 2ULLA 2WPLS 4XBCA 1SBWA 1NY22 1A1RA 1C1NA 1PQ8A 3RXKA 1CT4E 4DT7B 1S84A 4YLUA 1K1JA 1ZGVA 1CQQA 3A86A 3ESTA 1XVOA 1T4VH 1C5TA 3KNXA 3PTNA 1N8OB 2TGDA 2C3SA 1GPZA 1AB9B 4DG4A 4CRAA 1LPKB 2R3UA 1AU8A 1WBGB 4YT6H 2BQWB 4YOGA 2WYGA 4ABJA 3LC3A 4FUHA 8KME2 4IC5A 3U8RH 2ZQ1A 4X8SH 4BXSA 3MU5A 4Z6AH 4UEHH 8ESTE 2QGRA 4LZ1H 4J2YB 1H9IE 1AD8H 1ELAA 1UK2A 3QLPH 4Q7YA 1BJVA 1GJ6A 2BLVA 1K1PA 2OC7A 3TPIZ 4D7GA 3A84A 2ZFSA 2ZQ2A 1TRYA 1MZAA 1LPGB 2NU4E 2DE9A 3GDVA 3VB5A 2PHBA 1A0LA 1D3DB 4AZ2B 1C5SA 1L4DA 2XW9A 2WPKS 1OWDA 2F9BH 2ANMH 3SU2A 1C2EA 4O03A 1FPHH 1P2KA 1FY5A 3BTEE 1LVMA 3DD2H 1GMHG 4HZHA 5GDSH 2VVVA 1TMBH 1FAKH 2A2XH 4FVBA 4E7NA 1EATA 3TGJE 1A5IA 1QL8A 2ZZUH 1HIAA 1RGQA 3UOPA 5LGOA 1GI7B 2W7UA 3GY8A 1CE5A 4JZIA 2JETC 3S7KB 1Y3YA 3MNXA 1TMTH 3ZZ8A 3KQBA 2G51A 1GG6C 3PMBB 1A0JA 2GZ7A 2OLGA 5FHTA 2A7JA 5FCKA 4AG1A 2IJOB 4F4OC 5A8ZA 4U30A 1GI6A 2ODYB 2OBOA 1DM4B 3VGCC 4FU9A 4X2XA 1O2SA 1C9TA 2JH6D 1GL0E 1C5QA 1Y5AT 2ODPA 5AFYH 1AWFH 1F7ZA 1EOJA 1RJXB 4XBBA 3ZV9A 4NA9H 2AIQA 2W5EA 4GHQA 3F1SB 1J15A 1KTSB 4RKJB 4GCHF 1G30B 1O2IA 1TQ0B 1F0UA 1TBRH 3FP7E 1RTFB 3LGYA 3GOVB 4UFGH 4HFPB 1QGFA 1Z8JB 4AFUA 1FIWA 4NIWA 4Y8YA 4IMQA 3SV8A 3M36A 1OWIA 1IQGA 1MU8B 5F03A 1V2MT 2KAIB 2VIQA 2NU3E 2WV5A 3RC5A 4Y79A 3RMOH 4MNWA 1Y5BT 3ZZDA 4THNH 4ABHA 5I46H 3ODDA 1C2KA 2PWXA 1DWDH 1B7XB 5EU8A 4YESB 2AIPA 1XKAC 1TWXB 1O3EA 5C1UA 1A2CH 2AGIX 1NESE 4MNVA 1JIMA 2ANKH 3E6PH 3KHVA 1P3CA 3FVFB 1GGDB 2OBQA 3OYPA 4KTUA 1NPMA 1LHFH 1C2MA 2FOEA 5E0JA 5EOKA 3ZZ7A 2SGAA 2JH0D 3GY4A 2C8XB 2ZU1A 3NWUA 4H6SB 2EEKA 3RM2H 3ZVCA 1NFYA 1YLDA 3NPSA 3O8CA 1QA0A 1QJ1B 3MO3A 1BCUH 1QB1A 1SGQE 1O3OA 2F9OA 1FIZA 4X2WA 1O3CA 3SJ8A 2DE8A 2EA3A 3ZYDA 5J4QA 4Y0YE 1DVAH 1FY1A 3TH2H 1GBBA 1DT2A 3ZYEA 3OTJE 3ZVEA 4AB9A 7GCHF 4BTIB 1NU7B 2WYJA 2AMPA 1FNIA 1JRTA 1TNLA 2C8WB 1AFEH 1QB6A 2VWOA 1K22H 4ZKSU 1HGTH 4VGCB 3RXAA 4WJG2 1UTLM 1P01A 3SJOA 2Z9JA 1GBTA 3MO9A 1UVOA 4X2YA 3A7TA 2J34A 1FV9A 3P17H 1TRNA 4GHTA 5FBEA 4WVPE 1FN8A 1K1NA 2FS8A 2I6SA 1OP0A 1EXFA 1GVLA 2GV7A 3SZNA 5A8XA 1SI5H 1EASA 1C5MD 1DLEA 1VCWA 3ZVAA 1AVGH 1LVOA 1G2LA 1LHDH 1EP5A 3M3SA 1ZMNA 4NCYA 1AE5A 1HPGA 1QJ7B 2FTMA 1O30A 1GMDF 1G3EA 2FYQA 1PPGE 3PM3A 2FEQH 3DT0H 8GCHG 4X6NA 1O2NA 4E7RG 4X8TH 3NZIA 2HPPH 1ZTKA 4B74A 3SJ9A 3RUOA 2ZHEH 1PPZA 3TJOA 7KMEH 3MU4A 4MPXA 1L4ZA 1A0HB 1BTXA 4JZFH 5EW2H 1JRSA 2C4FH 2D8WA 3QN7A 2FYRA 4MVNA 5C2ZA 5T6GA 1C2JA 3C27B 2OQUA 1C1RA 2BLQA 2ZGBH 2ZHFH 2XRCA 3KQEA 1KYNA 1AKSA 1GHAG 4CR9A 5L30H 1S5SA 2HRVA 1BZXE 1GDUA 1AKSB 1F2SE 1PJPA 1IQEA 4BNRA 2V35A 3A85A 3DA9B 1GHBF 2ZO3H 2BY5X 2WPHS 1O5DH 4BAOB 3TGIE 3BV9B 1ZSLA 1BTYA 2QAAA 1TGSZ 2SGFE 1AUTC 4FUFA 1BTUA 1CBWC 2VIOA 3Q3YA 3UTUH 3HPTB 1O31A 5DP3A 4CBNA 3CS0A 1DS2E 2NWNA 4ISOA 3RXGA 4Z0KA 1ORFA 2XC0A 3UNSA 4NZLA 4OS2A 5EW1H 1HAPH 1P2JA 1QY6A 5C1YA 5JDUB 3F9FA 4XSKU 1UTQA 5L2YH 1VGCB 4A1TA 1GL1A 1PQ7A 2ANWA 1SL3A 1T8MA 4A5TS 1C4V2 1HYLA 1ELEE 5EODA 3KEEA 1GI3A 1TGNA 4INLA 3GYMA 1N1LA 2ALVA 1YM0A 1SGFG 3ZZ5A 2M5TA 2G55A 1IQHA 1DY9A 4ZUHA 2VNTA 3BSQA 2FXRA 1OOKB 1TBZH 1UCYH 2BXTH 1UK4A 1W11U 5F6MA 2EI8A 2ODQA 1W7XH 5ETXA 1O3FA 4ZXXH 1NTPA 4LZ4B 3GICB 3S7HB 1EUFA 1C2DA 3SU1A 1ZRKA 2PLXA 3A8DA 1BRAA 2VINA 3F9GA 1ELGA 3EA7A 3BTFE 1KXDA 1NFWA 3FZDA 2G52A 1GCDA 1ZMJA 5DG6A 1A3BH 1H8IH 1UO6A 3KGPA 2P8OB 1MUEB 3SO3A 1GJAB 1UVTH 2BXUH 5LPFA 1GG6B 3QGNB 2P16A 3ATIA 1JXPA 2BLWA 1XXFA 4AB8A 1O3KA 2Q6FA 1G3CA 2UUJB 3ATWA 1C1VH 1KLJH 4A92A 1CGJE 2A5AA 3FANA 1HAXB 1ZRBA 1XVMA 1B0FA 4NA8A 1HB0B 3TNTA 1FDPA 3SQHE 1MKXH 1P8VC 4TWWA 4I8GA 2ANYA 4X8UH 3SV2H 3GDUA 2ZCLP 1G9IE 1H4WA 5EQRA 1GI8B 1OP8A 3SOSA 2OP9A 1GJ8B 3P70B 1ELBA 1W8BH 1LMWB 4J1YA 5J4SA 1LPZB 1UCYK 1L1NA 2ZDKA 5GCHG 2Z9IA 3M5NA 1SGNE 4B2AA 2SFAA 1RTKA 1SGPE 3BN9A 1O3MA 2K1QA 2ESTE 4JZ1A 5DP7A 1FONA 1O2LA 5DP5A 3S9BA 1QBVH 1T31A 2PGBB 3GY3A 1O2MA 1PQ5A 3RU4E 1NC6A 2ZTYA 2BY6X 2NU0E 2BZAA 3U1IB 1IQMA 1ELDE 1NN6A 3RC4A 2FOBA 5A09A 1GBFA 2Z3DA 2Z9GA 2CGAA 2FLBH 1SFIA 2RDLA 4K8BA 4AYYB 1GHYH 3SV9A 5EGMA 1XUJA 2GCTB 5EXLA 2UUFB 1TNGA 3PWCA 2A4GA 1ZGIA 7GCHG 3VB4A 2BY8X 3B9FH 1YPHC 1HAHH 2B5TB 4NGAH 4B1TA 4ABBA 2A32A 1EB2A 1QRXA 3HKJB 1RTLA 3SU0A 1W3CA 4IC6A 2F9UA 1F0TA 1JBUH 4BAHB 3H7TA 4INKA 2PV9B 1XUHA 5E2PA 4CREA 1A5HA 4GVUA 2XC4A 1MBQA 3A80A 2QYIA 4Y8XA 1V2KT 3T28A 3EYDA 1TRMA 1KXAA 1GBIA 2PFEA 2RCEA 1YF4A 1O3JA 2J38A 2W3IA 4CRCA 1B5GH 3QDZB 5A2MH 1IQIA 4AN7A 4D7FA 4X2VA 4O3TA 1W13U 4NG9H 4AFSA 1TX6A 2J2UA 1RIWC 2EI7A 4JYTA 3UUZA 1EAWA 1VZQH 2F83A 2R3YA 1AY6H 4CRBA 3TK5A 4NA7A 1AB9C 1ETSH 6ESTA 1LHCH 3SI4H 2PSYA 4I7YH 1SGIB 1Y3XA 3E3TA 3SUFA 4NSVA 3PLPA 3E0NB 2P3FH 3TLOA 1NS3A 1GBAA 2XBVA 1UCYE 1ID5H 4Y8ZA 1FMGA 1C5NH 1KXEA 1TE0A 4AOQA 1YPMH 1HBTH 1K1LA 4O3UA 3RXVA 1QBNA 5FPTA 5A0AE 2F91A 4GAWA 1ZLRA 2Q6DA 5L2ZH 1WTHD 2TGPZ 3ENSB 1DITH 4DCDA 3TK9A 1MAYA 1P2QA 3GCHB 6CHAB 3LKWA 1PYTD 2FIRH 5T6FA 3P8GA 1J14A 4AX9H 1G3BA 1RFNA 1VJAU 1TGTA 3H5CB 2ZGHA 4UE7H 5EXMA 1A5GH 1DLKB 3NUMA 1GHBG 1PPCE 1W12U 1AN1E 2XNIA 3QGJA 3MO6A 4D9QA 1IQFA 2FZZA 4AG2A 1OP2A 2VVCA 2OXSA 5EPYA 1K1OA 4B71A 2O8WA 1MTNC 1SQOA 1LDTT 3UNRA 5DK1A 2FOMB 3NKKA 1FPCH 1O5EH 2DUCA 1KLTA 1FUJA 1FI8A 4NWKA 4BTUB 3D23A 1YKTA 6LPRA 1C4U2 1O2TA 3C1KA 3GCTG 1G37A 3SUEA 3MFJA 1NFUA 2G5NA 4DW2U 1MCVA 2FOFA 5FX6A 1E34B 3BIVH 2BHGA 3S9CA 1P2NA 3LGUA 4BAQB 1O2GH 1VITF 2WINI 4B2CA 2ZFTA 1ZTLA 3BTDE 1SG8B 3ZVGA 1DUEA 3MWIU 1T8LA 1NT1A 3BTHE 3RXEA 1TOMH 4K1TA 1A46H 1ZZZA 2ZEBA 3MMGA 3V3MA 1W14U 1THSH 1OX1A 1D3PB 3MI4A 1Y3WA 2FOHA 3LH1A 2HNTE 2QIQA 2OCVB 1J17T 3U1JB 3VEQB 1H1BA 1EQ9A 4A1VA 3MH5A 3AW0A 1DWCH 1QFKH 3QZRA 3IG6B 5JBBS 1P2OA 1QR3E 4ISLA 4R0IA 4TPIZ 1S6FA 2GZ9A 3MYWA 1TPAE 1KDQA 3T27A 1EAIA 4AGKA 1XX9A 2GD4B 3CS7A 2QXJA 4SGAE 3VFEA 1P05A 1V2UT 1FJSA 1AUJA 1C1UH 4DVAU 4FUDA 2A5KA 1EOLA 2GZ8A 4FUEA 1TALA 2VGCB 3V12A 3ZZAA 1SR5C 1DDJA 1GBCA 4CHAB 3RMNH 3UOUA 4BAMB 1A61H 3ATMA 2Y82A 1GBLA 2ZCKP 2A1DB 2BVSH 4FUIA 5DPAA 3PMHB 2GV6A 2Y5HA 2V6NA 1C9PA 1YPLH 3LJOA 2FTLE 1VJ9U 1CGHA 4D76A 1MZDA 1OWEA 4A7IB 1DOJA 2ZKSA 2ZTXA 1D9IA 4IN2A 4UDWH 1AIXH 3FP6E 1YCPM 2BQ6B 4D8NA 1KXCA 1PYTC 1JIRA 3ATKA 5CHAC 3QX5H 2PUXB 4DJZB 3RP2A 2P95A 5CMXH 3V0XA 1XUGA 1ABJH 3RLYH 4X6OA 3RM0H 1O2WA 1C2GA 3Q00A 1YPKH 3M7TA 4RN6A 2HWLB 1ZR0A 8GCHF 2PKAA 4ZKRU 3RXMA 1O5GH 1S0RA 1GHZA 2NU1E 1MD7A 1G36A 5SGAE 2ZU3A 3UY9A 2O8TA 1A3EH 3LDXH 3P8FA 1UTJA 4ZHLU 4LXBH 1DICA 1ARCA 5BPEA 1OYQA 4UFEH 1IAUA 4DURA 4ESTE 4OS6A 1Z71A 3DUXH 5K7RA 3QTOH 3GDSA 1YPGH 1KY9A 2B9LA 1S81A 4ABDA 2AGEX 1FY8E 4I8LA 2ZU2A 3ZVBA 4DIHH 2EC9H 2Z3CA 3IITA 5F8XA 2Z94A 1V2OT 5JYIA 2TBSA 3K6ZA 3PO1B 5LPRA 3MH4A 4KP0A 4WXVA 4Y7AA 3W94A 1GMCF 2Y80A 1O37A 1GCTB 3SNDA 1SGYE 1UVPA 1MD8A 1P02A 2GGVB 2VIDA 3OY6U 3ZZBA 2PGQB 2AMDA 1W0YH 1AVXA 1ZMLA 1L1GA 1BMMH 1F92A 4CR5A 1HRTH 1O3IA 1CHOF 3BIUH 2H6MA 2AMQA 4FU8A 2J4IA 1M9UA 4JYUH 3TJNA 1ZTJA 3NXPA 3UR6A 3BTME 2FM2A 3R0FA 5JBCS 2CF9H 1BB0B 2A31A 7LPRA 1S0QA 2BMGB 1P3EA 2BDHA 2G8TA 2VJ1A 1NU9A 3OSYA 1BBRH 2ZP0H 3GCTF 4OS7A 2PSXA 3VB7A 1D6RA 5T3HA 3SN8A 1W0ZU 2STAE 4WH8A 1T8OA 1TX8A 2O8UA 1ESAA 2HNTC 3P92A 1WUNH 4GUXA 4M7GA 1IHTH 3UR9A 4X1SU 3MOCA 1TMUH 1GJCB 1GJ4H 2R0LA 1VGCC 5LPEA 1Z7KA 1P2IA 9LPRA 4K1EA 5F8TA 4CRDA 4X6PA 4ABGA 1O2KA 1O3BA 1YCPK 1HJ8A 1MTVA 2HPQH 3VXFH 1N6YA 5F8ZA 3ZZ4A 1GCTC 1WTGH 3GCHC 3E90B 6CHAC 3U9AH 3MU8A 2HLCA 3LPRA 3U98H 3PLKA 2FI5E 5JPMH 3RXFA 5HXFA 4KELA 3OX7U 2P93A 4XE4A 4JCNA 2Q6GA 4X0WU 3K65B 3BTKE 3VB3A 1GMHF 1MCTA 1C5WB 2ZFRH 3EA8A 3BEFB 1GI9B 5HGGA 1HJAB 1FLEE 2F9NA 4NIYA 4NWLA 1UHBA 3HGPA 3KCGH 1XUFA 1T7CA 1BIOA 4OGXA 2ZNKH 4E05H 3SNCA 2D26C 5DGJA 3TIUA 3HK6B 1XKBC 3P95A 1PFXC 1AO5A 4ZHAA 1O5BB 3T25A 1O3HA 2ZFFH 3RDZA 5B6OA 1C5PA 1THPB 1GJ7B 4K1SA 1SLWB 1SOTA 2JETB 3ITIA 3SORA 2AEIH 3R3GB 4UD9H 1VR1H 3FAOA 1O5CB 5FX5A 1Z1JA 2BOHB 3A7VA 1C5YB 2GT8A 4YTAA 1ZOMA 3A83A 3ELAH 5FPSA 3GY2A 3KL6A 3WY8A 1DWBH 1SGRE 3SUGA 1OPHB 1BHXF 2C8YB 1GI5A 1V2WT 2HALA 1QTFA 2BDIA 4I32A 3A88A 2OC8A 1DWEH 3EDXB 4NIVA 1O3AA 1YC0A 2G00A 1NRPH 1ESBA 1IQNA 1QA7A 1XXDA 2QF0A 3U8TH 1DXWA 3SGQE 2BDBA 1F5RA 2BB4A 1J8AA 5ABWA 1ZJKA 3DHKH 1GVKB 3M37A 1BDAA 1GJBB 2WUCA 1E0FD 2C90B 1VITH 4ZHMU 1AE8H 1TIOA 1T8NA 5A0BA 1WQVH 1C1SA 1K21H 2FLRH 3EGKH 4Y10E 5AHGH 3RC6A 1BUIA 1TPPA 3D65E 4MTBA 5HM2A 2TRMA 1FY4A 4X1QU 2P94A 3MTYA 4IGDA 2UWOA 6GCHF 2ZECA 1IQJA 1O3DA 2TGTA 1QIXB 3N7OA 1SVPA 2AFQB 2FI3E 1NFXA 1ETRH 2GTBA 2CV3A 2FWWA 1GDNA 1F5LA 2SNVA 1TNIA 1LQEA 4FU7A 2XYAA 1A7SA 1GBEA 3MH6A 5TCAA 2FP7B 5C1XA 1DPOA 2XBXA 2AYWA 2A2QH 3KQCA 1K28D 4Q7ZA 2VWNA 4GLYA 4K60A 2ZTZA 1EPTC 1BBRK 2C93B 1Z8RA 4E06H 2A45B 5H4IB 1GMCG 3IWMA 4TY6A 2R2MB 1L2EA 3RU4D 3SU3A 1TNHA 3A7ZA 1H9LB 1YYY1 2H5DA 1UVSH 2BZ6H 3LIWA 2H1UA 1NRQH 2WPIS 2XC5A 1C1WH 2P59A 1NM6A 3RU4T 1V6DA 2VH6A 4MPVA 3GY7A 1P2MA 4YO9A 4YM9A 1D4PB 1VCPA 1THRH 3UFAA 2W3KA 4FUBA 1SOZA 2BX3A 3OY5U 4UONA 4LK4A 2THFB 1Q2WA 1U6QA 1YGCH 4Y11E 3QO6A 3M61U 4YT7H 1YP9A 3UREA 2FOAA 2JKHA 2XCNA 1HUTH 1ELVA 3O8BA 2F9PA 1KXFA 3PB1E 1F0RA 2BDAA 2CHAC 3EE0B 2SGQE 1ANCA 4WMDA 1O0DH 3E8LA 1C1TA 1O2RA 1EPTB 2ZHWH 1PPHE 2QC2A 2O9QA 3LONA 4MQAA 1GBJA 2QCYA 2GDEH 1ZPCA 3T2NA 2FOCA 4MG3A 4BAKB 1UTKA 5FAHA 1E38B 1OWJA 2LNCA 1O2PA 1V2QT 1V2TT 2FESH 3A8CA 3STJA 1DE7H 3F9EA 4I33A 2Y81A 2WPMS 4NFFA 2XCFA 3QZQA 3RMMH 1C5ZB 2Z7FE 2OC0A 2EI6A 2GMTB 5C3NA 4HI3A 1P06A 2ZU5A 2UWLA 2GCHG 2WV4A 1EJMA 3MH7A 3MU0A 3D62A 3W95A 4Q7XA 3Q77A 3F9HA 1MH0A 4IBLH 4JK5A 3ZZCA 3RMLH 1CBWB 3SNBA 4B76A 1C2IA 1HAVB 3T5FH 1UMAH 2BQ7B 2CMYA 1CA8B 1DSUA 1ESTA 2ZCHP 3P8OA 4KKDA 9ESTA 5DJ7A 2ZU4A 1NZQH 4YZUA 1P9SA 1UJ1A 5DO4H 1TQ7B 3Q3XA 2GVFA 1O2JA 5BRRE 4JZDH 2J95A 3EAJA 3T62A 2ZDVH 3FFGA 4JZEH 2P3UB 2V3OH 3B23B 1BMAA 5PTPA 1C1PA 1DX5M 2ALPA 2I6QA 3K2UA 1ZPBA 1EX3A 1O5AB 4IN1A 1O33A 2ZFQH 4QT8C 4PROA 2V0BA 4ZMAH 1HXFH 1SGTA 1GI2A 3PMJA 1AHTH 1S83A 2C8ZB 2VVUA 1T32A 1TBQH 1LVBA 1ZYOA 3TVJB 3CENA 3FP8E 1RXPA 2A7CA 1TAWA 1IOEA 3SBKA 1O2XA 1SGEE 3RXPA 3M7UA 5DP8A 1GJ9B 2Y5FA 4O9VA 3AAVA 4XBDA 3VB6A 1YPHE 3VXEH 2IOTA 4ZKOU 1G3DA 4BANB 1OS8A 5AFZH 2VWMA 2ZDMA 1NRNH 2BD4A 1LKAA 5DP6A 5EPNA 3SNAA 3O8RA 3LOXA 1RD3B 3P6ZB 3SGBE 4F49A 4CHAC 2HGTH 4TPYA 1NROH 3CP7A 5ESBA 2BDGA 1O34A 3TU7H 2SNWA 1V2VT 1UVUH 1Y8TA 2ZG0H 1E35B 1O3GA 2ZIQH 4B75A 1TONA 1Q31A 2BD8A 1UTNA 5ESTE 3MU1A 3SU5A 1GI0A 3LJJA 1ZJDA 2BDCA 1HJ9A 1TX7A 1LTOA 1GHAF 4U2WA 2QY0B 1PQAA 2HOBA 3SGAE 1WSSH 3BF6H 5GXPA 5JB9S 1JMOH 3TGKE 3RXJA 3SHCH 2YNAA 3TH3H 3S0NA 2XTTB 1Y3UA 4SGBE 1W7GH 3RXTA 2A4QA 2BY9X 1N8OC 1C5RA 2PTNA 4BOHA 3BG4C 1ZHMA 1MTNB 4A1XA 1GHWH 1SLVB 1WU1A 3HK3B 1H9HE 2OUAA 1Z6JH 4YOJA 3BTGE 3SUDA 4ZAEA 4MNYA 1OXGA 2UWPA 4Y71A 1P9UA 3FZZA 3LGVA 4ISHH 3ZZ6A 1GMDG 1LQDB 3E91A 2AS9A 1MQ6A 3SU6A 3TJVA 1C2FA 4U01A 3SJKA 1N6XA 4JMYA 1WV7H 1DFPA 2ZHQH 3URCA 1V3XA 3A7YA 3GY6A 3UWIA 4FVDA 1IQKA 4X1PU 5GIBA 5DKMA 2QF3A 1C1QA 1D6WA 4OGYA 1WQSA 1BJUA 3T29A 1FY3A 1NO9H 4R8TB 3UNQA 2BD3A 4X8VH 1DSTA 4A6LA 1SPJA 1HAYB 4UFDH 2VB0A 4ZXYH 1LKBA 5LH8A 1FXYA 8LPRA 1BTZA 1SLXB 5I25A 1O2VA 4D9RA 5EQQA 4Y0ZE 1P03A 2FOGA 3PLBA 5GPIB 1HAVA 1P57B 4AFZA 1SFQB 2QXIA 1ZPZA 4CH2B 1K1IA 3LGWA 2VU8E 1HCGA 1MKXK 3L6PA 1QL9A 5DP9A 2UUKB 2IPHA 1ANDA 3A82A 3H7OA 4RSPA 5TCCA 3RXQA 1JWTA 2ZGJA 1O39A 1AQ7A 1HJAC 4WY3A 2BD7A 3L3TA 5E8EH 5DP4A 5FPYA
chains in the Genus database with same CATH superfamily
4Y6DA 2VIVA 3UWJH 2Y5GA 5E2OA 3EQ0H 2J94A 1AZZA 1YLNA 4CRFA 1HAIH 4K5ZA 4YXWD 2G81E 3GYLB 4NZQA 1AWHB 1EPTA 1LHGH 4WF8A 1BRBE 4Q80A 2V3HH 1X7AC 1Y3VA 1MBMA 1GJDB 5C67A 1D3TB 2ZGXH 2O8LA 1MMJN 3BG4B 4TY7A 2F3CE 3JZ1B 1IQLA 1ARBA 1GWAA 2CHAB 2PTCE 2VIPA 1C2HA 4ZKNU 1HLTH 1YCPH 1NRRH 5CHAB 2XXLA 2FPZA 1NBMD 3D49H 1VITG 1A4WH 1O2UA 1ACBE 1J16A 2ZDAH 3NK8A 1V2JT 4H4FA 5AF9H 1EZUC 1FQ3A 1RIWB 5JBAS 1MTUA 1C5LH 4CRGA 1BOQA 1F5KU 3OE7D 3PV4A 3PO1C 3V7TA 2BD9A 2ZFPH 1LO6A 2CF8H 4JYVH 2BM2A 2ZC9H 3RXRA 1MTSA 1S82A 5TJXA 1W0KD 1DY8A 3M3TA 2GMTC 4BXWA 3E1XB 4JK6A 3L33A 1YPEH 1GJ5H 1QRWA 1HFDA 1O2HA 2XBWA 1CU1A 2RA3A 1EJAA 1F0SA 1AVWA 4FOUC 3HGNA 4HTCH 1DUAA 1NRSH 3SNEA 1QRZA 2Z9KA 2GCHF 4NSYA 1P09A 1BA8B 2J98B 2JH5D 1O5FH 2OC1A 1O3PB 5EG4A 1HV7A 1T4UH 5T1VA 3TNSA 2IN2A 4K8YA 1TFXA 1BTHH 3LU9B 3URDA 7ESTE 2BTCE 1Z8GA 4GPGA 2FS9A 4K2YA 1C1MA 1ELCA 2ZPSA 2A4OA 2ILNA 1Y59T 1AZ8A 1YLCA 1P11E 1O32A 1CHGA 2KCOA 4X6MA 5A0CA 3SU4A 1P10A 1MAXA 1BMLA 1MQ5A 1SB1H 2WUBA 3U28C 2GP9B 4BTTB 3RXDA 2QXGA 2NU2E 1BTPA 3GY5A 1O2ZA 3M5MA 2ZGCA 3P8NA 4DT4A 1CA0C 4KTCA 2G5VA 3UPEA 3I29A 5FXLA 1H8DH 3TJUA 2ZPQA 3HKIB 3KQ5A 4Z1MD 3DSPA 1O38A 2VIWA 4B2BA 3BEIB 3SV6A 5CE1A 4KGAA 3U8OH 2GT7A 2XWBI 3K9XB 4Q2KA 1DXPA 1KIGH 5IYTA 4AYVB 1SC8U 4I8JA 2QA9E 3TK6A 1O36A 2OINA 2UUYA 2A5IA 2STBE 4XDEA 2WPJS 1QCPA 1K2I1 1CGIE 3FOAA 1O3LA 4RKOB 1XMNB 3PMAB 5E0HA 1WYKA 1P04A 1V2RT 4ISIH 2TIOA 2G4UA 5JBTA 4WMEA 1HAZB 3PROA 5KECA 3RXBA 1FN6A 3GS9A 4WH6A 2R0KA 4IS5A 2GCTC 1GHVH 3BG8A 2FO9A 3A7XA 3U69H 1EKBB 1UTPA 1QQUA 1EZSC 2BOKA 1ZHRA 2ZI2H 2FMJA 1SGDE 1W10U 3UQOA 3RLWH 1P0SH 5E0GA 3SW2B 2BX4A 4WMFA 4XOJA 4B73A 2Y6TA 3I78A 1SQTA 4K69A 3ZZ9A 4ABIA 1KSNA 1TB6H 3RXHA 2ZA5A 1BTWA 1PPBH 2L6OA 4MDSA 1GI4A 5JB8S 1AFQB 3VGCB 1UHBB 1CT2E 1MKWK 3BEUA 2BYAX 5IDKA 1ZHPA 2PUQH 1C5UA 4MPWA 3ZZ3A 1OWKA 1CT0E 3A8BA 4IMZA 2VGCC 2BY7X 1BT7A 4MLFB 4KTSA 3F6UH 2J92A 1K9OE 2H9EH 1RRKA 3SJIA 1QBOA 1E37B 4FUGA 4ZROA 3ZVDA 1XUKA 2HVXA 4OS4A 4TSFD 1TNJA 4OS1A 1HXEH 3BTWE 2Y7XA 1ZSKA 2GDDA 1EAXA 2YNBA 2PP6A 4O97A 1GGDC 1J9CH 1UW7A 3MNSA 4FUCA 3QWCH 5K0HA 1AI8H 2ZDNA 2J5UA 1GBKA 1QNJA 2KAIA 4Y76A 1UTOA 2AH4X 2H5CA 4YOIA 1SHYA 3A87A 1XUIA 2KR7A 1BRUP 1SHHB 2Q1JA 4K3JA 3OU0A 4P02A 2SGDE 1O2OA 3UQVA 4I8KA 1EP6A 5HYOA 3SQEE 3M5LA 3A81A 2J9NA 4MPUA 5GWZA 1O2YA 1SGFA 3K6YA 3EA9A 5HM9A 3OEHD 1B0EA 2PR3A 3NRLA 3B8JA 3ODFA 4TT3D 4ABEA 2LPRA 1YPJH 5EJLA 3T26A 3QUMP 1QL7A 2YOLA 2A4RA 2P8OC 3MHWU 4WXIA 1MU6B 3LT3A 3GCOA 1TPSA 3RXCA 4CH8B 2PKSB 1EJNA 4WWYA 2F43B 3KF2A 1Q3XA 1RS0A 1Z1IA 4ABAA 4U32A 1ANBA 1TYNA 1E79D 3STIA 1EZQA 4DGJA 2FX4A 1EAUA 3NCLA 1KLIH 5L6NH 3HATH 1EZXC 1C1OA 1Z8IB 1K0HA 2R9PA 1HIAB 3DFJA 3V13A 2HNTF 5HMAA 2FODA 1D3QB 2FI4E 1LCYA 3SHAH 2VWLA 4LOYH 1TGBA 1QB9A 3OEED 3EE7A 1C4Y2 3LC5A 1O3NA 1ETTH 4OS5A 4AGJA 2Z9LA 2BLOA 1UTMA 3S9AA 3QTVH 3S69A 2Y7ZA 2D2DA 1C5VA 1P12E 1BITA 4GSOA 3PTBA 1C2LA 1L1JA 2ZF0H 3ATLA 3G01A 1UK3A 3TH4H 1S6HA 4DOQA 1CVWH 4FETA 1Y5UT 1SGCA 3A8AA 5EXNA 1GVZA 4IW4E 1Z6EA 2A0QB 4ACBA 1TNKA 3M3VA 1C5OH 1OYTH 1BBRE 3W1EA 5AVDA 4AORA 1L0ZA 5T6DA 3KQDA 2YMSB 1PPFE 2BVXH 2O8MA 2IJD1 2H2ZA 2F9VA 1WOFA 2PW8H 2CJIA 2RA0A 3A7WA 4DIIH 1GBMA 1SQAA 3RXLA 1YBWA 1C5XB 1HNEE 3H09A 4ISNA 4Y7BA 2PKAB 3I77A 2PKSC 2H9TH 2WSSD 1CO7E 1QURH 1KXBA 3GISB 2B0FA 1HAOH 1LHEH 3LH3A 2BD2A 2P3TB 3BTTE 1V2ST 1S85A 2GX4A 3AW1A 3CNRA 1OWHA 4YLQH 2GKVE 3WWBA 4X1RU 2OQ5A 1ELFA 2D1JA 3FN8A 3N7DA 5GJ4B 1GHXH 1GBHA 3UIRA 2OD3B 2B8OH 4H42U 3M35A 1BHXB 1XM1A 2XWAA 1CHOG 2RG3A 4H6TA 5C20A 1HAGE 1VCQA 2BD5A 4RI0A 2XBYA 4ASHA 1QQ4A 3MNBA 1ELTA 2VH0A 3LGIA 1CA0B 1ZSJA 1O2QA 1CSOE 1TPOA 2FDAA 2FX6A 1TA2A 2CXVA 3DFLA 4FXGH 3RXUA 1OSSA 1SLUB 4UFFH 1PPEE 1QHRB 3E16B 3JZ2B 5FBIA 3F68H 1OKXA 4GCHG 1TABE 3BTQE 5EQSA 1HDTH 1G2MA 3SI3H 5C5NA 2ZPRA 3M7QA 4HG6A 4MNXA 3A89A 3KIDU 4TYDA 1K1MA 1SMFE 2CN0H 1MKWH 1FAXA 1FZZA 2ASUB 1ANEA 2R2WU 2Z3EA 2H9HA 3PYHA 2WV9A 4INHA 4TWYA 1AGJA 2OTVA 1KDQB 2Z6BD 2ZWLH 3KN2A 5C5OA 4DY7B 3O8DA 1V2PT 2TGAA 3SV7A 1O35A 1TOCB 2W26A 1QJ6B 4HGCA 3RXIA 3DSGA 2QXHA 1G32B 3AVZA 4I8HA 3RXSA 1TA6A 1AMHA 2IPQX 1JOUB 1BQYA 4I31A 1ABIH 3Q3KA 2ZDLA 5FL7D 1E36B 1BRCE 1DANH 5FCRA 3E0PB 3GCNA 1EB1H 2AGGX 1KTTB 1MTWA 1SSXA 4VGCC 3MNCA 4X1NU 5CHBA 3ZV8A 1GBDA 4CBOA 1AFQC 2W7SA 3LGTA 4ABFA 2QF5A 1V2LT 3VPKA 1GI1A 4NFEA 5GCHF 1INCA 1LVYA 1TLDA 3QK1A 3AAUA 2WHXA 3M5OA 1WAYB 5A8YA 1TGCA 2TPIZ 3PWBA 2SGEE 2KCYA 1BMNH 2ZHDA 6GCHG 2SGPE 3RXOA 1IHSH 2BDYA 3ZVFA 1W2KH 4AFQA 2BVRH 1V2NT 4NIXA 2QF4A 2B7DH 3TITA 1WCZA 2G4TA 2AERH 4FUJA 4XFQA 3Q76A 2QN5T 2QV1A 4ZH8A 3AASA 5G4BA 1GDQA 2A7HA 2ULLA 2VBCA 2WPLS 4XBCA 1SBWA 1H8ED 1NY22 1A1RA 2EY4C 1C1NA 1PQ8A 3RXKA 1CT4E 2V7QD 4AC9A 4DT7B 1S84A 4YLUA 1K1JA 1ZGVA 1CQQA 3A86A 3ESTA 1XVOA 1T4VH 1C5TA 3KNXA 3PTNA 1N8OB 2TGDA 2C3SA 1GPZA 1AB9B 4DG4A 4CRAA 3PV5A 1LPKB 2R3UA 1AU8A 1WBGB 4YT6H 2BQWB 4YOGA 2WYGA 4ABJA 3LC3A 4FUHA 8KME2 4IC5A 3U8RH 2ZQ1A 4X8SH 4BXSA 3MU5A 4Z6AH 4UEHH 5EJZA 8ESTE 2QGRA 4LZ1H 4J2YB 1H9IE 2XOKD 1AD8H 1ELAA 1UK2A 3QLPH 4Q7YA 1BJVA 1GJ6A 2BLVA 1K1PA 2OC7A 3TPIZ 4D7GA 3A84A 2ZFSA 2ZQ2A 1TRYA 1MZAA 1LPGB 2NU4E 2DE9A 3GDVA 3VB5A 2RFKC 2PHBA 1A0LA 1D3DB 4AZ2B 1C5SA 1L4DA 2XW9A 2WPKS 1OWDA 2F9BH 2ANMH 3SU2A 1C2EA 4O03A 1FPHH 1P2KA 2K0QA 1FY5A 3BTEE 5IK2D 1LVMA 3DD2H 1GMHG 4HZHA 5GDSH 1YWUA 2VVVA 1TMBH 1E1RD 1FAKH 2A2XH 4FVBA 4E7NA 1EATA 3TGJE 1A5IA 1QL8A 2ZZUH 1HIAA 1RGQA 3UOPA 5LGOA 1GI7B 2W7UA 3GY8A 1CE5A 4JZIA 2JETC 3S7KB 1Y3YA 3MNXA 1TMTH 3ZZ8A 3KQBA 2G51A 1GG6C 3PMBB 1A0JA 2GZ7A 2OLGA 5FHTA 2A7JA 5FCKA 4AG1A 2IJOB 4F4OC 5A8ZA 4U30A 1GI6A 2ODYB 2OBOA 1DM4B 3VGCC 4FU9A 1VKYA 4X2XA 1O2SA 1C9TA 1YY3A 2JH6D 1GL0E 1C5QA 1Y5AT 2ODPA 5AFYH 1AWFH 1F7ZA 1EOJA 1RJXB 4XBBA 3ZV9A 4NA9H 2AIQA 2W5EA 4GHQA 3F1SB 1J15A 1KTSB 1SKYE 4RKJB 3WW7A 4GCHF 1G30B 1O2IA 1TQ0B 1F0UA 1TBRH 3FP7E 1RTFB 3LGYA 3GOVB 4UFGH 4HFPB 1QGFA 1Z8JB 4AFUA 1FIWA 2KM0A 4NIWA 4Y8YA 4IMQA 3SV8A 3M36A 1OWIA 1IQGA 1MU8B 5F03A 1V2MT 2KAIB 2VIQA 3FO8D 2NU3E 2WV5A 3RC5A 4Y79A 3RMOH 4MNWA 1Y5BT 2K8IA 4THNH 3ZZDA 4ABHA 5I46H 3ODDA 1C2KA 2PWXA 1DWDH 1WDIA 1B7XB 3OAAD 5EU8A 4YESB 2AIPA 1XKAC 1TWXB 1O3EA 5C1UA 1A2CH 2AGIX 1NESE 4MNVA 1JIMA 2ANKH 3E6PH 3KHVA 1P3CA 3FVFB 1GGDB 2OBQA 3OYPA 4KTUA 1NPMA 1LHFH 1C2MA 2FOEA 5E0JA 5EOKA 3ZZ7A 2SGAA 2JH0D 3GY4A 2C8XB 2ZU1A 3NWUA 4H6SB 2EEKA 3RM2H 3ZVCA 1NFYA 1YLDA 4F55A 3NPSA 3O8CA 1QA0A 1QJ1B 3MO3A 1BCUH 1QB1A 1SGQE 1O3OA 2F9OA 1FIZA 4X2WA 1O3CA 3SJ8A 2DE8A 2EA3A 3ZYDA 5J4QA 4Y0YE 1DVAH 1FY1A 3TH2H 1GBBA 1DT2A 3ZYEA 3OTJE 3ZVEA 4AB9A 7GCHF 4BTIB 1NU7B 2WYJA 2AMPA 1FNIA 1JRTA 1TNLA 2C8WB 1AFEH 1QB6A 2VWOA 1K22H 4ZKSU 1HGTH 4VGCB 4M9FA 3RXAA 4WJG2 1UTLM 1P01A 3SJOA 2Z9JA 1GBTA 3MO9A 1UVOA 4X2YA 3A7TA 2J34A 1FV9A 3P17H 1TRNA 3F2HA 4GHTA 5FBEA 4WVPE 1FN8A 1K1NA 2FS8A 2I6SA 1OP0A 1EXFA 1GVLA 2GV7A 3SZNA 5A8XA 1SI5H 3AK5A 1EASA 1C5MD 1DLEA 1VCWA 3ZVAA 1AVGH 1LVOA 1G2LA 1LHDH 1EP5A 3M3SA 1ZMNA 4NCYA 1AE5A 1HPGA 1QJ7B 2FTMA 1O30A 1GMDF 1G3EA 2FYQA 1PPGE 3PM3A 2FEQH 3DT0H 8GCHG 4X6NA 1O2NA 4E7RG 4X8TH 3NZIA 2HPPH 1ZTKA 4B74A 3SJ9A 3RUOA 2ZHEH 1PPZA 3TJOA 7KMEH 3MU4A 4MPXA 1L4ZA 1A0HB 1BTXA 2F4LA 4JZFH 5EW2H 1JRSA 2C4FH 2D8WA 3QN7A 2FYRA 4MVNA 5C2ZA 5T6GA 1C2JA 3C27B 2OQUA 1C1RA 2BLQA 2ZGBH 2ZHFH 2XRCA 3KQEA 1KYNA 1AKSA 1GHAG 4CR9A 5L30H 1S5SA 2J98A 2HRVA 1BZXE 1GDUA 1AKSB 1F2SE 1PJPA 1IQEA 4BNRA 2V35A 3A85A 3DA9B 1GHBF 2ZO3H 2BY5X 2WPHS 1O5DH 4BAOB 3TGIE 3BV9B 1ZSLA 1BTYA 2QAAA 1TGSZ 2OK5A 2SGFE 1AUTC 4FUFA 1BTUA 1CBWC 4B6EA 2VIOA 3Q3YA 3UTUH 3HPTB 1O31A 5DP3A 4CBNA 3CS0A 5C0TA 1DS2E 2NWNA 4ISOA 3FKSD 3RXGA 3F0OA 4Z0KA 1OHHD 1ORFA 2XC0A 3UNSA 4NZLA 4OS2A 5EW1H 1HAPH 1P2JA 1QY6A 5C1YA 1MABB 5JDUB 3F9FA 4XSKU 2LP6A 1UTQA 5L2YH 1VGCB 4A1TA 1GL1A 1PQ7A 2ANWA 1SL3A 1T8MA 4A5TS 1C4V2 1HYLA 1ELEE 5EODA 3KEEA 1GI3A 3VG8A 1TGNA 4INLA 3GYMA 1N1LA 2ALVA 1YM0A 1SGFG 3ZZ5A 2M5TA 2G55A 1IQHA 1DY9A 4ZUHA 2VNTA 3BSQA 2FXRA 1OOKB 1TBZH 1UCYH 2BXTH 1UK4A 1W11U 5F6MA 2EI8A 2ODQA 1W7XH 5ETXA 2JJ1D 1O3FA 4ZXXH 1NTPA 4LZ4B 3GICB 3S7HB 1EUFA 1C2DA 3SU1A 1ZRKA 2PLXA 3A8DA 1BRAA 2VINA 3F9GA 1ELGA 3EA7A 3BTFE 1KXDA 1NFWA 3FZDA 2G52A 1GCDA 1ZMJA 5DG6A 1A3BH 1H8IH 1UO6A 3KGPA 2P8OB 1MUEB 3SO3A 2QE7D 1GJAB 1UVTH 2BXUH 4ASUD 5LPFA 3N7EA 1GG6B 3QGNB 2P16A 3ATIA 1JXPA 2BLWA 1XXFA 4AB8A 1O3KA 2Q6FA 1G3CA 2UUJB 3ATWA 1C1VH 1KLJH 4A92A 2AHME 1S6LA 1CGJE 2A5AA 3FANA 1HAXB 1ZRBA 1XVMA 1B0FA 4NA8A 1HB0B 3TNTA 1FDPA 3SQHE 1MKXH 1P8VC 4TWWA 4I8GA 2ANYA 4X8UH 3SV2H 3GDUA 2ZCLP 1G9IE 1H4WA 5EQRA 1GI8B 1OP8A 3SOSA 2OP9A 1GJ8B 4I86A 3P70B 1ELBA 1W8BH 1LMWB 4J1YA 5J4SA 1LPZB 1UCYK 1L1NA 2ZDKA 5GCHG 2Z9IA 3M5NA 1SGNE 4B2AA 2SFAA 1RTKA 1SGPE 3BN9A 1O3MA 2K1QA 2ESTE 4JZ1A 5DP7A 1FONA 1O2LA 5DP5A 3S9BA 1QBVH 1T31A 2PGBB 3GY3A 1O2MA 1PQ5A 3RU4E 2KFWA 5DSFA 1NC6A 2ZTYA 2BY6X 2NU0E 1W0JD 2BZAA 3U1IB 1IQMA 1ELDE 1NN6A 3RC4A 2FOBA 5A09A 1GBFA 2Z3DA 2Z9GA 2CGAA 2FLBH 1SFIA 2RDLA 4K8BA 4AYYB 1GHYH 3SV9A 5EGMA 1XUJA 2GCTB 5EXLA 2UUFB 1TNGA 3PWCA 2A4GA 1ZGIA 7GCHG 3VB4A 2BY8X 3B9FH 1YPHC 1HAHH 2B5TB 4NGAH 4B1TA 4ABBA 2A32A 1EB2A 2KCPA 1QRXA 3HKJB 1RTLA 4RT1A 3SU0A 1W3CA 4IC6A 2F9UA 1F0TA 1JBUH 4XD7D 4BAHB 3H7TA 4INKA 2PV9B 1XUHA 5E2PA 4CREA 1A5HA 4GVUA 2XC4A 1MBQA 3A80A 2QYIA 4Y8XA 1V2KT 3T28A 3KYFA 3EYDA 1TRMA 1KXAA 1GBIA 2PFEA 3DCLA 4RT0A 2RCEA 1YF4A 1O3JA 2J38A 2W3IA 4CRCA 1B5GH 3QDZB 5A2MH 1IQIA 4AN7A 4D7FA 4X2VA 4O3TA 1W13U 4NG9H 4AFSA 1TX6A 2J2UA 1RIWC 2EI7A 4JYTA 3UUZA 1EAWA 1VZQH 2F83A 2R3YA 1AY6H 4CRBA 3TK5A 5CDFE 4NA7A 1AB9C 1ETSH 6ESTA 1LHCH 3SI4H 3UB0A 2PSYA 4I7YH 1SGIB 1Y3XA 3E3TA 3SUFA 4NSVA 3PLPA 3F0PA 3E0NB 2P3FH 3TLOA 5DN6D 1NS3A 1GBAA 2XBVA 1UCYE 1ID5H 4Y8ZA 1FMGA 1C5NH 1KXEA 1TE0A 4AOQA 1YPMH 1HBTH 1K1LA 4O3UA 3RXVA 1QBNA 5FPTA 5A0AE 2F91A 4GAWA 1ZLRA 2Q6DA 5L2ZH 1WTHD 2TGPZ 3ENSB 4F48B 1DITH 4DCDA 3TK9A 1MAYA 1P2QA 3UAIC 3GCHB 6CHAB 3LKWA 1PYTD 2FIRH 5T6FA 3P8GA 1J14A 4AX9H 1G3BA 1RFNA 1VJAU 1TGTA 3H5CB 2ZGHA 4UE7H 5EXMA 1A5GH 1DLKB 3NUMA 1GHBG 1PPCE 1W12U 5C0UA 1AN1E 2XNIA 3QGJA 3MO6A 4D9QA 1IQFA 2FZZA 4AG2A 1OP2A 2VVCA 2OXSA 5EPYA 1K1OA 4B71A 3OFND 2O8WA 1MTNC 1SQOA 1LDTT 3UNRA 5DK1A 2FOMB 3NKKA 1FPCH 1O5EH 2DUCA 1KLTA 1FUJA 1FI8A 4NWKA 5KEDA 4BTUB 3D23A 1YKTA 6LPRA 1C4U2 1O2TA 3C1KA 3GCTG 1G37A 3SUEA 1EFRD 1NFUA 3MFJA 2G5NA 4DW2U 1MCVA 2FOFA 5FX6A 1E34B 3BIVH 2BHGA 3S9CA 1P2NA 3LGUA 4BAQB 1O2GH 1VITF 2WINI 4B2CA 2ZFTA 1ZTLA 3BTDE 1SG8B 3ZVGA 1DUEA 1QZ8A 3MWIU 1T8LA 1NT1A 3BTHE 3RXEA 4ZCNA 1TOMH 4K1TA 1A46H 1ZZZA 2ZEBA 3MMGA 3V3MA 1W14U 1THSH 2WPDD 1OX1A 1D3PB 3MI4A 1Y3WA 2FOHA 2KX4A 3LH1A 2HNTE 2QIQA 2OCVB 1J17T 3U1JB 3VEQB 1H1BA 1EQ9A 4A1VA 3MH5A 3AW0A 2EQNA 1DWCH 1QFKH 3QZRA 3IG6B 2JJ2D 5JBBS 1P2OA 1QR3E 4ISLA 4R0IA 4TPIZ 1E1QD 1S6FA 3N99A 2GZ9A 3MYWA 1TPAE 1KDQA 1H8HD 3T27A 1EAIA 4AGKA 1XX9A 2GD4B 3CS7A 2QXJA 4SGAE 3VFEA 1P05A 1V2UT 1FJSA 1AUJA 1C1UH 4DVAU 4FUDA 2GJGA 2A5KA 1EOLA 2GZ8A 4FUEA 1TALA 2VGCB 3V12A 2V3MA 3ZZAA 1SR5C 3WWFA 1DDJA 1GBCA 4CHAB 3RMNH 3UOUA 4BAMB 1A61H 3ATMA 2Y82A 1GBLA 2ZCKP 2A1DB 2BVSH 4FUIA 5DPAA 4XRNA 3PMHB 3MQKC 2GV6A 2Y5HA 2V6NA 1C9PA 1YPLH 3LJOA 2FTLE 1VJ9U 3DSOA 1CGHA 4D76A 1MZDA 1OWEA 4A7IB 1DOJA 2ZKSA 2ZTXA 1D9IA 4IN2A 2WZQA 4UDWH 1AIXH 3FP6E 1YCPM 2BQ6B 4D8NA 1KXCA 1PYTC 1JIRA 3ATKA 5CHAC 3QX5H 2PUXB 4DJZB 3RP2A 2P95A 5CMXH 3V0XA 1XUGA 1ABJH 3RLYH 2HVYB 4X6OA 3RM0H 1O2WA 1C2GA 3Q00A 1YPKH 3M7TA 4RN6A 2HWLB 1ZR0A 8GCHF 2PKAA 4ZKRU 3RXMA 1O5GH 1S0RA 1GHZA 2NU1E 1MD7A 1G36A 5SGAE 2ZU3A 4P00A 3UY9A 2O8TA 1A3EH 3LDXH 3P8FA 1UTJA 4ZHLU 4LXBH 1DICA 1ARCA 5BPEA 3F2FA 1OYQA 4UFEH 1IAUA 4DURA 4ESTE 4OS6A 1Z71A 3DUXH 5K7RA 3QTOH 3GDSA 1YPGH 3PV2A 1KY9A 2B9LA 1S81A 4ABDA 2AGEX 1FY8E 4I8LA 2ZU2A 3ZVBA 4DIHH 2EC9H 2Z3CA 3IITA 5F8XA 2Z94A 1V2OT 5JYIA 2TBSA 3K6ZA 3PO1B 5LPRA 3MH4A 4KP0A 4WXVA 4Y7AA 3W94A 1GMCF 2Y80A 1O37A 1GCTB 3SNDA 1SGYE 1UVPA 1MD8A 1P02A 2GGVB 2LELA 2VIDA 3OY6U 3ZZBA 2PGQB 2AMDA 1W0YH 1AVXA 1ZMLA 1L1GA 1BMMH 1F92A 4CR5A 1HRTH 1O3IA 1CHOF 3BIUH 2H6MA 2AMQA 4FU8A 2J4IA 1M9UA 4JYUH 3TJNA 1ZTJA 3NXPA 3UR6A 3BTME 2FM2A 3R0FA 5JBCS 2CF9H 1BB0B 2A31A 3OTPA 7LPRA 1S0QA 5HIZA 2BMGB 1P3EA 2BDHA 3ZIAD 2G8TA 2VJ1A 1NU9A 3OSYA 3F2GA 5EJ1A 1BBRH 2ZP0H 3GCTF 4OS7A 2PSXA 3VB7A 1D6RA 5T3HA 3SN8A 1KMHB 1W0ZU 2STAE 4WH8A 1T8OA 1TX8A 2O8UA 1ESAA 2HNTC 3P92A 1WUNH 4GUXA 4M7GA 1IHTH 3UR9A 4X1SU 3MOCA 1TMUH 2KZ4A 1GJCB 1GJ4H 2R0LA 1VGCC 5LPEA 1Z7KA 1P2IA 9LPRA 4K1EA 5F8TA 4CRDA 4X6PA 5HIYA 4ABGA 1O2KA 1O3BA 1YCPK 1HJ8A 1MTVA 2HPQH 3VXFH 1N6YA 5F8ZA 3ZZ4A 1GCTC 1WTGH 3GCHC 3E90B 6CHAC 3U9AH 3MU8A 2HLCA 3LPRA 3U98H 3PLKA 2FI5E 5JPMH 3RXFA 5HXFA 4KELA 3OX7U 2P93A 4XE4A 4JCNA 2Q6GA 4X0WU 3K65B 3BTKE 3VB3A 1GMHF 1MCTA 1C5WB 2ZFRH 3EA8A 3BEFB 1GI9B 5HGGA 1HJAB 1FLEE 2F9NA 4NIYA 4NWLA 1UHBA 3HGPA 3KCGH 4ACAA 1XUFA 1T7CA 1BIOA 4OGXA 2ZNKH 4E05H 3SNCA 2D26C 5DGJA 3TIUA 3HK6B 1XKBC 5F53A 3P95A 1PFXC 1AO5A 4ZHAA 1O5BB 3T25A 1O3HA 2ZFFH 3RDZA 1SQRA 5B6OA 1C5PA 1THPB 1GJ7B 4K1SA 1SLWB 1SOTA 2JETB 3ITIA 3SORA 2AEIH 3R3GB 4UD9H 1VR1H 3FAOA 1O5CB 5FX5A 1Z1JA 2BOHB 3A7VA 1C5YB 2GT8A 4YTAA 3PRDA 1ZOMA 3A83A 2JDID 3ELAH 5FPSA 3GY2A 3KL6A 3WY8A 1DWBH 1SGRE 3SUGA 1OPHB 1BHXF 2C8YB 1GI5A 1V2WT 2HALA 1QTFA 2BDIA 4I32A 3A88A 2OC8A 3PRBA 1DWEH 3EDXB 4NIVA 1O3AA 1YC0A 2G00A 1NRPH 1ESBA 1IQNA 1QA7A 1XXDA 2QF0A 2YMSD 3U8TH 1DXWA 3SGQE 2BDBA 1F5RA 2BB4A 1J8AA 5ABWA 1ZJKA 3DHKH 1GVKB 3M37A 1BDAA 1GJBB 2WUCA 1E0FD 2C90B 1VITH 4ZHMU 1AE8H 1TIOA 1T8NA 5A0BA 1WQVH 1C1SA 1K21H 2FLRH 3EGKH 4Y10E 5AHGH 3KYGA 3RC6A 1BUIA 1TPPA 3D65E 4MTBA 5HM2A 2TRMA 1FY4A 4X1QU 2P94A 3MTYA 4IGDA 2UWOA 6GCHF 2ZECA 1IQJA 1O3DA 2TGTA 1QIXB 3F3BA 3N7OA 1SVPA 2AFQB 2FI3E 1NFXA 2HLDD 1ETRH 2GTBA 2CV3A 2FWWA 1GDNA 1F5LA 2SNVA 1TNIA 1LQEA 4FU7A 2XYAA 1A7SA 1GBEA 3MH6A 5TCAA 2FP7B 5C1XA 1DPOA 2XBXA 2AYWA 2A2QH 3KQCA 1K28D 4Q7ZA 2VWNA 4GLYA 4K60A 2ZTZA 1EPTC 1BBRK 2C93B 1Z8RA 4E06H 4Q4LA 2A45B 5H4IB 1GMCG 1NBME 3IWMA 4TY6A 2R2MB 1L2EA 3RU4D 3SU3A 1TNHA 3A7ZA 1H9LB 1YYY1 2H5DA 1UVSH 2BZ6H 3LIWA 2H1UA 2J97A 1NRQH 2WPIS 2XC5A 1C1WH 2P59A 2YMSC 1NM6A 3RU4T 1V6DA 2VH6A 4MPVA 3GY7A 1P2MA 4YO9A 4YM9A 1D4PB 1VCPA 1THRH 3UFAA 2W3KA 4FUBA 1SOZA 2BX3A 3OY5U 4UONA 2M2AA 4LK4A 2THFB 1Q2WA 1U6QA 1YGCH 4Y11E 3QO6A 3M61U 4YT7H 1YP9A 3UREA 2FOAA 2JKHA 2XCNA 1HUTH 1ELVA 3O8BA 2F9PA 1KXFA 3PB1E 1F0RA 2BDAA 2CHAC 3EE0B 5C94A 3SZEA 2SGQE 1ANCA 4WMDA 1O0DH 3E8LA 1C1TA 1O2RA 1EPTB 2ZHWH 1PPHE 2QC2A 5EIYA 2O9QA 3LONA 4MQAA 1GBJA 2QCYA 2GDEH 1ZPCA 3T2NA 2FOCA 4MG3A 4BAKB 1UTKA 5FAHA 1E38B 2JIZD 1OWJA 2LNCA 1O2PA 1V2QT 1V2TT 2FESH 3A8CA 3STJA 1DE7H 3F9EA 4I33A 2Y81A 2WPMS 4NFFA 2XCFA 3QZQA 3RMMH 1C5ZB 2Z7FE 2OC0A 2EI6A 2GMTB 5C3NA 4HI3A 1P06A 2ZU5A 2UWLA 2GCHG 2WV4A 1EJMA 3MH7A 3MU0A 3D62A 3W95A 4Q7XA 3Q77A 3F9HA 1MH0A 4IBLH 4JK5A 3ZZCA 4Q63A 3RMLH 1CBWB 3SNBA 4B76A 1C2IA 1HAVB 3T5FH 1UMAH 2BQ7B 2CMYA 1CA8B 1DSUA 1ESTA 2ZCHP 3P8OA 4KKDA 9ESTA 5DJ7A 2ZU4A 1NZQH 4YZUA 1P9SA 1UJ1A 5DO4H 1TQ7B 3Q3XA 2GVFA 1O2JA 5BRRE 4JZDH 2J95A 3EAJA 3T62A 2ZDVH 3FFGA 4JZEH 2P3UB 2V3OH 3B23B 1BMAA 5PTPA 2XNDD 1C1PA 1DX5M 2ALPA 2I6QA 3K2UA 1ZPBA 1COWD 1EX3A 1O5AB 4IN1A 1O33A 2ZFQH 4QT8C 4PROA 2V0BA 4ZMAH 1HXFH 1SGTA 1GI2A 3PMJA 1AHTH 1S83A 2C8ZB 2VVUA 1T32A 1TBQH 1LVBA 1ZYOA 3TVJB 3CENA 3FP8E 1RXPA 2A7CA 1TAWA 1IOEA 3SBKA 1O2XA 1SGEE 3RXPA 3M7UA 5DP8A 1GJ9B 2Y5FA 4O9VA 3AAVA 4XBDA 3VB6A 1YPHE 3VXEH 2IOTA 4ZKOU 1G3DA 4BANB 1OS8A 5AFZH 2VWMA 2ZDMA 1NRNH 2BD4A 1LKAA 5DP6A 5EPNA 3SNAA 3O8RA 3LOXA 1RD3B 3P6ZB 3SGBE 4F49A 4CHAC 2HGTH 4TPYA 1NROH 3CP7A 5ESBA 2BDGA 1BMFD 1O34A 3TU7H 2SNWA 1V2VT 1UVUH 1Y8TA 2ZG0H 1E35B 1O3GA 2ZIQH 4B75A 1TONA 1Q31A 5GNDA 2BD8A 1UTNA 5ESTE 3MU1A 3SU5A 1GI0A 3LJJA 1ZJDA 2BDCA 1HJ9A 1TX7A 1LTOA 1GHAF 4U2WA 2QY0B 1PQAA 2HOBA 3SGAE 1WSSH 3BF6H 5GXPA 5JB9S 1JMOH 3TGKE 3RXJA 3SHCH 2YNAA 3TH3H 3S0NA 2W6JD 2XTTB 1Y3UA 4SGBE 2CK3D 1W7GH 3RXTA 2A4QA 2BY9X 1N8OC 1C5RA 2PTNA 4BOHA 3BG4C 1ZHMA 1MTNB 4A1XA 1GHWH 1SLVB 1WU1A 3HK3B 1H9HE 2OUAA 5KGOA 1Z6JH 4YOJA 3BTGE 3SUDA 4ZAEA 4MNYA 1OXGA 2UWPA 4Y71A 4B6FA 5C17A 1P9UA 3FZZA 3LGVA 4ISHH 3ZZ6A 1GMDG 1LQDB 3E91A 2AS9A 1MQ6A 3SU6A 3TJVA 1C2FA 4U01A 3SJKA 1N6XA 4JMYA 1WV7H 1DFPA 2ZHQH 3URCA 1WXRA 1V3XA 3A7YA 3GY6A 3UWIA 4FVDA 1IQKA 4X1PU 5GIBA 5DKMA 2QF3A 2KCAA 1C1QA 1D6WA 4OGYA 1WQSA 4OM9A 1BJUA 3T29A 1FY3A 1NO9H 4R8TB 3UNQA 2BD3A 4X8VH 1DSTA 4A6LA 1SPJA 1HAYB 4UFDH 2VB0A 2L74A 4ZXYH 1LKBA 5LH8A 1FXYA 8LPRA 1BTZA 1SLXB 5I25A 1O2VA 4D9RA 5EQQA 4Y0ZE 3SYJA 1P03A 2FOGA 5B6LA 3PLBA 5GPIB 1HAVA 2W6ID 1P57B 4AFZA 1SFQB 2QXIA 1ZPZA 4CH2B 1K1IA 5HKKD 3LGWA 1HCGA 2VU8E 1MKXK 3L6PA 1QL9A 5DP9A 2UUKB 2IPHA 1ANDA 3A82A 3H7OA 4RSPA 5TCCA 3RXQA 1JWTA 2ZGJA 1O39A 1AQ7A 1HJAC 4WY3A 2BD7A 3L3TA 5E8EH 5DP4A 1FX0B 2RDEA 5FPYA
chains in the Genus database with same CATH topology
4Y6DA 2VIVA 3UWJH 2Y5GA 5E2OA 3EQ0H 2J94A 1AZZA 4CRFA 1HAIH 4K5ZA 2G81E 3GYLB 4NZQA 1AWHB 1EPTA 1LHGH 4WF8A 1BRBE 4Q80A 2V3HH 1X7AC 1Y3VA 1MBMA 1GJDB 5C67A 1D3TB 2ZGXH 2O8LA 1MMJN 3BG4B 4TY7A 2F3CE 3JZ1B 1IQLA 1ARBA 1GWAA 2CHAB 2PTCE 2VIPA 1C2HA 4ZKNU 1HLTH 1YCPH 1NRRH 5CHAB 2XXLA 2FPZA 3D49H 1VITG 1A4WH 1O2UA 1ACBE 1J16A 2ZDAH 3NK8A 1V2JT 4H4FA 5AF9H 1EZUC 1FQ3A 1RIWB 5JBAS 1MTUA 1C5LH 4CRGA 1BOQA 1F5KU 3V7TA 3PV4A 3PO1C 2BD9A 2ZFPH 1LO6A 2CF8H 4JYVH 2BM2A 2ZC9H 3RXRA 1MTSA 1S82A 5TJXA 1DY8A 3M3TA 2GMTC 4BXWA 3E1XB 4JK6A 3L33A 1YPEH 1GJ5H 1QRWA 1HFDA 1O2HA 2XBWA 1CU1A 2RA3A 1EJAA 1F0SA 1AVWA 3HGNA 4HTCH 1DUAA 1NRSH 3SNEA 1QRZA 2Z9KA 2GCHF 4NSYA 1P09A 1BA8B 2JH5D 1O5FH 2OC1A 1O3PB 5EG4A 1HV7A 1T4UH 3TNSA 2IN2A 4K8YA 1TFXA 1BTHH 3LU9B 3URDA 7ESTE 2BTCE 1Z8GA 4GPGA 2FS9A 4K2YA 1C1MA 1ELCA 2ZPSA 2A4OA 2ILNA 1Y59T 1AZ8A 1YLCA 1P11E 1O32A 1CHGA 4X6MA 5A0CA 3SU4A 1P10A 1MAXA 1BMLA 1MQ5A 1SB1H 2WUBA 2GP9B 4BTTB 3RXDA 2QXGA 2NU2E 1BTPA 3GY5A 1O2ZA 3M5MA 2ZGCA 3P8NA 1CA0C 4KTCA 2G5VA 3UPEA 3I29A 5FXLA 1H8DH 3TJUA 2ZPQA 3HKIB 1O38A 2VIWA 4B2BA 3BEIB 3SV6A 5CE1A 4KGAA 3U8OH 2GT7A 2XWBI 3K9XB 4Q2KA 1DXPA 1KIGH 5IYTA 4AYVB 1SC8U 4I8JA 2QA9E 3TK6A 1O36A 2OINA 2UUYA 2A5IA 2STBE 4XDEA 2WPJS 1QCPA 1K2I1 1CGIE 1O3LA 4RKOB 1XMNB 3PMAB 5E0HA 1WYKA 1P04A 1V2RT 4ISIH 2TIOA 2G4UA 5JBTA 4WMEA 1HAZB 3PROA 3RXBA 1FN6A 4WH6A 2R0KA 4IS5A 2GCTC 1GHVH 3BG8A 2FO9A 3A7XA 3U69H 1EKBB 1UTPA 1QQUA 1EZSC 2BOKA 1ZHRA 2ZI2H 2FMJA 1SGDE 1W10U 3UQOA 3RLWH 1P0SH 5E0GA 3SW2B 2BX4A 4WMFA 4XOJA 4B73A 2Y6TA 3I78A 1SQTA 4K69A 3ZZ9A 4ABIA 1KSNA 1TB6H 3RXHA 2ZA5A 1BTWA 1PPBH 4MDSA 1GI4A 5JB8S 1AFQB 3VGCB 1UHBB 1CT2E 1MKWK 3BEUA 2BYAX 5IDKA 1ZHPA 2PUQH 1C5UA 4MPWA 3ZZ3A 1OWKA 1CT0E 3A8BA 4IMZA 2VGCC 2BY7X 1BT7A 4MLFB 4KTSA 3F6UH 2J92A 1K9OE 2H9EH 1RRKA 3SJIA 1QBOA 1E37B 4FUGA 4ZROA 3ZVDA 1XUKA 2HVXA 4OS4A 1TNJA 4OS1A 1HXEH 3BTWE 2Y7XA 1ZSKA 2GDDA 1EAXA 2YNBA 4O97A 1GGDC 1J9CH 3MNSA 4FUCA 3QWCH 5K0HA 1AI8H 2ZDNA 1GBKA 1QNJA 2KAIA 4Y76A 1UTOA 2AH4X 2H5CA 4YOIA 1SHYA 3A87A 1XUIA 2Q1JA 1BRUP 1SHHB 4K3JA 3OU0A 2SGDE 1O2OA 3UQVA 4I8KA 1EP6A 5HYOA 3SQEE 3M5LA 3A81A 2J9NA 4MPUA 5GWZA 1O2YA 1SGFA 3K6YA 3EA9A 5HM9A 1B0EA 2PR3A 3B8JA 3ODFA 4ABEA 2LPRA 1YPJH 3T26A 3QUMP 1QL7A 2YOLA 2A4RA 2P8OC 3MHWU 4WXIA 1MU6B 3LT3A 3GCOA 1TPSA 3RXCA 4CH8B 2PKSB 1EJNA 4WWYA 3KF2A 1Q3XA 1RS0A 1Z1IA 4ABAA 4U32A 1ANBA 1TYNA 3STIA 1EZQA 4DGJA 2FX4A 1EAUA 3NCLA 1KLIH 5L6NH 3HATH 1EZXC 1C1OA 1Z8IB 2R9PA 1HIAB 3DFJA 3V13A 2HNTF 5HMAA 2FODA 1D3QB 2FI4E 1LCYA 3SHAH 2VWLA 4LOYH 1TGBA 1QB9A 1C4Y2 3LC5A 1O3NA 1ETTH 4OS5A 4AGJA 2Z9LA 2BLOA 1UTMA 3S9AA 3QTVH 3S69A 2Y7ZA 2D2DA 1C5VA 1P12E 1BITA 4GSOA 3PTBA 1C2LA 1L1JA 2ZF0H 3ATLA 3G01A 1UK3A 3TH4H 1S6HA 4DOQA 1CVWH 1Y5UT 1SGCA 3A8AA 5EXNA 1GVZA 4IW4E 1Z6EA 2A0QB 1TNKA 3M3VA 1C5OH 1OYTH 1BBRE 5AVDA 4AORA 1L0ZA 5T6DA 3KQDA 1PPFE 2BVXH 2O8MA 2H2ZA 2F9VA 1WOFA 2PW8H 2CJIA 2RA0A 3A7WA 4DIIH 1GBMA 1SQAA 3RXLA 1YBWA 1C5XB 1HNEE 4ISNA 4Y7BA 2PKAB 3I77A 2PKSC 2H9TH 1CO7E 1QURH 1KXBA 3GISB 2B0FA 1HAOH 1LHEH 3LH3A 2BD2A 2P3TB 3BTTE 1V2ST 1S85A 2GX4A 3AW1A 1OWHA 4YLQH 2GKVE 4X1RU 2OQ5A 1ELFA 2D1JA 5GJ4B 1GHXH 1GBHA 3UIRA 2OD3B 2B8OH 4H42U 3M35A 1BHXB 1XM1A 2XWAA 1CHOG 2RG3A 4H6TA 5C20A 1HAGE 1VCQA 2BD5A 2XBYA 4ASHA 1QQ4A 3MNBA 1ELTA 2VH0A 3LGIA 1CA0B 1ZSJA 1O2QA 1CSOE 1TPOA 2FDAA 2FX6A 1TA2A 2CXVA 3DFLA 4FXGH 3RXUA 1OSSA 1SLUB 4UFFH 1PPEE 1QHRB 3E16B 3JZ2B 5FBIA 3F68H 1OKXA 4GCHG 1TABE 3BTQE 5EQSA 1HDTH 1G2MA 3SI3H 5C5NA 2ZPRA 3M7QA 4MNXA 3A89A 3KIDU 4TYDA 1K1MA 1SMFE 2CN0H 1MKWH 1FAXA 1FZZA 2ASUB 1ANEA 2R2WU 2Z3EA 2H9HA 3PYHA 4INHA 4TWYA 1AGJA 2OTVA 1KDQB 2Z6BD 2ZWLH 3KN2A 5C5OA 4DY7B 3O8DA 1V2PT 2TGAA 3SV7A 1O35A 1TOCB 2W26A 1QJ6B 4HGCA 3RXIA 2QXHA 1G32B 3AVZA 4I8HA 3RXSA 1TA6A 1AMHA 1JOUB 1BQYA 4I31A 1ABIH 3Q3KA 2ZDLA 1E36B 1BRCE 1DANH 5FCRA 3E0PB 3GCNA 1EB1H 2AGGX 1KTTB 1MTWA 1SSXA 4VGCC 3MNCA 4X1NU 3ZV8A 1GBDA 4CBOA 1AFQC 2W7SA 3LGTA 4ABFA 1V2LT 3VPKA 1GI1A 4NFEA 5GCHF 1INCA 1LVYA 1TLDA 3QK1A 3AAUA 3M5OA 1WAYB 5A8YA 1TGCA 2TPIZ 3PWBA 2SGEE 1BMNH 2ZHDA 6GCHG 2SGPE 3RXOA 1IHSH 2BDYA 3ZVFA 1W2KH 4AFQA 2BVRH 1V2NT 4NIXA 2B7DH 3TITA 1WCZA 2G4TA 2AERH 4FUJA 4XFQA 3Q76A 2QN5T 2QV1A 4ZH8A 3AASA 5G4BA 1GDQA 2A7HA 2ULLA 2WPLS 4XBCA 1SBWA 1NY22 1A1RA 1C1NA 1PQ8A 3RXKA 1CT4E 4DT7B 1S84A 4YLUA 1K1JA 1ZGVA 1CQQA 3A86A 3ESTA 1XVOA 1T4VH 1C5TA 3KNXA 3PTNA 1N8OB 2TGDA 2C3SA 1GPZA 1AB9B 4DG4A 4CRAA 1LPKB 2R3UA 1AU8A 1WBGB 4YT6H 2BQWB 4YOGA 2WYGA 4ABJA 3LC3A 4FUHA 8KME2 4IC5A 3U8RH 2ZQ1A 4X8SH 4BXSA 3MU5A 4Z6AH 4UEHH 8ESTE 2QGRA 4LZ1H 4J2YB 1H9IE 1AD8H 1ELAA 1UK2A 3QLPH 4Q7YA 1BJVA 1GJ6A 2BLVA 1K1PA 2OC7A 3TPIZ 4D7GA 3A84A 2ZFSA 2ZQ2A 1TRYA 1MZAA 1LPGB 2NU4E 2DE9A 3GDVA 3VB5A 2PHBA 1A0LA 1D3DB 4AZ2B 1C5SA 1L4DA 2XW9A 2WPKS 1OWDA 2F9BH 2ANMH 3SU2A 1C2EA 4O03A 1FPHH 1P2KA 1FY5A 3BTEE 1LVMA 3DD2H 1GMHG 4HZHA 5GDSH 2VVVA 1TMBH 1FAKH 2A2XH 4FVBA 4E7NA 1EATA 3TGJE 1A5IA 1QL8A 2ZZUH 1HIAA 1RGQA 3UOPA 5LGOA 1GI7B 2W7UA 3GY8A 1CE5A 4JZIA 2JETC 3S7KB 1Y3YA 3MNXA 1TMTH 3ZZ8A 3KQBA 2G51A 1GG6C 3PMBB 1A0JA 2GZ7A 2OLGA 5FHTA 2A7JA 5FCKA 4AG1A 2IJOB 4F4OC 5A8ZA 4U30A 1GI6A 2ODYB 2OBOA 1DM4B 3VGCC 4FU9A 4X2XA 1O2SA 1C9TA 2JH6D 1GL0E 1C5QA 1Y5AT 2ODPA 5AFYH 1AWFH 1F7ZA 1EOJA 1RJXB 4XBBA 3ZV9A 4NA9H 2AIQA 2W5EA 4GHQA 3F1SB 1J15A 1KTSB 4RKJB 4GCHF 1G30B 1O2IA 1TQ0B 1F0UA 1TBRH 3FP7E 1RTFB 3LGYA 3GOVB 4UFGH 4HFPB 1QGFA 1Z8JB 4AFUA 1FIWA 4NIWA 4Y8YA 4IMQA 3SV8A 3M36A 1OWIA 1IQGA 1MU8B 5F03A 1V2MT 2KAIB 2VIQA 2NU3E 2WV5A 3RC5A 4Y79A 3RMOH 4MNWA 1Y5BT 3ZZDA 4THNH 4ABHA 5I46H 3ODDA 1C2KA 2PWXA 1DWDH 1B7XB 5EU8A 4YESB 2AIPA 1XKAC 1TWXB 1O3EA 5C1UA 1A2CH 2AGIX 1NESE 4MNVA 1JIMA 2ANKH 3E6PH 3KHVA 1P3CA 3FVFB 1GGDB 2OBQA 3OYPA 4KTUA 1NPMA 1LHFH 1C2MA 2FOEA 5E0JA 5EOKA 3ZZ7A 2SGAA 2JH0D 3GY4A 2C8XB 2ZU1A 3NWUA 4H6SB 2EEKA 3RM2H 3ZVCA 1NFYA 1YLDA 3NPSA 3O8CA 1QA0A 1QJ1B 3MO3A 1BCUH 1QB1A 1SGQE 1O3OA 2F9OA 1FIZA 4X2WA 1O3CA 3SJ8A 2DE8A 2EA3A 3ZYDA 5J4QA 4Y0YE 1DVAH 1FY1A 3TH2H 1GBBA 1DT2A 3ZYEA 3OTJE 3ZVEA 4AB9A 7GCHF 4BTIB 1NU7B 2WYJA 2AMPA 1FNIA 1JRTA 1TNLA 2C8WB 1AFEH 1QB6A 2VWOA 1K22H 4ZKSU 1HGTH 4VGCB 3RXAA 4WJG2 1UTLM 1P01A 3SJOA 2Z9JA 1GBTA 3MO9A 1UVOA 4X2YA 3A7TA 2J34A 1FV9A 3P17H 1TRNA 4GHTA 5FBEA 4WVPE 1FN8A 1K1NA 2FS8A 2I6SA 1OP0A 1EXFA 1GVLA 2GV7A 3SZNA 5A8XA 1SI5H 1EASA 1C5MD 1DLEA 1VCWA 3ZVAA 1AVGH 1LVOA 1G2LA 1LHDH 1EP5A 3M3SA 1ZMNA 4NCYA 1AE5A 1HPGA 1QJ7B 2FTMA 1O30A 1GMDF 1G3EA 2FYQA 1PPGE 3PM3A 2FEQH 3DT0H 8GCHG 4X6NA 1O2NA 4E7RG 4X8TH 3NZIA 2HPPH 1ZTKA 4B74A 3SJ9A 3RUOA 2ZHEH 1PPZA 3TJOA 7KMEH 3MU4A 4MPXA 1L4ZA 1A0HB 1BTXA 4JZFH 5EW2H 1JRSA 2C4FH 2D8WA 3QN7A 2FYRA 4MVNA 5C2ZA 5T6GA 1C2JA 3C27B 2OQUA 1C1RA 2BLQA 2ZGBH 2ZHFH 2XRCA 3KQEA 1KYNA 1AKSA 1GHAG 4CR9A 5L30H 1S5SA 2HRVA 1BZXE 1GDUA 1AKSB 1F2SE 1PJPA 1IQEA 4BNRA 2V35A 3A85A 3DA9B 1GHBF 2ZO3H 2BY5X 2WPHS 1O5DH 4BAOB 3TGIE 3BV9B 1ZSLA 1BTYA 2QAAA 1TGSZ 2SGFE 1AUTC 4FUFA 1BTUA 1CBWC 2VIOA 3Q3YA 3UTUH 3HPTB 1O31A 5DP3A 4CBNA 3CS0A 1DS2E 2NWNA 4ISOA 3RXGA 4Z0KA 1ORFA 2XC0A 3UNSA 4NZLA 4OS2A 5EW1H 1HAPH 1P2JA 1QY6A 5C1YA 5JDUB 3F9FA 4XSKU 1UTQA 5L2YH 1VGCB 4A1TA 1GL1A 1PQ7A 2ANWA 1SL3A 1T8MA 4A5TS 1C4V2 1HYLA 1ELEE 5EODA 3KEEA 1GI3A 1TGNA 4INLA 3GYMA 1N1LA 2ALVA 1YM0A 1SGFG 3ZZ5A 2M5TA 2G55A 1IQHA 1DY9A 4ZUHA 2VNTA 3BSQA 2FXRA 1OOKB 1TBZH 1UCYH 2BXTH 1UK4A 1W11U 5F6MA 2EI8A 2ODQA 1W7XH 5ETXA 1O3FA 4ZXXH 1NTPA 4LZ4B 3GICB 3S7HB 1EUFA 1C2DA 3SU1A 1ZRKA 2PLXA 3A8DA 1BRAA 2VINA 3F9GA 1ELGA 3EA7A 3BTFE 1KXDA 1NFWA 3FZDA 2G52A 1GCDA 1ZMJA 5DG6A 1A3BH 1H8IH 1UO6A 3KGPA 2P8OB 1MUEB 3SO3A 1GJAB 1UVTH 2BXUH 5LPFA 1GG6B 3QGNB 2P16A 3ATIA 1JXPA 2BLWA 1XXFA 4AB8A 1O3KA 2Q6FA 1G3CA 2UUJB 3ATWA 1C1VH 1KLJH 4A92A 1CGJE 2A5AA 3FANA 1HAXB 1ZRBA 1XVMA 1B0FA 4NA8A 1HB0B 3TNTA 1FDPA 3SQHE 1MKXH 1P8VC 4TWWA 4I8GA 2ANYA 4X8UH 3SV2H 3GDUA 2ZCLP 1G9IE 1H4WA 5EQRA 1GI8B 1OP8A 3SOSA 2OP9A 1GJ8B 3P70B 1ELBA 1W8BH 1LMWB