2NU1E

Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
b'ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Molecular structures of the complexes of SGPB with OMTKY3 aromatic P1 variants Trp18I, His18I, Phe18I and Tyr18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu1E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu1E01
1C5PA 2XBXA 1AY6H 2KAIB 1GHXH 4JYVH 1B5GH 1HXFH 3NUMA 3PLKA 1GBCA 1EATA 4A1TA 1C1VH 1LVYA 1O38A 1ELEE 1P8VC 1TOMH 4BAMB 4X1NU 1GBAA 3SU3A 2ZP0H 1F7ZA 4NIXA 2OC7A 1UK4A 1ESTA 3D62A 2W7SA 3VB6A 1BHXB 1QR3E 1O31A 3A7WA 1J16A 4Q7YA 5E2PA 5CHAC 1E35B 5DK1A 1GBLA 3SNBA 1HJ9A 1QRWA 1AHTH 3MH6A 1XUIA 1CHOG 3SI3H 1EAIA 3VXEH 1IQFA 5A2MH 1AE5A 3RU4E 3UIRA 1AIXH 1SC8U 2NU1E 3SU2A 1UTKA 1WUNH 1YPHE 3KN2A 1EAUA 3S9CA 4BTTB 1FZZA 1UTJA 5E0HA 4YOGA 3RXPA 1K2I1 1O3EA 3BTQE 3UNRA 3HK3B 3ZZ6A 1GJBB 4MNWA 3F6UH 2BLQA 3LJOA 3SOSA 5FXLA 2ANMH 2ZKSA 3SJ9A 1AE8H 2ZHDA 4AX9H 1YF4A 1G36A 1TWXB 1Z6JH 3GOVB 1AFQC 1QRXA 3ZV8A 2BY6X 3SGAE 5AF9H 4O9VA 2BOKA 1BUIA 4CRAA 1HJAC 2A7JA 3MU5A 2KAIA 1P2MA 2WPIS 2ZECA 4INKA 2G00A 1UVSH 1BITA 3U1IB 1QL7A 4D9RA 1UCYH 2QF3A 3E6PH 4ABFA 1HNEE 5E0GA 3MU0A 3MO6A 3U69H 3KF2A 4A7IB 3M3VA 2YNBA 3ELAH 2XCFA 2ZHWH 1H8IH 4CR5A 2OXSA 3TJVA 1A4WH 5EOKA 3VGCB 1GJ8B 2V0BA 8GCHF 1DY8A 1JBUH 4ZKSU 3SJOA 5FPSA 3ZZBA 2A4QA 1UMAH 1Y59T 4ZHAA 4AFQA 2CGAA 4JZFH 4ASHA 4UONA 4O3UA 1BJUA 1BRBE 3RU4T 4TPYA 1S85A 7LPRA 5DP9A 2G4TA 3ITIA 1LHCH 3MOCA 2A4RA 1CA0C 2ZCLP 1O3JA 4INHA 3UR6A 2HPQH 2GZ8A 2IPHA 4IW4E 3RXJA 1AD8H 2F9UA 1H9IE 5IDKA 3TLOA 5JBAS 1CGHA 1ZGVA 2JH0D 1D3PB 1GVKB 1FY4A 1SQOA 4WH8A 2EI7A 2FS9A 2ULLA 3ZZ5A 1OWDA 3SJKA 1GI9B 4FUEA 3NPSA 1FLEE 2ANWA 2CJIA 3BF6H 1OS8A 1KXBA 3TK5A 4DT7B 1BTWA 1MQ5A 2ZGCA 4AB9A 2LPRA 4WJG2 3SJIA 3U8TH 4SGAE 2PWXA 1J15A 2UWPA 1O5GH 1C5WB 1FV9A 1K21H 2OBQA 1DFPA 1ZHMA 3LT3A 3VB5A 2J34A 1ZJKA 3A88A 2FDAA 2PR3A 1LVMA 2GZ9A 2A2XH 2FI5E 1E37B 1E0FD 1KXAA 2THFB 3FAOA 1DPOA 1SGRE 2O8MA 4K1EA 1PYTD 3MH5A 5A0BA 3HGNA 2STAE 3GDVA 2EC9H 1GBBA 2FOFA 3RC4A 4GLYA 1TX6A 1E38B 1GWAA 4CRBA 1C5OH 2XC4A 3OU0A 2OC8A 2XNIA 1GBHA 5DP6A 2BX4A 3RM2H 2F91A 1HIAB 5CE1A 1S6FA 2OD3B 2PV9B 5K0HA 1QTFA 1C5VA 4DOQA 1QB1A 3DUXH 1FMGA 4LK4A 1ZHPA 1T31A 3P8GA 3Q00A 2NU0E 1D3QB 1TPPA 3ZV9A 1TBZH 2BD3A 2FPZA 3P6ZB 1ZMJA 5ABWA 5FBIA 1QJ6B 3T62A 1DM4B 4UFGH 5L2ZH 3PMBB 2A4OA 1O34A 1C1RA 1QIXB 1GBIA 5EXMA 4B1TA 2PSYA 2CXVA 1BMMH 3RXLA 3P95A 3UQOA 1O3LA 2VIQA 1HAPH 1AB9B 4M7GA 2O8TA 3ZZAA 2J94A 1BMAA 4HFPB 1P2NA 5CMXH 2FODA 4KTSA 4AG2A 1QA7A 1YPMH 2GVFA 3RXRA 2F3CE 1QL9A 2ZGJA 1GCDA 4AGJA 2VIDA 1EZXC 2P8OC 1D3DB 1FNIA 4X1QU 3NKKA 1JRSA 3MU1A 1UTLM 3TGIE 1OOKB 2BLWA 1K1JA 2QV1A 1W3CA 3SN8A 3TVJB 1AKSB 1NM6A 1ZTLA 3LGIA 4R8TB 2CHAB 3QDZB 3ZVDA 7ESTE 3T5FH 1ZJDA 2XWBI 3M36A 2Z9GA 1Z7KA 3TH2H 2ZEBA 1O3NA 4K5ZA 4Z6AH 1QQ4A 1XUGA 1HIAA 1C5NH 3MO3A 1TPAE 3TK6A 2Z6BD 1CT2E 2R3UA 2W26A 1P12E 1AUTC 1PPGE 5GXPA 5E8EH 2BQ6B 3A7XA 3RXVA 5G4BA 1O5BB 3SO3A 3ZVGA 2VWOA 1MTSA 3TITA 3GYLB 1G3DA 1B0FA 5ESBA 1P09A 3LC3A 3M61U 2M5TA 1KTTB 1NC6A 1V2MT 1GJ7B 1KLTA 1JXPA 5GJ4B 2VH6A 1HAVB 4K8BA 1O2WA 2D26C 4DG4A 5JB9S 4NIVA 4X8TH 4UD9H 3RXDA 5F8XA 2R2WU 1MAYA 2GTBA 1HAGE 1Q3XA 3TH4H 1KXFA 4FVBA 3A87A 5JDUB 1A0LA 1C1WH 1S81A 2ZDNA 3DHKH 3GY7A 4LXBH 1VCPA 1KLIH 2BD5A 1WQSA 1V2ST 5DPAA 1HAIH 1HGTH 1VITH 1TMUH 1K1NA 1S5SA 4RKJB 3SNAA 3VEQB 3Q3YA 1Y5AT 3BTEE 3IITA 2ZU1A 1DDJA 7GCHF 2K1QA 1GI2A 1AVGH 1HAYB 2P3TB 3NCLA 1AKSA 4YTAA 3U8OH 3HPTB 2XRCA 4K3JA 3T26A 3ZYDA 1AN1E 3RMLH 3C27B 4Y79A 3PTNA 4X2YA 2H2ZA 5E2OA 4MNXA 1MTWA 3RXBA 3ODDA 4IMQA 2ZFRH 1MKWK 3SNDA 2J4IA 1IHSH 1VITF 1C2HA 3CP7A 3STIA 2R0LA 3RXMA 3BG8A 4HZHA 2TBSA 1O2ZA 4LZ4B 2F9OA 1LMWB 1TRMA 4Q7ZA 1NROH 4Y8XA 1DWDH 4CH8B 1SG8B 1EPTB 5DP7A 3EYDA 1EAWA 2WINI 3ZZ3A 5GPIB 1TLDA 1D4PB 1A5IA 4I8GA 5JPMH 1HAVA 1PJPA 4X6OA 1ETTH 4K60A 2J95A 5LGOA 3PO1C 1GJCB 1HDTH 2R0KA 3K2UA 1VJ9U 1OP0A 2BVSH 1CE5A 2O8UA 1EJNA 1MBQA 2IN2A 2H9EH 1BMLA 1ZSLA 2ZIQH 1O3CA 7GCHG 4IS5A 3I29A 2SNWA 4ISIH 2Y5FA 1XKAC 2Z3CA 1M9UA 3KQCA 1AFEH 1AFQB 2AEIH 1C5RA 3F68H 3MNXA 1C1MA 4DY7B 1MKXK 1CGJE 1EB2A 4TYDA 2B5TB 2FI3E 5GCHF 2J9NA 2ZU2A 1TGBA 1HJAB 1P06A 4IBLH 4D7FA 1ANBA 4K1SA 2O8WA 1TALA 3AAVA 3SU1A 2BD2A 3CS7A 1C5LH 1FDPA 4BAQB 4B71A 3LGUA 5IYTA 5T6GA 5L6NH 2TIOA 3BG4B 3P8FA 4GHQA 3MNBA 3RDZA 5C1XA 1V2OT 1C2IA 1VITG 8ESTE 1TBQH 1MH0A 5EODA 3T27A 4O3TA 5PTPA 2P94A 4I31A 1TPSA 4X2VA 1RIWC 3ZVEA 6CHAB 1UVOA 1FY8E 3URDA 1W11U 1HPGA 2PFEA 2PW8H 2XBWA 3F1SB 1VZQH 1EPTA 1YCPK 1ACBE 1GGDC 1W8BH 2FEQH 4X2XA 1L1JA 1PPFE 1V2LT 1HXEH 2ZCKP 3BTKE 1V2RT 1ELVA 1HAHH 3FP8E 2HNTC 1RJXB 2ZTZA 1A0HB 1BOQA 1SGFG 3LH1A 1FY1A 3SU6A 1AZ8A 1C2KA 3RM0H 4YM9A 3HK6B 3SW2B 2NU4E 5A0AE 4KGAA 1ZTJA 2A7CA 2XCNA 5ESTE 3P92A 1QRZA 1VGCC 3FP6E 4FUBA 4ABJA 1DE7H 5GCHG 3ZZ7A 1TABE 4Q7XA 1MUEB 3NXPA 3A8DA 1P01A 1CT4E 1IQLA 1HLTH 3LDXH 5K7RA 4MVNA 2Z3EA 1YKTA 3R3GB 4UEHH 2FYQA 1EJMA 1DXWA 3PMAB 4IC6A 1GI3A 2ZPRA 1QNJA 1GL1A 2PKSB 2UUYA 1SOZA 2QCYA 1T8NA 3KQDA 1DITH 1XKBC 1RFNA 1NRSH 4LOYH 1UTMA 2BDIA 5EQSA 2BXTH 4XBCA 3A85A 1ZPCA 3LKWA 3BIVH 6ESTA 4B2AA 1P02A 4GAWA 1P2JA 3QTOH 1GMCF 4KTCA 1UTOA 1N8OB 1JOUB 2VWMA 1TNKA 4BNRA 2EA3A 1IQEA 1O2KA 4NWKA 2ZQ2A 1GJ6A 1O2RA 1C2EA 1ARBA 2BQWB 1O32A 5FBEA 1GJ5H 4WXVA 1FXYA 1C1QA 2VIVA 1AGJA 4JK6A 7KMEH 1AWFH 1V6DA 2QC2A 3ZVAA 8LPRA 4YO9A 2FLBH 3TU7H 1Y5UT 2G8TA 1MTNC 1XUKA 2VB0A 2Y82A 4O03A 4CHAC 1SLUB 1Y3WA 1ZMNA 1HBTH 2F9BH 4NZQA 1HAZB 3I78A 5DKMA 3GYMA 1FY3A 3O8CA 2HNTE 1TYNA 2VIWA 4Q80A 2CN0H 2UUFB 4B76A 3MFJA 1GI0A 1O5CB 1AI8H 4GPGA 1UK3A 5BRRE 2Z9JA 5A8YA 1BRAA 1ELDE 1F0SA 2AGEX 2ZGBH 3UPEA 4ISOA 2BZAA 2GCHF 1BCUH 4J1YA 2ZGXH 1LPKB 1UO6A 1OWIA 1CGIE 1GMCG 1C2MA 1NU7B 2BQ7B 4BANB 2ANKH 4U01A 1E34B 3R0FA 1N6YA 1BQYA 4H4FA 2WPKS 3V13A 2RCEA 5EW2H 1SGQE 1THSH 3SUDA 1EOJA 1JRTA 4GUXA 4ISHH 3H7TA 2QXJA 3RU4D 2NU3E 1BBRE 2OP9A 5C5OA 3RXCA 1MU6B 5F8TA 1UTPA 4E05H 2J2UA 1NRRH 3FVFB 2A5IA 5HMAA 4IMZA 2P3UB 1ZRBA 3UY9A 4WXIA 2DE8A 4H6TA 1HAXB 4U30A 1LQDB 4D9QA 2C4FH 3SI4H 3SHAH 4MPWA 4D76A 1A3BH 1TQ0B 2H5DA 1P03A 5DP3A 2BOHB 4YZUA 2A7HA 1C9PA 2PTNA 3MWIU 3CENA 3O8RA 4CRGA 1PQAA 4WMFA 3MTYA 1LVOA 1RGQA 4BAOB 1OWJA 2GCHG 2O9QA 2WV4A 5FX6A 1O2SA 2BDCA 2W7UA 2G4UA 5EQQA 1SGPE 2OUAA 4MPUA 1QBVH 1RRKA 2I6SA 3FZZA 4H42U 3T25A 2ZDKA 4A6LA 4F4OC 1Q2WA 4MLFB 4Y0ZE 3RP2A 5LH8A 4JZDH 1EOLA 2XBYA 4A92A 4YOJA 3TGJE 1AMHA 1FN6A 1QB9A 3S0NA 1SGNE 4CH2B 3RXQA 3GISB 5FAHA 2ZDMA 1C5UA 3KNXA 4ZXYH 1J9CH 1RTKA 1FAKH 2GP9B 3NZIA 3MU8A 4MPXA 3ZVCA 4CR9A 2VINA 1H8DH 4PROA 1KDQB 1OXGA 1NRQH 1GG6B 2A5AA 1TNJA 4VGCB 1ORFA 3LPRA 1OYTH 1NTPA 2ZPQA 1LHFH 4ZMAH 3LGYA 3M5OA 1V2VT 2GT7A 1G3EA 4WVPE 1XM1A 2D8WA 1W0ZU 1TMTH 4NA7A 1TAWA 1T4UH 1Z8RA 3AVZA 4RKOB 1AZZA 1UVUH 1J17T 1GCTB 4E06H 4JMYA 1O2IA 3PO1B 4I8LA 2HNTF 2BHGA 4GCHF 2C93B 1HCGA 1MKWH 4NWLA 2C8XB 1QL8A 1MCVA 2XW9A 2H6MA 1YPLH 5TCAA 4DCDA 1C5MD 8GCHG 1TGCA 1V2WT 3A7ZA 1SFQB 1A5HA 1BIOA 1BBRH 1DLKB 1V2QT 3ZVFA 1CHGA 1F0UA 1V2JT 1EXFA 2ZA5A 2HLCA 5DP5A 4RSPA 1QY6A 1DS2E 2R9PA 2ALVA 4TPIZ 2GDEH 1GJDB 3SHCH 1FN8A 3QGJA 2VVUA 5A0CA 1O5EH 2BY5X 5C3NA 1QCPA 2BY7X 1K1LA 4B73A 1ZGIA 5E0JA 1EZUC 1ZHRA 3QUMP 2Y5GA 1SI5H 1EJAA 2FOHA 2GV6A 2P59A 2VH0A 1NO9H 1JMOH 1CBWC 3RXFA 3E8LA 1WU1A 1P2OA 2PHBA 2XC0A 1EP5A 4FUCA 3T28A 3P17H 1GI4A 2C3SA 3BTTE 3H5CB 3MNSA 1HB0B 1GBFA 1YP9A 3MH7A 1TIOA 1YCPM 1RIWB 4DW2U 1GMDF 1KDQA 2Z9KA 1TNGA 1FPCH 1BTUA 1G37A 1XX9A 1ANCA 2VGCB 3LOXA 1WTHD 3N7OA 1MKXH 2ZC9H 1ANEA 1G3CA 1V2KT 1W13U 3HATH 4MNVA 1IQKA 2ZFQH 1GGDB 1N6XA 4YLQH 3DA9B 3PWBA 4X1PU 3DFLA 1YPGH 3S69A 4CRDA 2VIOA 5JBTA 1XVOA 2PLXA 2NWNA 2GCTC 4GCHG 3SJ8A 1MQ6A 1H9LB 1XXDA 1F5KU 2XTTB 3TJNA 1HFDA 2VJ1A 2VWLA 4FU9A 3PB1E 3Q76A 1V2NT 5TJXA 5LPRA 3UOPA 3WY8A 1QQUA 1TNHA 1TBRH 4KP0A 1L4DA 2HVXA 2CF9H 4KKDA 4X6MA 4HGCA 4ISLA 4XSKU 2SGDE 1VGCB 3TNSA 1HAOH 1GL0E 2ZDAH 1WTGH 2EI6A 3BEIB 4ZKOU 1GBDA 3B8JA 2O8LA 1V3XA 1S84A 2OQ5A 1LPGB 4A1VA 2GMTB 2A31A 3VB4A 1LTOA 3VPKA 1TGNA 3O8BA 1GHAF 5AVDA 4MTBA 3M3TA 4ABIA 3AW0A 1O35A 3UTUH 2W3IA 5FCRA 1IQJA 2ODQA 4NA9H 1QA0A 4ZKNU 4AORA 1E36B 3ZZ8A 1H4WA 2Y7XA 1S82A 1ELAA 2JKHA 2ASUB 1GMDG 4AG1A 1FUJA 3A7VA 1GVLA 3RLYH 1S83A 2FTMA 3P70B 5J4SA 1O3PB 3M5LA 1P2IA 4TY6A 1S0QA 1Y5BT 1UCYK 1J14A 4WMEA 2Z94A 3TK9A 4Q2KA 1A3EH 4X0WU 2B9LA 1LPZB 2TGAA 3W94A 2RDLA 1TX7A 3PROA 4XBDA 1C2DA 4UDWH 5GWZA 1C1TA 4IN2A 3SORA 1DWBH 3ZYEA 2UWOA 4IC5A 3MNCA 3PTBA 1SHYA 3A8AA 2ODYB 2QXHA 2FO9A 1GBJA 1O2VA 4XE4A 2BMGB 4Y7AA 5FCKA 3RXUA 3V12A 4F49A 1IQGA 4ZXXH 4GVUA 1LO6A 2DE9A 1AUJA 2CV3A 3RUOA 3I77A 1L1GA 4FVDA 3SV8A 3GCTF 3U1JB 4Y6DA 3A7YA 2FMJA 3RC6A 2ZHFH 5I46H 2FX4A 1SSXA 2B0FA 2ZU5A 2ZGHA 3TH3H 1PPHE 2VVCA 4YESB 1GHAG 3L33A 4HI3A 1BB0B 1PPCE 3EA7A 3M5NA 1SGYE 5FPTA 3U8RH 2B7DH 2YNAA 2BDAA 1BRCE 4INLA 1UTQA 2BD8A 1ELCA 1W7GH 3BSQA 3BV9B 4AGKA 3GY6A 2ODPA 1RXPA 3BTFE 1CT0E 1NY22 5CHAB 2BB4A 4ABAA 2EI8A 2GZ7A 3TJUA 4AFSA 1C5TA 3GDSA 2A2QH 3RXAA 2TPIZ 1EB1H 1ELFA 3M35A 4OS2A 3QZQA 1RS0A 2Z3DA 2BVRH 3O8DA 1GHBF 2ZFTA 3BEUA 2FTLE 1IQNA 1VCWA 4X2WA 1C4V2 1T7CA 4FU8A 3V0XA 4AOQA 4X6PA 2OC1A 1GMHF 3B9FH 3G01A 1L0ZA 1O3DA 1SLXB 2QXIA 2G52A 5JB8S 2FOMB 4ZAEA 1SR5C 1EKBB 1PQ8A 3PYHA 4JYUH 4DIHH 2ZHEH 5L2YH 4SGBE 3PM3A 3VFEA 2F83A 1FIWA 4THNH 1XXFA 2BDHA 4R0IA 1QBOA 1ETSH 1ZOMA 1GBTA 3UNQA 5C20A 5C67A 4ISNA 4WMDA 1W7XH 1MZDA 2ZFPH 4X1RU 4BTIB 4B75A 1ZYOA 3H7OA 3RMNH 1O5AB 2OINA 4Y7BA 3ATLA 1KSNA 2GV7A 1OKXA 3IG6B 3V3MA 1ID5H 1EZSC 2BZ6H 3A81A 4CBNA 4BOHA 5DJ7A 1QJ1B 1O2QA 1TB6H 1QBNA 2GGVB 3KQBA 3D49H 1FPHH 1SBWA 1ZPZA 1YPJH 3ZZ9A 1GDQA 1KLJH 4Y10E 2QA9E 1MTUA 3OSYA 4Y11E 1F0RA 2I6QA 1YPKH 1TFXA 1VCQA 1ABJH 3RXSA 1OWKA 2GX4A 1WAYB 1P04A 3A8BA 4NFFA 1GHBG 2FS8A 3F9GA 2SNVA 3VXFH 4FUJA 2FXRA 4U2WA 3UOUA 1GMHG 1MAXA 4Y0YE 1O5DH 3KL6A 3F9EA 3D23A 1AVXA 1CA0B 1OWHA 1W14U 3GCHC 3EA9A 5BPEA 1C1PA 5HXFA 4CBOA 1O3IA 3E0PB 5F03A 5FPYA 3RLWH 4YLUA 2FOBA 2JETC 1XUHA 1ZLRA 3SU4A 5B6OA 2QXGA 1HUTH 1FONA 4FUGA 3LONA 1DX5M 2QAAA 5DP8A 4JZEH 1IHTH 2UUJB 4NFEA 1EQ9A 4JCNA 3TPIZ 1O3GA 9LPRA 1HRTH 1ZTKA 1C2JA 1UVPA 3Q3XA 4I32A 1LKAA 4AZ2B 1BTPA 1YM0A 1A2CH 1GPZA 4AN7A 3VB7A 4UFEH 3RXHA 2ZHQH 4K2YA 3SNCA 3A86A 3U9AH 4GHTA 1KY9A 2CHAC 1BMNH 1K1OA 1GDUA 2ZU3A 1P9SA 2C8ZB 2BY8X 1ZSJA 2BVXH 3SGQE 5SGAE 1BZXE 3V7TA 3STJA 1CQQA 3BIUH 4DIIH 3DD2H 2GD4B 1XMNB 2J38A 4JK5A 1BHXF 1YPHC 3GY5A 2G55A 2QGRA 3QWCH 4X8SH 5JYIA 4ABHA 1JIRA 2QF0A 3C1KA 2GT8A 1EZQA 2AGIX 3BTWE 5T3HA 1BJVA 2PUQH 1DUEA 3DT0H 1SGDE 3PLBA 1BTYA 2VVVA 3S9AA 1C2LA 1SL3A 3SZNA 3KQEA 4DGJA 2JH5D 2DUCA 2WYGA 3K65B 1AVWA 1FIZA 2A1DB 4TY7A 3MYWA 1P05A 1LHEH 1LDTT 4YT6H 2PTCE 1WV7H 1TRYA 5C1YA 2FIRH 1MD7A 1MMJN 1K28D 1L4ZA 1V2TT 2ZG0H 2P8OB 4FUIA 2OBOA 1CSOE 2WYJA 3M7UA 1KYNA 3KEEA 2BLVA 1SGCA 2P3FH 4WWYA 1RD3B 3K9XB 1ELGA 5C1UA 2VWNA 2LNCA 2FLRH 3AASA 1KIGH 1RTLA 1V2PT 1A7SA 5JBBS 1C9TA 1THPB 3K6YA 1MBMA 3MU4A 1O3FA 4NIWA 3ZVBA 2ZWLH 4ABDA 4FXGH 1DOJA 1QFKH 2G5NA 4OS5A 2A32A 3SV2H 1AU8A 1J8AA 1ELTA 5EGMA 3UR9A 1LHDH 3U98H 1SMFE 1TONA 2Y6TA 5JBCS 1P57B 1O36A 1YGCH 2ESTE 1SVPA 1PPEE 1H9HE 1W12U 1O3MA 3GY4A 1P10A 1NRNH 3IWMA 1AO5A 1EPTC 2FZZA 3UWIA 3OYPA 1TNIA 4CRFA 1PPBH 1SGTA 4AYYB 1A0JA 2OLGA 3ZZ4A 3A83A 1O0DH 4WF8A 1V2UT 1C5QA 3P8OA 3A84A 2B8OH 1BRUP 1RTFB 3PMJA 4Y76A 2PUXB 1FAXA 1INCA 5AHGH 2Y81A 3M7QA 3T29A 2AMDA 2F9VA 2FYRA 2XBVA 3TIUA 1W2KH 4K69A 2FX6A 1DVAH 1W0YH 4KELA 2PKAA 2Q6DA 1LVBA 2A0QB 4OGXA 1CU1A 1PYTC 4B2BA 2STBE 5I25A 3EQ0H 1WQVH 3NK8A 3SUFA 1BTHH 3QZRA 1X7AC 1GI7B 1KXDA 4OS4A 3FANA 5H4IB 4A5TS 1YLDA 3KCGH 1P2KA 2FP7B 4I8JA 3PMHB 2WUCA 4AFZA 3BG4C 3UREA 2ZO3H 3QX5H 1TE0A 1GJ9B 1HJ8A 2Q1JA 4ABGA 2UUKB 1OX1A 2TRMA 2Z7FE 1O2LA 3SV9A 3E0NB 3UUZA 1DSTA 5T6DA 3DFJA 5EPYA 5T6FA 2TGPZ 5DP4A 6CHAC 4QT8C 1LQEA 1TPOA 2R2MB 1O3OA 1C4Y2 1NESE 2W5EA 4FU7A 5FHTA 1TGSZ 1T8OA 4ZKRU 1Y8TA 4ESTE 3JZ1B 2BD9A 1UJ1A 1DXPA 4DVAU 2HOBA 2J92A 1C5XB 1YBWA 2D2DA 1KXCA 1TA2A 2RG3A 3QK1A 1Y3XA 4ZH8A 2GKVE 4X6NA 3SQHE 1OPHB 3SQEE 8KME2 3RMOH 5LPEA 2BDBA 3URCA 2C8YB 3K6ZA 4Y8ZA 3M37A 2SGPE 1IOEA 1C2FA 1MD8A 1ZR0A 4BXSA 1NZQH 3D65E 3LJJA 1HYLA 1SQTA 1BTXA 3BTHE 1OSSA 2WPMS 3EGKH 4JZIA 4B74A 1ZZZA 3RXGA 4TWWA 1O2TA 3UWJH 1NFXA 1B0EA 2PKSC 1Y3YA 1Y3UA 2WV5A 2P93A 2AYWA 1SLVB 2Z9IA 1ARCA 1EUFA 1Z71A 1SGEE 3Q77A 4XOJA 3ZZDA 5GIBA 2TGTA 1WOFA 1PQ5A 4WH6A 2BY9X 2V3HH 3M3SA 3L6PA 4OS7A 2ZU4A 4UE7H 1JWTA 3ODFA 1O2MA 1TOCB 1P0SH 4HTCH 4NCYA 1DWCH 1YLCA 1F2SE 3VB3A 1F92A 1YYY1 1ZSKA 4E7NA 3MH4A 3ATIA 3NWUA 1DANH 1O5FH 3FZDA 5L30H 1N8OC 1Y3VA 1O2HA 2ZDVH 2GDDA 3OX7U 3LC5A 3LIWA 3M5MA 2HWLB 1S0RA 3RXIA 5EXNA 1ETRH 1C1OA 3BTGE 1ESBA 2W3KA 1VR1H 3GCOA 1WCZA 3UNSA 3SV7A 3HGPA 1FQ3A 3SV6A 4AYVB 5EU8A 3ATMA 4DURA 3PWCA 1GHWH 2P95A 1ZPBA 2FOGA 2HGTH 3GDUA 2BTCE 1U6QA 4WY3A 3GCHB 4I8HA 4ZHMU 4IN1A 1DSUA 1O2PA 2AIPA 1IQHA 1TRNA 2V6NA 4A1XA 2ZPSA 1K9OE 3QGNB 3L3TA 5EG4A 1O2OA 2H1UA 3GY3A 3E90B 2ZZUH 1CO7E 2JETB 3RXOA 5LPFA 1O37A 2VU8E 3B23B 3Q3KA 2ZNKH 4B2CA 2XYAA 1XUJA 1C2GA 3MMGA 3W95A 3ENSB 4Y8YA 1YCPH 2Z9LA 3ATKA 1O30A 1Z1IA 2XC5A 5F6MA 1B7XB 1A61H 5AFYH 1C5ZB 2VNTA 1O3HA 2BD4A 2G51A 3A7TA 2FOCA 1ESAA 3HKIB 1PPZA 4FUFA 2UWLA 1S6HA 2WUBA 1MCTA 1QHRB 1UHBB 1OYQA 2BD7A 4UFDH 1SHHB 1GHYH 1C4U2 2ZF0H 2A45B 4Y71A 1A1RA 4YOIA 4NIYA 1D6RA 1WYKA 5AFZH 2CF8H 3S9BA 2V3OH 1OP8A 1EASA 1G3BA 5EXLA 2ZFFH 1Z8JB 3UFAA 4D8NA 3KHVA 1Z1JA 1TA6A 1GI6A 1DT2A 1HV7A 1N1LA 3LGVA 2R3YA 2P16A 2G81E 1O39A 1SB1H 5J4QA 1PFXC 1MZAA 5HM2A 1OP2A 1T8MA 1TGTA 1BT7A 4JZ1A 5GDSH 1GI1A 1MTVA 5TCCA 1EAXA 3E91A 1MTNB 4ZHLU 2EEKA 1NFUA 4CHAB 3TNTA 2BX3A 2G5VA 2FM2A 3LH3A 5DG6A 2F9PA 1P2QA 1P3EA 1O2JA 1T4VH 1TQ7B 3FP7E 3GICB 2ILNA 3F9FA 1A46H 2H9HA 5DGJA 2OQUA 1TX8A 3MO9A 5HGGA 1IQIA 3M7TA 1LKBA 2Y7ZA 3BN9A 2FESH 1LCYA 1F5LA 1O3AA 3VGCC 3PLPA 5HM9A 2BXUH 1O33A 1O3KA 2Q6FA 5EPNA 1TNLA 1DUAA 4NA8A 2OTVA 2H9TH 1UHBA 2JH6D 4X8UH 4AFUA 1O2YA 4ABEA 5ETXA 3LU9B 1NFWA 1C1NA 1WSSH 5HYOA 3LGWA 4CREA 1QURH 4XFQA 1BDAA 3S7KB 4NZLA 3MI4A 1NRPH 1Q31A 4K1TA 2AIQA 4NG9H 3ATWA 3QLPH 2F9NA 1BTZA 4D7GA 4XBBA 1K1IA 4ZROA 2AMQA 2BDGA 2BYAX 3FFGA 4NSYA 1ABIH 1A5GH 2FOEA 2OCVB 1BBRK 1GG6C 4VGCC 1AQ7A 1AWHB 1O3BA 1KTSB 4KTUA 3F9HA 4OS1A 3LGTA 3RXKA 1D9IA 1GI5A 1YC0A 2SGQE 3GCNA 1ELBA 3RMMH 3GCTG 5F8ZA 3EAJA 2YOLA 3RC5A 1KXEA 1GCTC 1O2UA 2AFQB 3S7HB 2SGAA 3BTME 1GJ4H 4AB8A 5A09A 1FI8A 4IGDA 3SNEA 1T32A 2QN5T 4FUDA 1QB6A 1Z6EA 2ANYA 2HALA 4I8KA 4BTUB 1F5RA 3QTVH 1EX3A 3T2NA 3EDXB 5C5NA 1NS3A 3SU5A 2ZDLA 2HPPH 3GY2A 2Q6GA 3E16B 3ZZCA 4BAHB 3E1XB 3RXTA 3EA8A 1C1UH 1SOTA 1GVZA 1JIMA 3QN7A 2AH4X 1G9IE 3EE0B 1GI8B 2AS9A 1H1BA 4U32A 3SGBE 1K22H 1K1PA 2ZQ1A 2WPHS 1WBGB 1G30B 3KGPA 4X1SU 3P8NA 1NFYA 2Y5HA 2PGQB 2PSXA 6LPRA 4JYTA 1FJSA 3OY6U 3RXEA 1O2NA 1F0TA 4BXWA 1NT1A 4RN6A 2IOTA 2SFAA 1QGFA 2IJOB 1DWEH 2ZFSA 1ZRKA 2AMPA 2TGDA 2VGCC 2VIPA 4NSVA 1YPEH 3SUEA 1Z8IB 2WPLS 2ZTXA 3KIDU 1SGIB 2HRVA 3A80A 3E3TA 6GCHF 3JZ2B 1P11E 1AB9C 2OC0A 2BLOA 2C8WB 4X8VH 4Z0KA 5A8ZA 1C5SA 1NU9A 4GSOA 1P3CA 1SPJA 2ZI2H 5C2ZA 3CS0A 3HKJB 4MPVA 1FY5A 4CRCA 1EP6A 2AERH 4J2YB 5A8XA 1LHGH 1DICA 1QJ7B 1G2LA 3OY5U 1VJAU 1MU8B 3ESTA 2Y80A 4DJZB 4BAKB 4I7YH 3SU0A 2C90B 2QIQA 1T8LA 1GBKA 1NPMA 3A82A 4FUHA 3PV4A 1GHVH 2SGFE 4MG3A 1XUFA 1SQAA 2GMTC 1ANDA 1L2EA 3OTJE 4OS6A 3SUGA 5DO4H 2AGGX 3A89A 3MHWU 5FX5A 2A4GA 1G32B 4O97A 1GBMA 4K8YA 4E7RG 3UQVA 1UK2A 2FI4E 4MDSA 1O2GH 1GJAB 4YT7H 1L1NA 1G2MA 1C5YB 1D6WA 1IAUA 3QO6A 1C1SA 3TJOA 1THRH 4ZUHA 2CMYA 3BTDE 1CBWB 1DLEA 4MNYA 2QY0B 3TGKE 2FOAA 2NU2E 1Z8GA 2XXLA 1W10U 1SLWB 4LZ1H 2D1JA 2BM2A 1GHZA 4MQAA 1UVTH 6GCHG 2ALPA 3BEFB 1OWEA 4OGYA 2BDYA 1UCYE 1CHOF 1DY9A 2PGBB 5EQRA 2ZCHP 1UTNA 4ABBA 1K1MA 2V35A 4UFFH 1IQMA 1CA8B 1O2XA 1XVMA 1P9UA 4I33A 2XWAA 1SFIA 2A5KA 4NGAH 3GY8A 2RA0A 2H5CA 9ESTA 3SBKA 1PQ7A 1BA8B 1CVWH 2FWWA 2QYIA 2ZTYA 2GCTB 1NN6A 3AW1A 4XDEA 1ZMLA 2SGEE 2WPJS 3AAUA 4H6SB 3A8CA 1D3TB 5EW1H 2PKAB 1GDNA 2RA3A 4TWYA 1SGFA 1GBEA 1TMBH
chains in the Genus database with same CATH superfamily
1C5PA 2XBXA 1AY6H 2KAIB 1GHXH 4JYVH 1B5GH 1HXFH 3NUMA 3PLKA 4Z1MD 1GBCA 5IK2D 1EATA 4P00A 4A1TA 1C1VH 1LVYA 1O38A 1ELEE 1P8VC 1TOMH 4BAMB 4X1NU 1GBAA 3SU3A 2ZP0H 1F7ZA 4NIXA 5C0TA 2OC7A 1UK4A 1ESTA 3D62A 2W7SA 3VB6A 1BHXB 1QR3E 2EY4C 1O31A 3A7WA 1J16A 4Q7YA 5E2PA 5CHAC 1E35B 5DK1A 1GBLA 2LP6A 3SNBA 1HJ9A 1QRWA 1AHTH 3MH6A 5KECA 1XUIA 1CHOG 3SI3H 1EAIA 3VXEH 1IQFA 5A2MH 1AE5A 3RU4E 3UIRA 1AIXH 1EFRD 1SC8U 2NU1E 3SU2A 1UTKA 1WUNH 1YPHE 3KN2A 1EAUA 3S9CA 4BTTB 1FZZA 1UTJA 5E0HA 4YOGA 3RXPA 2KFWA 1K2I1 1O3EA 1QZ8A 3BTQE 3F2HA 3UNRA 3HK3B 1YWUA 3ZZ6A 1GJBB 4MNWA 3F6UH 2BLQA 3LJOA 3SOSA 5FXLA 2ANMH 2ZKSA 3SJ9A 1AE8H 2ZHDA 4AX9H 1YF4A 1G36A 1TWXB 1Z6JH 3GOVB 1AFQC 1QRXA 2M2AA 3ZV8A 2BY6X 1NBME 3SGAE 5AF9H 4O9VA 2BOKA 1BUIA 4CRAA 1HJAC 2A7JA 3MU5A 2KAIA 1P2MA 2WPIS 2ZECA 4INKA 2G00A 1UVSH 1BITA 3DCLA 1QL7A 3U1IB 4D9RA 1UCYH 2QF3A 3E6PH 4ABFA 1HNEE 5E0GA 3MU0A 3MO6A 3U69H 3KF2A 4A7IB 3M3VA 2YNBA 3ELAH 2XCFA 2ZHWH 1H8IH 4CR5A 2OXSA 3TJVA 1A4WH 5EOKA 3VGCB 1GJ8B 2V0BA 8GCHF 1DY8A 1JBUH 4ZKSU 4ASUD 1S6LA 3SJOA 3N99A 5FPSA 3ZZBA 2A4QA 1UMAH 1Y59T 4ZHAA 4AFQA 2CGAA 4JZFH 4ASHA 4UONA 4O3UA 1BJUA 1BRBE 3RU4T 4TPYA 1S85A 7LPRA 2QF5A 5DP9A 2G4TA 3ITIA 5B6LA 1LHCH 2WHXA 2KCAA 3MOCA 2A4RA 1CA0C 2ZCLP 1O3JA 4INHA 3FKSD 3UR6A 2IJD1 2HPQH 2GZ8A 2IPHA 4IW4E 3RXJA 1AD8H 1SQRA 1H9IE 2F9UA 5IDKA 3TLOA 5JBAS 1CGHA 1ZGVA 2JH0D 1D3PB 1GVKB 1FY4A 1SQOA 4WH8A 2EI7A 2FS9A 2ULLA 3ZZ5A 1OWDA 3SJKA 1GI9B 4FUEA 3NPSA 1FLEE 2ANWA 2CJIA 3BF6H 1OS8A 1KXBA 3TK5A 4DT7B 1BTWA 1MQ5A 2WSSD 2ZGCA 4AB9A 2LPRA 4WJG2 3SJIA 3U8TH 4SGAE 2PWXA 1J15A 2UWPA 4Q63A 1O5GH 1C5WB 1FV9A 1K21H 2OBQA 1DFPA 1ZHMA 3LT3A 3VB5A 2J34A 1ZJKA 3A88A 2FDAA 3KYGA 2PR3A 1LVMA 2GZ9A 2A2XH 2FI5E 1E37B 1E0FD 1KXAA 2THFB 3FAOA 1DPOA 1SGRE 2YMSD 2O8MA 4K1EA 1PYTD 3MH5A 2KCPA 5A0BA 3HGNA 2STAE 3GDVA 2EC9H 1GBBA 2FOFA 3RC4A 4GLYA 1TX6A 1E38B 1GWAA 4CRBA 1C5OH 2XC4A 3OU0A 2OC8A 2XNIA 1GBHA 5DP6A 2QE7D 1W0JD 2BX4A 3RM2H 2F91A 1HIAB 5CE1A 1S6FA 2OD3B 2PV9B 5K0HA 1QTFA 1C5VA 4DOQA 1QB1A 3DUXH 1FMGA 3F0OA 4LK4A 1ZHPA 1T31A 3P8GA 3Q00A 2NU0E 1D3QB 1TPPA 2HLDD 3ZV9A 1TBZH 2BD3A 2FPZA 3P6ZB 1ZMJA 5ABWA 5FBIA 1QJ6B 3T62A 4FETA 1DM4B 4UFGH 5L2ZH 3PMBB 2A4OA 1O34A 1C1RA 1QIXB 1GBIA 5EXMA 4B1TA 2PSYA 2CXVA 1BMMH 3RXLA 3P95A 3UQOA 1O3LA 2VIQA 1HAPH 1AB9B 4M7GA 2O8TA 3ZZAA 2J94A 1BMAA 4ZCNA 4HFPB 1P2NA 5CMXH 2FODA 2QF4A 4KTSA 4AG2A 1QA7A 1YPMH 3PV2A 2GVFA 3RXRA 2F3CE 1QL9A 2ZGJA 1GCDA 4AGJA 2VIDA 1EZXC 2P8OC 1D3DB 1FNIA 4X1QU 3NKKA 1JRSA 3MU1A 1UTLM 3TGIE 1OOKB 2BLWA 1K1JA 2QV1A 1W3CA 3SN8A 3TVJB 1AKSB 1NM6A 1ZTLA 3LGIA 4R8TB 2CHAB 3QDZB 3ZVDA 7ESTE 2K0QA 2WZQA 3T5FH 1ZJDA 2XWBI 3M36A 2Z9GA 2OK5A 1Z7KA 3TH2H 3KQ5A 2ZEBA 4TT3D 1O3NA 4K5ZA 4Z6AH 3DSPA 1QQ4A 1XUGA 1COWD 1HIAA 1C5NH 3MO3A 3F2FA 1TPAE 3TK6A 2Z6BD 1CT2E 2R3UA 2W26A 1P12E 1AUTC 1PPGE 5GXPA 5E8EH 2BQ6B 3A7XA 1SKYE 5G4BA 3RXVA 1O5BB 3SO3A 3ZVGA 2VWOA 1MTSA 3TITA 3GYLB 1G3DA 1B0FA 5ESBA 1P09A 3LC3A 3M61U 1KTTB 1NC6A 1V2MT 2M5TA 1GJ7B 1KLTA 4XD7D 1JXPA 5GJ4B 2VH6A 1HAVB 4K8BA 1O2WA 2D26C 4DG4A 5JB9S 4NIVA 4X8TH 4UD9H 3RXDA 1WXRA 5F8XA 2R2WU 1MAYA 2GTBA 1HAGE 1Q3XA 3TH4H 1KXFA 4FVBA 3A87A 5JDUB 1A0LA 1C1WH 1S81A 2ZDNA 3DHKH 3GY7A 4LXBH 1VCPA 3PRBA 1KLIH 2BD5A 1WQSA 1V2ST 5DPAA 1HAIH 1HGTH 1VITH 1TMUH 1K1NA 1S5SA 4RKJB 3SNAA 3VEQB 3Q3YA 1Y5AT 3BTEE 3IITA 2ZU1A 1DDJA 7GCHF 2K1QA 1GI2A 1AVGH 1HAYB 2P3TB 3NCLA 1AKSA 4YTAA 3U8OH 3HPTB 2XRCA 4K3JA 3T26A 3ZYDA 1AN1E 3RMLH 3C27B 4Y79A 3PTNA 4X2YA 2H2ZA 5E2OA 4MNXA 1MTWA 3RXBA 3ODDA 4IMQA 2ZFRH 1MKWK 3SNDA 2CK3D 2J4IA 1IHSH 1VITF 1C2HA 3CP7A 3STIA 2R0LA 3RXMA 3BG8A 4HZHA 2KZ4A 2TBSA 5DN6D 1O2ZA 2JJ2D 4LZ4B 2F9OA 1LMWB 1TRMA 4Q7ZA 1NROH 4Y8XA 1DWDH 4CH8B 1SG8B 1EPTB 5DP7A 3EYDA 1EAWA 2WINI 3ZZ3A 5GPIB 1TLDA 1D4PB 1A5IA 4I8GA 5JPMH 1HAVA 1PJPA 4X6OA 1ETTH 4K60A 2J95A 5LGOA 3PO1C 1VKYA 1GJCB 4B6FA 1HDTH 2R0KA 3K2UA 1VJ9U 1OP0A 2BVSH 1CE5A 2O8UA 1EJNA 1MBQA 2IN2A 2H9EH 1BMLA 1ZSLA 2ZIQH 5EJZA 1O3CA 2J5UA 7GCHG 4IS5A 3I29A 2SNWA 4ISIH 2Y5FA 5C94A 1XKAC 2Z3CA 1M9UA 3KQCA 1AFEH 1AFQB 2AEIH 1C5RA 3F68H 3MNXA 1C1MA 4DY7B 1MKXK 1CGJE 1EB2A 4TYDA 2B5TB 2FI3E 5GCHF 2J9NA 2ZU2A 1TGBA 1HJAB 1P06A 4IBLH 5DSFA 4D7FA 1ANBA 4K1SA 2O8WA 1TALA 3AAVA 3SU1A 2BD2A 3CS7A 1C5LH 1FDPA 4BAQB 4B71A 2J98B 3LGUA 5IYTA 5T6GA 5L6NH 2TIOA 3BG4B 3P8FA 2W6ID 3MNBA 4GHQA 3RDZA 5C1XA 1V2OT 1C2IA 1VITG 8ESTE 1TBQH 1MH0A 5EODA 3T27A 4O3TA 5PTPA 2P94A 4I31A 1TPSA 4X2VA 1RIWC 3FO8D 3ZVEA 6CHAB 1MABB 1UVOA 1FY8E 3URDA 1W11U 1HPGA 2PFEA 2PW8H 2XBWA 3F1SB 1VZQH 1EPTA 1YCPK 1ACBE 1GGDC 1W8BH 2FEQH 4X2XA 1L1JA 1PPFE 1V2LT 1HXEH 2ZCKP 3BTKE 1V2RT 1ELVA 1HAHH 3FP8E 2HNTC 1RJXB 2ZTZA 1A0HB 1BOQA 3WW7A 1SGFG 3LH1A 1FY1A 3SU6A 1AZ8A 1C2KA 3RM0H 4YM9A 3HK6B 3SW2B 2NU4E 5A0AE 4KGAA 1ZTJA 2A7CA 2XCNA 5ESTE 3P92A 1QRZA 1VGCC 3FP6E 4FUBA 4ABJA 1DE7H 5GCHG 3ZZ7A 1TABE 4Q7XA 1MUEB 2KR7A 3NXPA 3A8DA 4XRNA 1P01A 1CT4E 1IQLA 1HLTH 3LDXH 5K7RA 4MVNA 2Z3EA 1YKTA 3R3GB 4UEHH 2FYQA 1EJMA 1DXWA 3PMAB 4IC6A 1GI3A 2ZPRA 1QNJA 1GL1A 2PKSB 2UUYA 1SOZA 2QCYA 1T8NA 2J98A 3KQDA 1DITH 1XKBC 1RFNA 1NRSH 4LOYH 1UTMA 2BDIA 5EQSA 2BXTH 4XBCA 3A85A 1ZPCA 3LKWA 3BIVH 6ESTA 4B2AA 1P02A 4GAWA 1P2JA 3QTOH 1GMCF 4KTCA 1UTOA 1N8OB 1JOUB 2VWMA 1TNKA 4BNRA 2EA3A 1IQEA 1O2KA 4NWKA 2ZQ2A 1GJ6A 1O2RA 1C2EA 1ARBA 2BQWB 1O32A 5FBEA 1GJ5H 4WXVA 1KMHB 1FXYA 1C1QA 2VIVA 1AGJA 4JK6A 7KMEH 1AWFH 1V6DA 2QC2A 3ZVAA 8LPRA 4YO9A 2FLBH 3TU7H 1Y5UT 2G8TA 1MTNC 1XUKA 2VB0A 2Y82A 4O03A 4CHAC 1SLUB 1Y3WA 1ZMNA 1HBTH 2F9BH 4NZQA 1HAZB 3I78A 5DKMA 3GYMA 1FY3A 3O8CA 2HNTE 1TYNA 2VIWA 4Q80A 2CN0H 2UUFB 4B76A 3MFJA 1GI0A 1O5CB 1AI8H 4GPGA 1UK3A 5BRRE 3OAAD 2Z9JA 5A8YA 1BRAA 1ELDE 1F0SA 2AGEX 2ZGBH 3UPEA 4ISOA 2BZAA 2GCHF 1BCUH 4J1YA 2ZGXH 1LPKB 1UO6A 1OWIA 1CGIE 3H09A 1GMCG 1C2MA 1NU7B 2BQ7B 4BANB 2ANKH 4U01A 1E34B 3R0FA 1N6YA 1BQYA 4H4FA 2WPKS 3V13A 2RCEA 5EW2H 1SGQE 1THSH 3SYJA 3SUDA 1EOJA 1JRTA 4GUXA 4ISHH 3H7TA 2QXJA 3RU4D 2NU3E 1BBRE 2OP9A 5C5OA 3RXCA 1MU6B 5F8TA 1UTPA 4E05H 2J2UA 1NRRH 3FVFB 2A5IA 5HMAA 4IMZA 2P3UB 1ZRBA 3UY9A 4WXIA 2DE8A 4H6TA 1HAXB 4U30A 1LQDB 4D9QA 5CHBA 2C4FH 3SI4H 3SHAH 4MPWA 4D76A 1A3BH 1TQ0B 2H5DA 3PRDA 1P03A 5DP3A 2BOHB 1NBMD 4YZUA 2A7HA 1C9PA 2PTNA 3MWIU 2WPDD 3CENA 3O8RA 4CRGA 1PQAA 4WMFA 3MTYA 1LVOA 1RGQA 2YMSC 4BAOB 1OWJA 2GCHG 2O9QA 2WV4A 5FX6A 1O2SA 2BDCA 2W7UA 2G4UA 5EQQA 1SGPE 2OUAA 4MPUA 1QBVH 1RRKA 2I6SA 3FZZA 4H42U 3T25A 2ZDKA 4A6LA 4F4OC 1Q2WA 4MLFB 4Y0ZE 3RP2A 5LH8A 4JZDH 1EOLA 2XBYA 4A92A 4YOJA 2WV9A 3TGJE 1AMHA 1FN6A 1QB9A 3S0NA 1SGNE 4CH2B 3RXQA 3GISB 5FAHA 2ZDMA 1C5UA 3KNXA 4ZXYH 1J9CH 1RTKA 1FAKH 2GP9B 2KM0A 3NZIA 3MU8A 4MPXA 3ZVCA 4CR9A 2VINA 1H8DH 4PROA 1KDQB 1OXGA 1NRQH 1GG6B 2A5AA 1TNJA 4VGCB 2K8IA 1ORFA 3LPRA 1OYTH 4AC9A 1NTPA 2ZPQA 3DSOA 1LHFH 4ZMAH 3LGYA 3M5OA 1V2VT 5T1VA 2GT7A 1G3EA 4WVPE 1XM1A 2D8WA 1W0ZU 1TMTH 1K0HA 4NA7A 1TAWA 1T4UH 1Z8RA 3AVZA 4RKOB 1AZZA 1UVUH 4B6EA 1J17T 1GCTB 4E06H 4JMYA 1O2IA 3PO1B 4I8LA 2HNTF 2BHGA 4GCHF 4Q4LA 2C93B 1HCGA 1MKWH 4NWLA 2C8XB 1QL8A 1MCVA 2XW9A 2H6MA 1YPLH 5CDFE 5TCAA 4DCDA 1C5MD 8GCHG 1TGCA 1V2WT 3A7ZA 1SFQB 3F2GA 1A5HA 1BIOA 1BBRH 1DLKB 1V2QT 1E79D 3ZVFA 1CHGA 1F0UA 1V2JT 1EXFA 2ZA5A 2HLCA 3PV5A 5DP5A 4RSPA 1QY6A 1DS2E 2R9PA 2ALVA 4TPIZ 2GDEH 1GJDB 3SHCH 1FN8A 3QGJA 2VVUA 5A0CA 1O5EH 2BY5X 3AK5A 5C3NA 1QCPA 2BY7X 1K1LA 4B73A 1ZGIA 5E0JA 1EZUC 1ZHRA 3QUMP 2Y5GA 1SI5H 1EJAA 2FOHA 2GV6A 2P59A 2VH0A 1NO9H 1JMOH 1CBWC 3RXFA 3E8LA 1WU1A 1P2OA 2PHBA 2XC0A 1EP5A 4FUCA 3T28A 3P17H 1GI4A 2C3SA 3BTTE 3H5CB 3MNSA 1HB0B 1GBFA 1YP9A 3MH7A 1TIOA 1YCPM 1RIWB 4DW2U 1GMDF 1KDQA 2Z9KA 1TNGA 1FPCH 1BTUA 1G37A 1XX9A 1ANCA 5HIYA 2VGCB 3LOXA 1WTHD 3N7OA 1MKXH 2ZC9H 1ANEA 1G3CA 1V2KT 1W13U 3HATH 4MNVA 1IQKA 2ZFQH 1GGDB 1N6XA 4YLQH 3DA9B 5C17A 1W0KD 3PWBA 4X1PU 3DFLA 1YPGH 3S69A 4CRDA 2VIOA 5JBTA 1XVOA 2PLXA 2NWNA 2GCTC 4GCHG 3SJ8A 1MQ6A 1H9LB 1XXDA 4ACAA 1F5KU 2XTTB 3TJNA 1HFDA 2VJ1A 2VWLA 4FU9A 3PB1E 3Q76A 1V2NT 5TJXA 5LPRA 3KYFA 3UOPA 3WY8A 1QQUA 1TNHA 1TBRH 4KP0A 1L4DA 2HVXA 3SZEA 2CF9H 4KKDA 4X6MA 4HGCA 4ISLA 4XSKU 2SGDE 1VGCB 3TNSA 4I86A 1HAOH 1GL0E 2ZDAH 1WTGH 2EI6A 3BEIB 4ZKOU 1GBDA 3B8JA 2O8LA 1V3XA 1S84A 2OQ5A 1LPGB 4A1VA 2GMTB 2A31A 3VB4A 1LTOA 3VPKA 1TGNA 3O8BA 1GHAF 5AVDA 4MTBA 3M3TA 4ABIA 3AW0A 1O35A 3UTUH 2W3IA 5FCRA 1IQJA 2ODQA 4NA9H 1QA0A 4ZKNU 4AORA 2RFKC 1E36B 3WWBA 3ZZ8A 1H4WA 2Y7XA 1UW7A 1S82A 1ELAA 2JKHA 2ASUB 1GMDG 4AG1A 1FUJA 3OFND 3A7VA 1GVLA 3RLYH 1S83A 2FTMA 3P70B 5J4SA 1O3PB 3M5LA 1P2IA 4TY6A 1S0QA 1Y5BT 4DT4A 1UCYK 1J14A 4WMEA 2Z94A 3TK9A 4Q2KA 1A3EH 4X0WU 2B9LA 1LPZB 2TGAA 3W94A 2RDLA 1TX7A 2V3MA 3CNRA 3PROA 4XBDA 1C2DA 4UDWH 5GWZA 1C1TA 4IN2A 3SORA 1DWBH 3ZYEA 2UWOA 4IC5A 3MNCA 3PTBA 1SHYA 3A8AA 2ODYB 2QXHA 2FO9A 1GBJA 1O2VA 4XE4A 2BMGB 4Y7AA 5FCKA 3RXUA 2JIZD 4F49A 3V12A 1IQGA 4ZXXH 4GVUA 1LO6A 2DE9A 1AUJA 2CV3A 3RUOA 3I77A 1L1GA 4FVDA 3SV8A 2W6JD 3GCTF 3U1JB 4Y6DA 3A7YA 2FMJA 3RC6A 2ZHFH 3ZIAD 5I46H 2FX4A 4FOUC 1SSXA 2B0FA 2ZU5A 2GJGA 2ZGHA 3TH3H 1PPHE 2VVCA 4YESB 1GHAG 3L33A 5EIYA 4HI3A 1BB0B 1PPCE 3EA7A 3M5NA 1SGYE 5FPTA 3U8RH 2B7DH 2YNAA 2BDAA 1BRCE 4INLA 1UTQA 2BD8A 1ELCA 4F48B 1W7GH 3BSQA 3BV9B 4AGKA 3GY6A 2ODPA 1RXPA 3BTFE 1BMFD 1CT0E 1NY22 5CHAB 2BB4A 4ABAA 2EI8A 2GZ7A 3TJUA 4AFSA 1C5TA 3GDSA 2A2QH 3RXAA 2TPIZ 1EB1H 1ELFA 3M35A 4OS2A 3QZQA 4M9FA 5GNDA 1RS0A 2Z3DA 2BVRH 3O8DA 1GHBF 2ZFTA 3NRLA 3BEUA 2FTLE 1IQNA 1VCWA 4X2WA 1C4V2 1T7CA 4FU8A 3V0XA 4AOQA 4X6PA 2OC1A 1GMHF 3B9FH 3G01A 1L0ZA 1O3DA 1SLXB 2QXIA 2G52A 5JB8S 2FOMB 4ZAEA 1SR5C 1EKBB 1PQ8A 3PYHA 4JYUH 4DIHH 2ZHEH 5L2YH 4SGBE 3PM3A 3VFEA 3N7EA 2F83A 1FIWA 4THNH 1XXFA 2BDHA 4R0IA 1QBOA 1ETSH 1ZOMA 1GBTA 3UNQA 5C20A 5C67A 4ISNA 4WMDA 1W7XH 4HG6A 1MZDA 2ZFPH 4X1RU 4BTIB 4B75A 1ZYOA 3H7OA 4RT0A 3RMNH 1O5AB 2OINA 4Y7BA 3ATLA 1KSNA 2GV7A 1OKXA 3IG6B 3V3MA 1ID5H 1EZSC 2BZ6H 3A81A 4CBNA 4BOHA 5DJ7A 1QJ1B 1O2QA 1TB6H 1QBNA 2GGVB 3KQBA 3D49H 1FPHH 1SBWA 1ZPZA 1YPJH 3ZZ9A 1GDQA 1KLJH 4Y10E 2QA9E 1MTUA 3OSYA 4Y11E 1F0RA 2I6QA 4RI0A 1YPKH 1TFXA 1VCQA 1ABJH 3RXSA 1OWKA 2GX4A 1WAYB 1P04A 3A8BA 4NFFA 1GHBG 2FS8A 3F9GA 2SNVA 3VXFH 4FUJA 2FXRA 4U2WA 3UOUA 1GMHG 1MAXA 4Y0YE 1O5DH 3KL6A 3F9EA 3D23A 3EE7A 2HVYB 1AVXA 1CA0B 1OWHA 1W14U 3GCHC 3GS9A 3EA9A 5BPEA 1C1PA 5HXFA 4CBOA 1O3IA 3E0PB 5F03A 5FPYA 3RLWH 4YLUA 2FOBA 2JETC 1XUHA 1ZLRA 3SU4A 5B6OA 2QXGA 1HUTH 1FONA 4FUGA 3LONA 1DX5M 2QAAA 5DP8A 4JZEH 1IHTH 2UUJB 4NFEA 1EQ9A 4JCNA 3TPIZ 1O3GA 9LPRA 1HRTH 1ZTKA 1C2JA 1UVPA 3Q3XA 4I32A 1LKAA 4AZ2B 1BTPA 1YM0A 1A2CH 1GPZA 4AN7A 3UB0A 3VB7A 4UFEH 3RXHA 2ZHQH 4K2YA 3SNCA 3A86A 4RT1A 3U9AH 4GHTA 1KY9A 2CHAC 1BMNH 1K1OA 1GDUA 2ZU3A 1P9SA 2C8ZB 2BY8X 1ZSJA 2BVXH 3SGQE 5SGAE 1BZXE 3V7TA 3STJA 1CQQA 3BIUH 4DIIH 3DD2H 1E1RD 2GD4B 1XMNB 2J38A 4JK5A 1BHXF 1YPHC 3GY5A 2G55A 2QGRA 3QWCH 4X8SH 5JYIA 4ABHA 1JIRA 2QF0A 3C1KA 2GT8A 1EZQA 2AGIX 3BTWE 5T3HA 1BJVA 2PUQH 1DUEA 3DT0H 1SGDE 2AHME 1BTYA 2VVVA 3PLBA 3FOAA 3S9AA 1C2LA 1SL3A 3SZNA 3KQEA 4DGJA 2JH5D 3UAIC 2DUCA 2WYGA 3K65B 1AVWA 1FIZA 2A1DB 4TY7A 2V7QD 3MYWA 1P05A 1H8HD 1LHEH 1LDTT 4YT6H 5FL7D 2PTCE 1WV7H 1TRYA 5C1YA 2FIRH 1MD7A 1MMJN 1K28D 1L4ZA 1V2TT 2F4LA 2ZG0H 2P8OB 4FUIA 2OBOA 1CSOE 2WYJA 3M7UA 1KYNA 2KCOA 3KEEA 2BLVA 1WDIA 1SGCA 2P3FH 4WWYA 1RD3B 3K9XB 1ELGA 5C1UA 2VWNA 2LNCA 2FLRH 3AASA 1KIGH 1RTLA 1V2PT 1A7SA 5JBBS 1C9TA 1THPB 3K6YA 1MBMA 3MU4A 1O3FA 4NIWA 3ZVBA 2ZWLH 4ABDA 4FXGH 1DOJA 1QFKH 2G5NA 4OS5A 2A32A 3SV2H 1AU8A 1J8AA 1ELTA 3OEED 5EGMA 3UR9A 1LHDH 3U98H 1SMFE 1TONA 2Y6TA 5JBCS 1P57B 1O36A 1YGCH 2ESTE 1SVPA 1PPEE 1H9HE 1W12U 1O3MA 3GY4A 1P10A 1NRNH 3IWMA 1AO5A 1EPTC 2FZZA 5HKKD 3UWIA 3OYPA 1TNIA 4CRFA 1PPBH 1SGTA 4AYYB 1A0JA 2OLGA 3ZZ4A 5C0UA 3A83A 1O0DH 4WF8A 1V2UT 1C5QA 3P8OA 3A84A 2B8OH 1BRUP 1RTFB 1OHHD 3PMJA 4Y76A 2PUXB 1FAXA 1INCA 2JDID 5AHGH 2Y81A 3M7QA 3T29A 2EQNA 2AMDA 2F9VA 2FYRA 2XBVA 3TIUA 1W2KH 4K69A 2FX6A 1DVAH 1W0YH 3F0PA 4KELA 2PKAA 2Q6DA 1LVBA 2A0QB 4OGXA 1CU1A 1PYTC 4B2BA 2STBE 5I25A 3MQKC 3EQ0H 1WQVH 3NK8A 3SUFA 1BTHH 3QZRA 1X7AC 1GI7B 1KXDA 4OS4A 3FANA 5H4IB 4A5TS 1YLDA 3KCGH 1P2KA 2FP7B 4I8JA 3PMHB 2WUCA 4AFZA 3BG4C 3UREA 2ZO3H 3QX5H 1TE0A 1GJ9B 1HJ8A 2Q1JA 4ABGA 2UUKB 1OX1A 2TRMA 2Z7FE 1O2LA 3SV9A 3E0NB 3UUZA 1DSTA 5T6DA 3DFJA 5EPYA 5T6FA 2TGPZ 5DP4A 6CHAC 4QT8C 1LQEA 1TPOA 2R2MB 1O3OA 1C4Y2 1NESE 2W5EA 4FU7A 5FHTA 1TGSZ 1T8OA 4ZKRU 1Y8TA 4ESTE 1FX0B 3JZ1B 5F53A 3DSGA 2BD9A 1UJ1A 1DXPA 4DVAU 2HOBA 2J92A 1C5XB 1YBWA 2D2DA 1KXCA 1TA2A 2RG3A 2XNDD 3QK1A 1Y3XA 4ZH8A 2GKVE 4X6NA 3SQHE 1OPHB 1YLNA 3SQEE 8KME2 3RMOH 5LPEA 2BDBA 3URCA 2C8YB 3K6ZA 4Y8ZA 3M37A 2SGPE 1IOEA 1C2FA 1MD8A 1ZR0A 4BXSA 1NZQH 3D65E 3LJJA 1HYLA 1SQTA 1BTXA 3BTHE 1OSSA 2WPMS 3EGKH 4JZIA 4B74A 1ZZZA 3RXGA 4TWWA 1O2TA 3UWJH 1NFXA 1B0EA 2PKSC 1Y3YA 1Y3UA 2WV5A 2P93A 2AYWA 1SLVB 2Z9IA 1ARCA 1EUFA 1Z71A 1SGEE 3Q77A 4XOJA 3ZZDA 5GIBA 2TGTA 1WOFA 1PQ5A 4WH6A 2BY9X 2V3HH 3M3SA 3L6PA 4OS7A 2ZU4A 4UE7H 1JWTA 3ODFA 1O2MA 1TOCB 1P0SH 4HTCH 4NCYA 1DWCH 1YLCA 1F2SE 3VB3A 1F92A 1YYY1 1ZSKA 4E7NA 3MH4A 3ATIA 3NWUA 1DANH 3F3BA 1O5FH 3FZDA 5L30H 1N8OC 1Y3VA 1O2HA 2ZDVH 2GDDA 3OX7U 3LC5A 3LIWA 3M5MA 2HWLB 1S0RA 3RXIA 5EXNA 3WWFA 1ETRH 1C1OA 5EJ1A 3BTGE 1ESBA 2W3KA 1VR1H 3GCOA 1WCZA 3UNSA 3SV7A 3HGPA 1FQ3A 3SV6A 4AYVB 5EU8A 3ATMA 4DURA 3PWCA 1GHWH 2KX4A 2P95A 1ZPBA 2FOGA 2HGTH 3GDUA 2BTCE 1U6QA 4WY3A 3GCHB 4I8HA 4ZHMU 4IN1A 1DSUA 1O2PA 2AIPA 1IQHA 1H8ED 1TRNA 2V6NA 4A1XA 2ZPSA 1K9OE 3QGNB 3L3TA 5EG4A 1O2OA 2H1UA 3GY3A 3E90B 2ZZUH 4F55A 1CO7E 2JETB 3RXOA 5LPFA 1O37A 2VU8E 3B23B 3Q3KA 2ZNKH 4B2CA 2XYAA 1XUJA 1C2GA 1YY3A 3MMGA 3W95A 3ENSB 4Y8YA 1YCPH 2Z9LA 3ATKA 1O30A 1Z1IA 2XC5A 5F6MA 1B7XB 1A61H 5AFYH 1C5ZB 2VNTA 1O3HA 2BD4A 2G51A 3A7TA 2FOCA 1ESAA 3HKIB 1PPZA 4FUFA 2UWLA 1S6HA 2WUBA 1MCTA 1QHRB 1UHBB 1OYQA 2BD7A 4UFDH 4P02A 1SHHB 1GHYH 1C4U2 2ZF0H 2A45B 4Y71A 1A1RA 2F43B 4YOIA 4NIYA 1D6RA 1WYKA 5AFZH 2CF8H 2VBCA 3S9BA 2V3OH 1OP8A 1EASA 1G3BA 5EXLA 2ZFFH 2XOKD 3FN8A 1Z8JB 3UFAA 2J97A 4D8NA 3KHVA 1Z1JA 1TA6A 1GI6A 1DT2A 1HV7A 1N1LA 3LGVA 2R3YA 2P16A 2G81E 1O39A 1SB1H 5J4QA 1PFXC 1MZAA 5HM2A 1OP2A 3N7DA 1T8MA 5HIZA 1TGTA 1BT7A 4JZ1A 5GDSH 1GI1A 1MTVA 5TCCA 1EAXA 3E91A 1MTNB 4ZHLU 2EEKA 1NFUA 4CHAB 3TNTA 2BX3A 2G5VA 2FM2A 3LH3A 5DG6A 2F9PA 1P2QA 1P3EA 1O2JA 1T4VH 1TQ7B 3FP7E 3GICB 2ILNA 3F9FA 1A46H 2H9HA 5DGJA 2OQUA 1TX8A 3MO9A 5HGGA 1IQIA 3M7TA 1LKBA 2Y7ZA 3BN9A 2FESH 1LCYA 1F5LA 1O3AA 3VGCC 2KCYA 3PLPA 5HM9A 2BXUH 1O33A 1O3KA 2Q6FA 5EPNA 1TNLA 1DUAA 4NA8A 2OTVA 2H9TH 1UHBA 2JH6D 4X8UH 4AFUA 1O2YA 4ABEA 5ETXA 3LU9B 1NFWA 1C1NA 1WSSH 5HYOA 3LGWA 4CREA 1QURH 4XFQA 1BDAA 3S7KB 4NZLA 3MI4A 1NRPH 1Q31A 4K1TA 2AIQA 4NG9H 3ATWA 3QLPH 2F9NA 1BTZA 4D7GA 4XBBA 1K1IA 4ZROA 2AMQA 2BDGA 2BYAX 5KEDA 3FFGA 4NSYA 1ABIH 1A5GH 2FOEA 2OCVB 2IPQX 1BBRK 1GG6C 4VGCC 1AQ7A 1AWHB 1O3BA 1KTSB 4KTUA 3F9HA 4OS1A 3LGTA 3RXKA 1D9IA 1GI5A 3W1EA 1YC0A 2SGQE 3GCNA 1ELBA 3RMMH 3GCTG 5F8ZA 4ACBA 3EAJA 2YOLA 3RC5A 1KXEA 2L74A 1GCTC 1O2UA 2RDEA 3OTPA 2AFQB 3S7HB 2SGAA 3BTME 1GJ4H 4AB8A 5A09A 1FI8A 4IGDA 3SNEA 1T32A 2QN5T 4FUDA 1QB6A 2JJ1D 1Z6EA 2ANYA 2HALA 4I8KA 4BTUB 1F5RA 3QTVH 1EX3A 3T2NA 3EDXB 5C5NA 1NS3A 3SU5A 2ZDLA 2HPPH 3GY2A 2Q6GA 3E16B 3ZZCA 4BAHB 3E1XB 3RXTA 3EA8A 2YMSB 1C1UH 1SOTA 1GVZA 1JIMA 3QN7A 2AH4X 1G9IE 3EE0B 1GI8B 2AS9A 1H1BA 4U32A 3SGBE 1K22H 1K1PA 2ZQ1A 2WPHS 1WBGB 5EJLA 1G30B 3KGPA 4X1SU 3P8NA 1NFYA 2Y5HA 2PGQB 2PSXA 3OE7D 6LPRA 4JYTA 1FJSA 3OY6U 3RXEA 1O2NA 1F0TA 4BXWA 1NT1A 4RN6A 2IOTA 2SFAA 1QGFA 2IJOB 1DWEH 2ZFSA 1ZRKA 2AMPA 2TGDA 2VGCC 2VIPA 4NSVA 1YPEH 3SUEA 1Z8IB 2WPLS 2ZTXA 3KIDU 1SGIB 2HRVA 3A80A 2LELA 3E3TA 6GCHF 3JZ2B 1P11E 1AB9C 2OC0A 2BLOA 2C8WB 4X8VH 4Z0KA 5KGOA 5A8ZA 4TSFD 3OEHD 1C5SA 1NU9A 4GSOA 1P3CA 4YXWD 1SPJA 2ZI2H 5C2ZA 3CS0A 3HKJB 2L6OA 4MPVA 1FY5A 4CRCA 1EP6A 2AERH 4J2YB 5A8XA 1LHGH 1DICA 1QJ7B 1G2LA 3OY5U 1VJAU 1MU8B 3ESTA 2Y80A 4DJZB 4BAKB 4I7YH 3SU0A 2C90B 2QIQA 1T8LA 1GBKA 1NPMA 3A82A 4FUHA 3PV4A 1GHVH 2SGFE 4MG3A 1XUFA 1SQAA 2GMTC 1ANDA 1L2EA 3OTJE 4OS6A 3SUGA 5DO4H 2AGGX 3A89A 3MHWU 5FX5A 2A4GA 1G32B 4O97A 1GBMA 2PP6A 4K8YA 4E7RG 3UQVA 1UK2A 2FI4E 4MDSA 3VG8A 1O2GH 1GJAB 4YT7H 1L1NA 1G2MA 1C5YB 1D6WA 1IAUA 3QO6A 1C1SA 3TJOA 1THRH 4ZUHA 2CMYA 3BTDE 1CBWB 1DLEA 4MNYA 2QY0B 3TGKE 2FOAA 2NU2E 1Z8GA 2XXLA 1W10U 1SLWB 4LZ1H 2D1JA 2BM2A 1GHZA 4MQAA 1UVTH 6GCHG 2ALPA 3BEFB 1OWEA 4OGYA 2BDYA 1UCYE 1CHOF 1DY9A 2PGBB 5EQRA 2ZCHP 1UTNA 4ABBA 1K1MA 2V35A 4UFFH 1IQMA 1CA8B 1O2XA 1XVMA 1P9UA 4I33A 2XWAA 4OM9A 1SFIA 2A5KA 4NGAH 3GY8A 2RA0A 2H5CA 9ESTA 3SBKA 1PQ7A 1BA8B 1CVWH 2FWWA 2QYIA 2ZTYA 2GCTB 1NN6A 3AW1A 4XDEA 1ZMLA 2SGEE 2WPJS 3AAUA 4H6SB 3A8CA 1D3TB 3U28C 1E1QD 5EW1H 2PKAB 1GDNA 2RA3A 4TWYA 1SGFA 1GBEA 1TMBH
chains in the Genus database with same CATH topology
1C5PA 2XBXA 1AY6H 2KAIB 1GHXH 4JYVH 1B5GH 1HXFH 3NUMA 3PLKA 1GBCA 1EATA 4A1TA 1C1VH 1LVYA 1O38A 1ELEE 1P8VC 1TOMH 4BAMB 4X1NU 1GBAA 3SU3A 2ZP0H 1F7ZA 4NIXA 2OC7A 1UK4A 1ESTA 3D62A 2W7SA 3VB6A 1BHXB 1QR3E 1O31A 3A7WA 1J16A 4Q7YA 5E2PA 5CHAC 1E35B 5DK1A 1GBLA 3SNBA 1HJ9A 1QRWA 1AHTH 3MH6A 1XUIA 1CHOG 3SI3H 1EAIA 3VXEH 1IQFA 5A2MH 1AE5A 3RU4E 3UIRA 1AIXH 1SC8U 2NU1E 3SU2A 1UTKA 1WUNH 1YPHE 3KN2A 1EAUA 3S9CA 4BTTB 1FZZA 1UTJA 5E0HA 4YOGA 3RXPA 1K2I1 1O3EA 3BTQE 3UNRA 3HK3B 3ZZ6A 1GJBB 4MNWA 3F6UH 2BLQA 3LJOA 3SOSA 5FXLA 2ANMH 2ZKSA 3SJ9A 1AE8H 2ZHDA 4AX9H 1YF4A 1G36A 1TWXB 1Z6JH 3GOVB 1AFQC 1QRXA 3ZV8A 2BY6X 3SGAE 5AF9H 4O9VA 2BOKA 1BUIA 4CRAA 1HJAC 2A7JA 3MU5A 2KAIA 1P2MA 2WPIS 2ZECA 4INKA 2G00A 1UVSH 1BITA 3U1IB 1QL7A 4D9RA 1UCYH 2QF3A 3E6PH 4ABFA 1HNEE 5E0GA 3MU0A 3MO6A 3U69H 3KF2A 4A7IB 3M3VA 2YNBA 3ELAH 2XCFA 2ZHWH 1H8IH 4CR5A 2OXSA 3TJVA 1A4WH 5EOKA 3VGCB 1GJ8B 2V0BA 8GCHF 1DY8A 1JBUH 4ZKSU 3SJOA 5FPSA 3ZZBA 2A4QA 1UMAH 1Y59T 4ZHAA 4AFQA 2CGAA 4JZFH 4ASHA 4UONA 4O3UA 1BJUA 1BRBE 3RU4T 4TPYA 1S85A 7LPRA 5DP9A 2G4TA 3ITIA 1LHCH 3MOCA 2A4RA 1CA0C 2ZCLP 1O3JA 4INHA 3UR6A 2HPQH 2GZ8A 2IPHA 4IW4E 3RXJA 1AD8H 2F9UA 1H9IE 5IDKA 3TLOA 5JBAS 1CGHA 1ZGVA 2JH0D 1D3PB 1GVKB 1FY4A 1SQOA 4WH8A 2EI7A 2FS9A 2ULLA 3ZZ5A 1OWDA 3SJKA 1GI9B 4FUEA 3NPSA 1FLEE 2ANWA 2CJIA 3BF6H 1OS8A 1KXBA 3TK5A 4DT7B 1BTWA 1MQ5A 2ZGCA 4AB9A 2LPRA 4WJG2 3SJIA 3U8TH 4SGAE 2PWXA 1J15A 2UWPA 1O5GH 1C5WB 1FV9A 1K21H 2OBQA 1DFPA 1ZHMA 3LT3A 3VB5A 2J34A 1ZJKA 3A88A 2FDAA 2PR3A 1LVMA 2GZ9A 2A2XH 2FI5E 1E37B 1E0FD 1KXAA 2THFB 3FAOA 1DPOA 1SGRE 2O8MA 4K1EA 1PYTD 3MH5A 5A0BA 3HGNA 2STAE 3GDVA 2EC9H 1GBBA 2FOFA 3RC4A 4GLYA 1TX6A 1E38B 1GWAA 4CRBA 1C5OH 2XC4A 3OU0A 2OC8A 2XNIA 1GBHA 5DP6A 2BX4A 3RM2H 2F91A 1HIAB 5CE1A 1S6FA 2OD3B 2PV9B 5K0HA 1QTFA 1C5VA 4DOQA 1QB1A 3DUXH 1FMGA 4LK4A 1ZHPA 1T31A 3P8GA 3Q00A 2NU0E 1D3QB 1TPPA 3ZV9A 1TBZH 2BD3A 2FPZA 3P6ZB 1ZMJA 5ABWA 5FBIA 1QJ6B 3T62A 1DM4B 4UFGH 5L2ZH 3PMBB 2A4OA 1O34A 1C1RA 1QIXB 1GBIA 5EXMA 4B1TA 2PSYA 2CXVA 1BMMH 3RXLA 3P95A 3UQOA 1O3LA 2VIQA 1HAPH 1AB9B 4M7GA 2O8TA 3ZZAA 2J94A 1BMAA 4HFPB 1P2NA 5CMXH 2FODA 4KTSA 4AG2A 1QA7A 1YPMH 2GVFA 3RXRA 2F3CE 1QL9A 2ZGJA 1GCDA 4AGJA 2VIDA 1EZXC 2P8OC 1D3DB 1FNIA 4X1QU 3NKKA 1JRSA 3MU1A 1UTLM 3TGIE 1OOKB 2BLWA 1K1JA 2QV1A 1W3CA 3SN8A 3TVJB 1AKSB 1NM6A 1ZTLA 3LGIA 4R8TB 2CHAB 3QDZB 3ZVDA 7ESTE 3T5FH 1ZJDA 2XWBI 3M36A 2Z9GA 1Z7KA 3TH2H 2ZEBA 1O3NA 4K5ZA 4Z6AH 1QQ4A 1XUGA 1HIAA 1C5NH 3MO3A 1TPAE 3TK6A 2Z6BD 1CT2E 2R3UA 2W26A 1P12E 1AUTC 1PPGE 5GXPA 5E8EH 2BQ6B 3A7XA 3RXVA 5G4BA 1O5BB 3SO3A 3ZVGA 2VWOA 1MTSA 3TITA 3GYLB 1G3DA 1B0FA 5ESBA 1P09A 3LC3A 3M61U 2M5TA 1KTTB 1NC6A 1V2MT 1GJ7B 1KLTA 1JXPA 5GJ4B 2VH6A 1HAVB 4K8BA 1O2WA 2D26C 4DG4A 5JB9S 4NIVA 4X8TH 4UD9H 3RXDA 5F8XA 2R2WU 1MAYA 2GTBA 1HAGE 1Q3XA 3TH4H 1KXFA 4FVBA 3A87A 5JDUB 1A0LA 1C1WH 1S81A 2ZDNA 3DHKH 3GY7A 4LXBH 1VCPA 1KLIH 2BD5A 1WQSA 1V2ST 5DPAA 1HAIH 1HGTH 1VITH 1TMUH 1K1NA 1S5SA 4RKJB 3SNAA 3VEQB 3Q3YA 1Y5AT 3BTEE 3IITA 2ZU1A 1DDJA 7GCHF 2K1QA 1GI2A 1AVGH 1HAYB 2P3TB 3NCLA 1AKSA 4YTAA 3U8OH 3HPTB 2XRCA 4K3JA 3T26A 3ZYDA 1AN1E 3RMLH 3C27B 4Y79A 3PTNA 4X2YA 2H2ZA 5E2OA 4MNXA 1MTWA 3RXBA 3ODDA 4IMQA 2ZFRH 1MKWK 3SNDA 2J4IA 1IHSH 1VITF 1C2HA 3CP7A 3STIA 2R0LA 3RXMA 3BG8A 4HZHA 2TBSA 1O2ZA 4LZ4B 2F9OA 1LMWB 1TRMA 4Q7ZA 1NROH 4Y8XA 1DWDH 4CH8B 1SG8B 1EPTB 5DP7A 3EYDA 1EAWA 2WINI 3ZZ3A 5GPIB 1TLDA 1D4PB 1A5IA 4I8GA 5JPMH 1HAVA 1PJPA 4X6OA 1ETTH 4K60A 2J95A 5LGOA 3PO1C 1GJCB 1HDTH 2R0KA 3K2UA 1VJ9U 1OP0A 2BVSH 1CE5A 2O8UA 1EJNA 1MBQA 2IN2A 2H9EH 1BMLA 1ZSLA 2ZIQH 1O3CA 7GCHG 4IS5A 3I29A 2SNWA 4ISIH 2Y5FA 1XKAC 2Z3CA 1M9UA 3KQCA 1AFEH 1AFQB 2AEIH 1C5RA 3F68H 3MNXA 1C1MA 4DY7B 1MKXK 1CGJE 1EB2A 4TYDA 2B5TB 2FI3E 5GCHF 2J9NA 2ZU2A 1TGBA 1HJAB 1P06A 4IBLH 4D7FA 1ANBA 4K1SA 2O8WA 1TALA 3AAVA 3SU1A 2BD2A 3CS7A 1C5LH 1FDPA 4BAQB 4B71A 3LGUA 5IYTA 5T6GA 5L6NH 2TIOA 3BG4B 3P8FA 4GHQA 3MNBA 3RDZA 5C1XA 1V2OT 1C2IA 1VITG 8ESTE 1TBQH 1MH0A 5EODA 3T27A 4O3TA 5PTPA 2P94A 4I31A 1TPSA 4X2VA 1RIWC 3ZVEA 6CHAB 1UVOA 1FY8E 3URDA 1W11U 1HPGA 2PFEA 2PW8H 2XBWA 3F1SB 1VZQH 1EPTA 1YCPK 1ACBE 1GGDC 1W8BH 2FEQH 4X2XA 1L1JA 1PPFE 1V2LT 1HXEH 2ZCKP 3BTKE 1V2RT 1ELVA 1HAHH 3FP8E 2HNTC 1RJXB 2ZTZA 1A0HB 1BOQA 1SGFG 3LH1A 1FY1A 3SU6A 1AZ8A 1C2KA 3RM0H 4YM9A 3HK6B 3SW2B 2NU4E 5A0AE 4KGAA 1ZTJA 2A7CA 2XCNA 5ESTE 3P92A 1QRZA 1VGCC 3FP6E 4FUBA 4ABJA 1DE7H 5GCHG 3ZZ7A 1TABE 4Q7XA 1MUEB 3NXPA 3A8DA 1P01A 1CT4E 1IQLA 1HLTH 3LDXH 5K7RA 4MVNA 2Z3EA 1YKTA 3R3GB 4UEHH 2FYQA 1EJMA 1DXWA 3PMAB 4IC6A 1GI3A 2ZPRA 1QNJA 1GL1A 2PKSB 2UUYA 1SOZA 2QCYA 1T8NA 3KQDA 1DITH 1XKBC 1RFNA 1NRSH 4LOYH 1UTMA 2BDIA 5EQSA 2BXTH 4XBCA 3A85A 1ZPCA 3LKWA 3BIVH 6ESTA 4B2AA 1P02A 4GAWA 1P2JA 3QTOH 1GMCF 4KTCA 1UTOA 1N8OB 1JOUB 2VWMA 1TNKA 4BNRA 2EA3A 1IQEA 1O2KA 4NWKA 2ZQ2A 1GJ6A 1O2RA 1C2EA 1ARBA 2BQWB 1O32A 5FBEA 1GJ5H 4WXVA 1FXYA 1C1QA 2VIVA 1AGJA 4JK6A 7KMEH 1AWFH 1V6DA 2QC2A 3ZVAA 8LPRA 4YO9A 2FLBH 3TU7H 1Y5UT 2G8TA 1MTNC 1XUKA 2VB0A 2Y82A 4O03A 4CHAC 1SLUB 1Y3WA 1ZMNA 1HBTH 2F9BH 4NZQA 1HAZB 3I78A 5DKMA 3GYMA 1FY3A 3O8CA 2HNTE 1TYNA 2VIWA 4Q80A 2CN0H 2UUFB 4B76A 3MFJA 1GI0A 1O5CB 1AI8H 4GPGA 1UK3A 5BRRE 2Z9JA 5A8YA 1BRAA 1ELDE 1F0SA 2AGEX 2ZGBH 3UPEA 4ISOA 2BZAA 2GCHF 1BCUH 4J1YA 2ZGXH 1LPKB 1UO6A 1OWIA 1CGIE 1GMCG 1C2MA 1NU7B 2BQ7B 4BANB 2ANKH 4U01A 1E34B 3R0FA 1N6YA 1BQYA 4H4FA 2WPKS 3V13A 2RCEA 5EW2H 1SGQE 1THSH 3SUDA 1EOJA 1JRTA 4GUXA 4ISHH 3H7TA 2QXJA 3RU4D 2NU3E 1BBRE 2OP9A 5C5OA 3RXCA 1MU6B 5F8TA 1UTPA 4E05H 2J2UA 1NRRH 3FVFB 2A5IA 5HMAA 4IMZA 2P3UB 1ZRBA 3UY9A 4WXIA 2DE8A 4H6TA 1HAXB 4U30A 1LQDB 4D9QA 2C4FH 3SI4H 3SHAH 4MPWA 4D76A 1A3BH 1TQ0B 2H5DA 1P03A 5DP3A 2BOHB 4YZUA 2A7HA 1C9PA 2PTNA 3MWIU 3CENA 3O8RA 4CRGA 1PQAA 4WMFA 3MTYA 1LVOA 1RGQA 4BAOB 1OWJA 2GCHG 2O9QA 2WV4A 5FX6A 1O2SA 2BDCA 2W7UA 2G4UA 5EQQA 1SGPE 2OUAA 4MPUA 1QBVH 1RRKA 2I6SA 3FZZA 4H42U 3T25A 2ZDKA 4A6LA 4F4OC 1Q2WA 4MLFB 4Y0ZE 3RP2A 5LH8A 4JZDH 1EOLA 2XBYA 4A92A 4YOJA 3TGJE 1AMHA 1FN6A 1QB9A 3S0NA 1SGNE 4CH2B 3RXQA 3GISB 5FAHA 2ZDMA 1C5UA 3KNXA 4ZXYH 1J9CH 1RTKA 1FAKH 2GP9B 3NZIA 3MU8A 4MPXA 3ZVCA 4CR9A 2VINA 1H8DH 4PROA 1KDQB 1OXGA 1NRQH 1GG6B 2A5AA 1TNJA 4VGCB 1ORFA 3LPRA 1OYTH 1NTPA 2ZPQA 1LHFH 4ZMAH 3LGYA 3M5OA 1V2VT 2GT7A 1G3EA 4WVPE 1XM1A 2D8WA 1W0ZU 1TMTH 4NA7A 1TAWA 1T4UH 1Z8RA 3AVZA 4RKOB 1AZZA 1UVUH 1J17T 1GCTB 4E06H 4JMYA 1O2IA 3PO1B 4I8LA 2HNTF 2BHGA 4GCHF 2C93B 1HCGA 1MKWH 4NWLA 2C8XB 1QL8A 1MCVA 2XW9A 2H6MA 1YPLH 5TCAA 4DCDA 1C5MD 8GCHG 1TGCA 1V2WT 3A7ZA 1SFQB 1A5HA 1BIOA 1BBRH 1DLKB 1V2QT 3ZVFA 1CHGA 1F0UA 1V2JT 1EXFA 2ZA5A 2HLCA 5DP5A 4RSPA 1QY6A 1DS2E 2R9PA 2ALVA 4TPIZ 2GDEH 1GJDB 3SHCH 1FN8A 3QGJA 2VVUA 5A0CA 1O5EH 2BY5X 5C3NA 1QCPA 2BY7X 1K1LA 4B73A 1ZGIA 5E0JA 1EZUC 1ZHRA 3QUMP 2Y5GA 1SI5H 1EJAA 2FOHA 2GV6A 2P59A 2VH0A 1NO9H 1JMOH 1CBWC 3RXFA 3E8LA 1WU1A 1P2OA 2PHBA 2XC0A 1EP5A 4FUCA 3T28A 3P17H 1GI4A 2C3SA 3BTTE 3H5CB 3MNSA 1HB0B 1GBFA 1YP9A 3MH7A 1TIOA 1YCPM 1RIWB 4DW2U 1GMDF 1KDQA 2Z9KA 1TNGA 1FPCH 1BTUA 1G37A 1XX9A 1ANCA 2VGCB 3LOXA 1WTHD 3N7OA 1MKXH 2ZC9H 1ANEA 1G3CA 1V2KT 1W13U 3HATH 4MNVA 1IQKA 2ZFQH 1GGDB 1N6XA 4YLQH 3DA9B 3PWBA 4X1PU 3DFLA 1YPGH 3S69A 4CRDA 2VIOA 5JBTA 1XVOA 2PLXA 2NWNA 2GCTC 4GCHG 3SJ8A 1MQ6A 1H9LB 1XXDA 1F5KU 2XTTB 3TJNA 1HFDA 2VJ1A 2VWLA 4FU9A 3PB1E 3Q76A 1V2NT 5TJXA 5LPRA 3UOPA 3WY8A 1QQUA 1TNHA 1TBRH 4KP0A 1L4DA 2HVXA 2CF9H 4KKDA 4X6MA 4HGCA 4ISLA 4XSKU 2SGDE 1VGCB 3TNSA 1HAOH 1GL0E 2ZDAH 1WTGH 2EI6A 3BEIB 4ZKOU 1GBDA 3B8JA 2O8LA 1V3XA 1S84A 2OQ5A 1LPGB 4A1VA 2GMTB 2A31A 3VB4A 1LTOA 3VPKA 1TGNA 3O8BA 1GHAF 5AVDA 4MTBA 3M3TA 4ABIA 3AW0A 1O35A 3UTUH 2W3IA 5FCRA 1IQJA 2ODQA 4NA9H 1QA0A 4ZKNU 4AORA 1E36B 3ZZ8A 1H4WA 2Y7XA 1S82A 1ELAA 2JKHA 2ASUB 1GMDG 4AG1A 1FUJA 3A7VA 1GVLA 3RLYH 1S83A 2FTMA 3P70B 5J4SA 1O3PB 3M5LA 1P2IA 4TY6A 1S0QA 1Y5BT 1UCYK 1J14A 4WMEA 2Z94A 3TK9A 4Q2KA 1A3EH 4X0WU 2B9LA 1LPZB 2TGAA