2NU2E

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
molecule keywords Streptogrisin B, Protease B
total genus 52
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu2E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu2E01
4CRGA 3TH4H 3TH2H 1GGDC 3MNCA 1EAUA 1JBUH 1SGNE 4DY7B 3DT0H 1S0QA 1QL8A 2A7CA 1GDNA 1GMDG 5DKMA 2OTVA 1AVXA 3PB1E 3UTUH 2BB4A 2ZC9H 3GY8A 4AFZA 3GY5A 2TGDA 4MNYA 3GOVB 1QQ4A 5L2YH 1DITH 5DP8A 4YM9A 4X2WA 4R0IA 2CHAC 2B9LA 1MTVA 2BD2A 1KXDA 4DW2U 3RXAA 1EJMA 1O3IA 1EPTB 5EW1H 2BD3A 2GZ9A 1K1JA 1W12U 3PMHB 3ODDA 1LKBA 5JB8S 3GY4A 2WUBA 2A5AA 1AZZA 3G01A 4Z6AH 3H5CB 2ZKSA 3M5LA 1C1WH 3HKIB 1FY5A 4INKA 4NIYA 1C1RA 2ZFSA 2G8TA 2FO9A 1O3NA 1AFQC 1BB0B 1DT2A 1BHXB 5K0HA 1LHGH 1CT2E 1TOMH 4BAOB 3TPIZ 1AO5A 2D8WA 3LU9B 1G2MA 3RXQA 3UY9A 3MTYA 2P3FH 1EAIA 2BY7X 2BZ6H 5HGGA 1GL0E 2ODYB 3LGIA 3A7XA 4ISHH 2Z3CA 4X2XA 3MH4A 4KP0A 5DP7A 4WXIA 3KHVA 1O2JA 2A5KA 2C8XB 5GPIB 2CF9H 1J14A 1BZXE 1ZSLA 1J8AA 1SLWB 2R2WU 2O8LA 1C2KA 3ZYEA 1NROH 1OWHA 1IQGA 4AGKA 4B74A 2RA3A 1KY9A 2PR3A 2W3KA 4OGYA 4ABIA 4X1PU 3PTBA 3M7QA 1WV7H 1GVLA 2Z6BD 7GCHG 1SGFG 2EEKA 2WUCA 4OS4A 3E0PB 1KDQA 6GCHG 2NU1E 1O3JA 1AMHA 1RD3B 4ZH8A 1CHOF 3L6PA 4WMDA 2HNTF 1YLDA 2P3TB 1L1GA 4INHA 2ZU1A 5FCKA 1WQVH 2A4QA 1DWEH 2O8WA 3E91A 5EGMA 1P10A 1J16A 4AZ2B 3A8AA 3M35A 4XSKU 1WTHD 1TA2A 3UOUA 3MMGA 2Y80A 2PUQH 2WYJA 3CS7A 1HLTH 1QRZA 3ITIA 3SV9A 2BDGA 4AYVB 3I29A 1GBLA 1S81A 4JCNA 1C9TA 3ZVAA 3KQDA 1V2WT 3MNSA 1NRQH 3D23A 3PLBA 4MLFB 5AFYH 3SJ9A 4BTIB 2W7SA 2ZWLH 1C5VA 1W8BH 3SGAE 3UR9A 1X7AC 7LPRA 3GCNA 1OYQA 3SW2B 1P2QA 2FMJA 3VGCB 1F0RA 5L2ZH 5E0GA 4CHAC 3E6PH 5JBCS 1FIWA 3U8OH 1LVBA 3MFJA 3A7ZA 2J92A 1NRSH 3T25A 2Z7FE 1P2JA 2RG3A 3CS0A 1UK2A 1NPMA 2GP9B 5A2MH 4RKOB 2BVRH 2ZF0H 3RC4A 3RXCA 2ALPA 1XMNB 2ZU5A 2HRVA 5JPMH 1B0FA 3A8DA 1BBRK 1ZPCA 2H9TH 1MTNB 3JZ1B 2FI3E 2SGDE 3I77A 3IITA 1O2YA 1RFNA 4TY6A 4Y7AA 1S0RA 2PKSC 2WPJS 1ANCA 1VR1H 1DFPA 1PPFE 2G51A 3SU2A 4YLUA 3AASA 3AVZA 4CBNA 4A1VA 1SR5C 3E3TA 1TPPA 1ARCA 1P02A 4NWLA 2J95A 2AIQA 1AY6H 2QF3A 3F6UH 2TRMA 2R3YA 3FANA 1GBIA 1NU7B 3UQOA 3DA9B 4JK6A 4DCDA 3SOSA 2SFAA 5GCHF 1LKAA 1S5SA 3RLYH 5HM9A 3SI4H 1MKXH 1TWXB 1FAXA 2ZGBH 4B2BA 2VINA 1O34A 4FUFA 4DOQA 1H8DH 2FI5E 2ODPA 2FXRA 1O2OA 1V2MT 3CENA 4I8GA 1OKXA 3V0XA 1SC8U 1UHBA 5EQSA 2JH0D 1XUKA 2H1UA 2FOMB 1MMJN 2I6SA 4XBBA 1GJ6A 4IMZA 1QA0A 1NFUA 3KQCA 3SV6A 1O3GA 1LVMA 3NXPA 6CHAB 1SGCA 5F03A 1ESAA 4E06H 1LCYA 2RA0A 2FYQA 1GJAB 4K1SA 1WTGH 1T31A 2ODQA 3RXJA 3LT3A 5ETXA 2Z9GA 1GI6A 1O39A 3OYPA 5EQRA 1G3DA 1D3PB 1UVSH 1NT1A 3TLOA 1QB9A 1VCQA 4AN7A 3O8RA 2F3CE 1AU8A 2R9PA 3TGKE 1CBWB 2PW8H 1DUAA 2FOGA 3HK6B 3BEFB 1ELEE 1YPHE 3GCHB 3UWJH 1P3CA 1Z8RA 2OD3B 2BX4A 4TWWA 3KL6A 1UVUH 1P06A 3UQVA 4CH2B 5HXFA 2PTNA 1O3DA 3RC5A 1H4WA 3GY3A 1CQQA 1ELGA 4R8TB 1N1LA 3RXVA 1QGFA 1FUJA 5EPYA 9ESTA 4XBDA 1IQLA 2GMTB 4AB8A 4TYDA 1P9SA 2XBWA 1SQTA 5DP4A 4J2YB 1DLEA 1UTOA 1KXBA 5C3NA 2RCEA 3QK1A 3RMLH 3RMNH 1C5OH 5FBEA 2UUYA 2ZU2A 1G3EA 3BTTE 2QV1A 3RXKA 3A87A 3ZVDA 5JB9S 2ZA5A 1FPCH 1UVTH 1HAOH 3PTNA 4IN1A 2GCHG 3MNBA 2GZ7A 1TIOA 1NRPH 3UREA 4ZKRU 1KLJH 1RRKA 2BY6X 1EASA 3VGCC 1Y3WA 4JYTA 2H9HA 2C8WB 4IW4E 4B73A 3FVFB 3R3GB 3VB6A 1EJAA 3HKJB 4IC6A 1EZSC 2Y5HA 1C2IA 1QL7A 3TITA 1Z71A 1P3EA 4UDWH 1AQ7A 3D49H 4WH8A 4VGCB 3QX5H 5C5OA 1SI5H 1XVOA 2QXJA 2ZGHA 4BAQB 1V2PT 1O3LA 1P2OA 3K6YA 4A1XA 1MAYA 4K5ZA 1GL1A 1QCPA 1ZMNA 2FOBA 2HPPH 2NU2E 1C4Y2 4IS5A 1D9IA 3A85A 2WYGA 4B75A 1ZGVA 5A0BA 5K7RA 4MPVA 1DOJA 1T8NA 1TGNA 2TBSA 3MO3A 1E35B 2HGTH 1SLXB 2O8TA 3TK5A 4BNRA 4AX9H 1W7GH 1GMHG 1W3CA 4GLYA 2A31A 4FVBA 2PSXA 1IAUA 2BD5A 3E16B 2AGGX 4MQAA 3RM0H 4MNVA 2PFEA 4DG4A 1DVAH 3ZZBA 1F92A 2QAAA 3S9AA 1CT4E 2HNTE 2VIPA 1BTUA 4O9VA 1SLVB 2C93B 1TONA 2F9PA 3BTHE 4FU8A 2BD8A 3T28A 2VVUA 1A5HA 3P8OA 3NKKA 4CRAA 1V2UT 3MU1A 1E0FD 3TVJB 4DGJA 2ZP0H 3PWBA 4WVPE 4K8BA 1TMBH 2TGAA 1FPHH 1O2KA 3R0FA 1EOJA 1V2KT 5GJ4B 1EKBB 1W7XH 2GD4B 1E38B 2CHAB 4UFEH 1TALA 2QXHA 3SNEA 3BG8A 2GKVE 2CV3A 2ZPQA 4AGJA 1K1IA 2R0KA 3LC3A 1PPHE 1GCTB 3PO1B 1O2LA 2XRCA 4CHAB 2ZFQH 4GHTA 2GCTB 3SHAH 2ZU4A 4Y71A 3OX7U 1MBQA 2FESH 1V2RT 1E37B 1KTTB 4B1TA 1A7SA 1UCYE 3EA8A 2HPQH 4NA8A 3SU3A 5TCCA 4ZHMU 5C2ZA 2F9OA 1QJ6B 4X0WU 1O2NA 2B7DH 3A84A 4FUHA 1BTYA 4DIIH 3HGNA 4YOIA 4I32A 1BQYA 4ZHAA 1AN1E 1AGJA 2TIOA 3VXFH 2Y5GA 1GI2A 2Z94A 3SQHE 1ELAA 1DXWA 3TGJE 3U69H 2AGIX 3M37A 5EPNA 4DURA 2XC5A 4ZUHA 1BOQA 3ATWA 1KXAA 4OS1A 1TRYA 1JRTA 3RP2A 1BHXF 1Q2WA 5T6GA 5FX5A 3LIWA 1GVKB 1C5LH 3BTGE 2AS9A 1MH0A 5I25A 1GMDF 1BMLA 1BRAA 4BTUB 4ABFA 3A86A 4JMYA 2VIOA 2SGQE 3FZZA 2QXGA 4MG3A 3PO1C 1O3FA 2XBXA 1FY1A 4SGBE 5FXLA 4BAMB 2OCVB 1P03A 1GI9B 1KLIH 2UWPA 2HNTC 3CP7A 3QN7A 1W14U 5EW2H 1FN6A 1XUIA 3LGTA 1HAGE 2BMGB 2AIPA 3ENSB 1EATA 4I8JA 2A5IA 3VB3A 3DD2H 1GMHF 3O8BA 2J34A 2VU8E 3RXIA 1TB6H 1WU1A 2ZPSA 1O3AA 4XOJA 1ACBE 1L1NA 1KXEA 4NZLA 2ZDAH 1TGSZ 1O33A 1TMTH 1P05A 2BM2A 3SV7A 5FHTA 1HGTH 3MU4A 1HRTH 1V3XA 1UTNA 1C5RA 3AAUA 3E90B 5CMXH 1OYTH 1OWIA 3OU0A 3SJIA 4YOJA 5JBAS 1MZDA 5AHGH 1AB9C 1T8MA 2ZEBA 2TPIZ 1BJUA 2RDLA 1EPTC 4I33A 3V12A 2A7JA 4O97A 2FEQH 2AYWA 4JZDH 5E0HA 5EXNA 1IQMA 2V0BA 3BTKE 2OBOA 4SGAE 3TK9A 1HXFH 5HM2A 4FUJA 1C1UH 3C1KA 2ZHFH 1XKBC 3ELAH 1P2NA 5GXPA 3BTFE 3F9FA 1ORFA 3T29A 3NCLA 2FODA 1BTZA 2FX6A 3SUEA 4H42U 1YF4A 5T6FA 3P92A 1Y5AT 4ISIH 2D26C 2GVFA 2QCYA 2W3IA 2ZDVH 2CF8H 3ZZ6A 1IQNA 2FLRH 1W10U 2QF0A 4YT7H 5C5NA 1TA6A 1HAHH 1OP2A 4ISLA 5TCAA 2ZDNA 1EPTA 1CE5A 3W95A 2Q6FA 1K28D 2PTCE 1IQJA 3GY2A 5C1UA 1QRWA 5AFZH 2XYAA 4TY7A 1PQ5A 2P59A 1SMFE 5E8EH 1E36B 1C2JA 1F5RA 1PQ7A 1GI4A 2FWWA 1HBTH 1O3KA 3QDZB 4CR5A 2F83A 1D3DB 4MDSA 1A0HB 4ZHLU 3GCTG 1EP6A 2Y5FA 3K9XB 2A45B 3ATKA 3MO9A 5BPEA 4NCYA 1J15A 1FDPA 1INCA 2QXIA 1P01A 1YLCA 2FX4A 1K2I1 2AMPA 3F9HA 1SGEE 2GT8A 1ZJDA 1O3CA 1TMUH 3QO6A 4BAHB 1HAIH 2UUFB 3RM2H 1HAPH 1MKWH 1YM0A 1UCYH 5I46H 5DP9A 5DP3A 3NZIA 1GI1A 4J1YA 4IGDA 3KEEA 4UFGH 4H4FA 2FP7B 4HI3A 1GBTA 1EX3A 2GDEH 2NU0E 3L3TA 1H9LB 1B5GH 1BCUH 2H2ZA 1CBWC 4GCHF 3TJVA 1TNKA 1HFDA 3C27B 2VH6A 3ZZ4A 5LH8A 4ABGA 1CGJE 1C5WB 3EAJA 5JBTA 4Y0YE 4B76A 2CJIA 1KIGH 2C3SA 1T4UH 1VCPA 3WY8A 1MZAA 1GHBG 3A7WA 3P70B 1XM1A 3SU4A 2EI7A 4PROA 2ULLA 1O30A 1AUTC 1LVOA 3LGUA 2QA9E 4O3UA 1EQ9A 5A0AE 3UIRA 1Y5BT 1C1NA 2P95A 2Q6DA 3SJ8A 2FYRA 2QYIA 2VNTA 3B23B 3U8RH 7ESTE 2BLWA 2D2DA 1ABJH 4UEHH 4OS2A 1A0JA 2GZ8A 2VH0A 1B0EA 4XFQA 4ABHA 1W0YH 3M5OA 4HZHA 2YNAA 1ZJKA 3MU8A 3UOPA 3LH1A 3HATH 1ETRH 3P95A 9LPRA 1GI8B 3GCHC 3SNBA 2VGCC 1NTPA 1GWAA 1O3MA 1K1OA 3T27A 1C5TA 2IOTA 2EI6A 1QHRB 3RXBA 5E2OA 3URDA 2VWNA 2VVCA 1VGCB 2C90B 3ZVGA 2LPRA 2IJOB 1EB1H 1MCVA 4F49A 3E8LA 1FJSA 4IMQA 2FI4E 1V6DA 1FXYA 2GMTC 4D9RA 4BANB 1G37A 1QJ1B 3Q77A 1F5KU 4JK5A 3S0NA 1QA7A 1V2TT 2G00A 4B71A 4YO9A 2JH6D 4B2CA 1MBMA 3FP6E 2Y81A 4UD9H 2G4TA 1O2ZA 3U8TH 4AORA 2EA3A 1NS3A 4NIXA 1C2LA 1E34B 1DY9A 1QR3E 3MO6A 1VITF 2FOEA 3MH5A 1LDTT 3UNSA 1TNGA 2PGQB 3DFLA 3T2NA 2BDAA 3SZNA 2VWLA 1GI0A 2BHGA 1QNJA 4Y11E 1DLKB 5LPFA 3S7KB 1F7ZA 5HMAA 4Y8YA 2FDAA 1AE8H 1AKSA 1YPKH 1AB9B 2ZDLA 1BITA 1SGDE 1YPHC 3A8CA 4Q7YA 1BRUP 3KQBA 1RGQA 2H5DA 2WPIS 4Q7XA 3SGBE 1TNHA 1Z1IA 3TJUA 3UFAA 3RU4E 5B6OA 2SGFE 3RMOH 1JIMA 1GJ9B 1CHOG 3IG6B 1EZUC 2XBYA 1P0SH 2H9EH 2W7UA 1GHBF 2PKAB 3T62A 2QY0B 3SJKA 1FZZA 1Z8JB 4GPGA 2NWNA 3GICB 1CU1A 1O5EH 1K1MA 1UTKA 5C20A 4A92A 4I31A 3ZVCA 1GJ4H 1UMAH 2FS8A 2V35A 2G52A 3RMMH 1LPZB 1ELBA 1MD7A 1O5CB 4YLQH 2WPHS 4F4OC 1Z8GA 5CHAC 8GCHG 1LHCH 2AFQB 4NSYA 2PV9B 1JWTA 2FLBH 3TJOA 3P8FA 4NA7A 3I78A 1WUNH 2OQ5A 2V3HH 2BTCE 6ESTA 4QT8C 4CRCA 5E0JA 5F6MA 1AWFH 2ZIQH 3OSYA 2B5TB 1CA8B 1D4PB 3U1JB 1C5MD 2G4UA 2YOLA 1Y8TA 1NC6A 2NU4E 2ZG0H 1EOLA 1K1LA 2H6MA 2ZCLP 1LVYA 1UTPA 5A8YA 1FAKH 3Q00A 1S85A 4I8LA 2OBQA 1Q31A 1QJ7B 2VIVA 2OINA 2FS9A 2G81E 4NFEA 4NZQA 1J17T 1G3BA 2W5EA 5EXMA 3STJA 3P6ZB 1ELVA 5EU8A 1PQ8A 5L6NH 4AFUA 2ZHWH 1GBEA 1GG6C 1U6QA 1O3BA 2QIQA 1VZQH 1O5GH 1SGRE 1N6YA 1O37A 1GHZA 1O2MA 2BY9X 1CGHA 1DWBH 1UTLM 3W94A 5A09A 1TFXA 1O3OA 1QFKH 2OUAA 1PQAA 3P8NA 2FOAA 1ANDA 2A0QB 1H1BA 1TBRH 1ZTLA 3KCGH 1N6XA 5AF9H 4NFFA 5GWZA 2OXSA 5CE1A 5SGAE 4CRFA 1O2WA 3JZ2B 4X6PA 1CT0E 1SFIA 2OC8A 1OXGA 3RLWH 4GHQA 4RSPA 3KF2A 1V2QT 2VWOA 3NK8A 2SNVA 1BT7A 4WWYA 1KXFA 5FPTA 2F9NA 1WQSA 1QB6A 2BDCA 1HB0B 3Q3YA 1AZ8A 1S6FA 3ZVBA 4FUDA 4A5TS 2WINI 1RTFB 3UNRA 1MTUA 1V2JT 2ZFPH 4NG9H 1RIWB 3Q3XA 4A7IB 1A61H 2DUCA 3LPRA 3LDXH 2ASUB 1AKSB 4CR9A 2TGPZ 3BV9B 1A5IA 1AI8H 2ZZUH 2BLQA 3RUOA 4AOQA 2WPKS 4INLA 1C2EA 2IPHA 4CREA 2ZQ2A 1GMCF 1V2NT 5AVDA 2QN5T 3ODFA 4KELA 2ZTXA 3ESTA 1O2TA 8LPRA 1O2PA 1S6HA 3U9AH 1O2IA 1DSUA 3TU7H 3BG4C 1IQFA 2I6QA 1ELCA 2ZFRH 4WJG2 1GBMA 1WAYB 1C5SA 4BTTB 2THFB 4MNWA 4O03A 4D7GA 4X1RU 1O5FH 1O2RA 5DP5A 2KAIB 1OWKA 2P8OB 3PV4A 5C1XA 4ZAEA 2A4GA 2W26A 2BY8X 2PSYA 1T8LA 3ZZ9A 3BF6H 5G4BA 1K21H 1JRSA 2P16A 4RKJB 1LPGB 1O2GH 2O9QA 4ZROA 4ZKOU 1EAXA 1TQ7B 1GJ5H 2Z9LA 1O38A 4AFSA 1C2GA 1XX9A 1GBBA 2YNBA 3H7TA 1OS8A 3A81A 1FY4A 1GBCA 3GYLB 3T26A 3LONA 4X8UH 5ESTE 3Q76A 1N8OB 3RXEA 4Y7BA 1TPSA 3DFJA 5DGJA 3SQEE 1EJNA 4ABAA 3S9CA 1EZXC 3LJJA 1S83A 3MHWU 5PTPA 2ZQ1A 3S69A 3LGWA 4YZUA 3SJOA 2V3OH 1C2DA 4H6TA 4NIVA 3UPEA 1O5AB 3ZYDA 1NRNH 4ZKSU 1BJVA 3BTQE 1LHDH 1GGDB 2BQ7B 2AMDA 2ZHEH 5A8ZA 1NY22 5DK1A 1XUFA 2ANWA 2ZI2H 1SQAA 1CA0B 4AG2A 1BTXA 1JIRA 4ABBA 1AIXH 5ESBA 1SQOA 8GCHF 1G2LA 1GCDA 3GY7A 4UFDH 3SORA 1P2IA 1SG8B 1MCTA 3EYDA 2O8MA 1RTKA 2ZNKH 3ZV9A 3M3SA 2OP9A 2PHBA 3ATMA 2ESTE 4FU7A 1ZHRA 3M3TA 1BRCE 3LOXA 1YYY1 4NWKA 1TX6A 1YCPM 2ZHDA 4MNXA 1D3TB 2EC9H 1G30B 1A46H 2ZGXH 4I8HA 1P57B 2ZDMA 1Z1JA 4X8TH 4Z0KA 5LPEA 1L1JA 1K1PA 1TRNA 1ZHPA 1GJDB 4XBCA 1ABIH 1CVWH 3KNXA 4BXSA 1TX8A 1IQKA 4CRBA 4Y0ZE 2BOHB 4MTBA 4X8VH 1BTHH 1O3PB 4UFFH 1ANEA 1ZGIA 1F2SE 1KXCA 1P2KA 3A83A 1O2XA 1H9HE 2R2MB 5DG6A 3SN8A 1HPGA 4LOYH 3PWCA 1GHAG 1H9IE 2LNCA 3OY5U 1O2QA 1PYTC 7KMEH 3M5NA 1ZOMA 2G5VA 1VITG 1FV9A 1NN6A 1YCPH 3OY6U 4HGCA 4ZKNU 3EGKH 2Z9JA 1ANBA 3M7TA 1EZQA 1DPOA 3F9GA 1C1SA 4OGXA 3RU4T 2F9UA 6CHAC 4ABEA 2BYAX 4FU9A 4KTSA 4U30A 5BRRE 2Y82A 3PMBB 1A3EH 2A1DB 1ID5H 2BDYA 1HIAB 3ZZ8A 1QBVH 3K2UA 1DICA 1O2VA 1XUJA 2AH4X 4WMEA 1LQEA 4FUBA 3SU6A 5F8XA 1VITH 1QB1A 4CRDA 2KAIA 3ZZAA 4YT6H 5FAHA 1GDUA 1HCGA 3A8BA 4KTUA 4FUCA 1QBNA 3HPTB 2A7HA 3EDXB 5EQQA 2C4FH 4X1SU 1FNIA 2CXVA 1IQHA 1H8IH 1SGPE 3EA9A 1KLTA 4KKDA 3MNXA 1NU9A 1EUFA 2CGAA 1MTWA 1DDJA 4MPUA 5E2PA 1O36A 2OLGA 8KME2 3KN2A 1JXPA 1GJ7B 2VGCB 5JBBS 2XCFA 1GHAF 1AD8H 1TBQH 1K1NA 2A4OA 3QGNB 1B7XB 2JKHA 1HAVA 3D62A 3ZVFA 1THRH 1ELFA 1BTWA 3IWMA 1GI3A 1PPEE 2NU3E 4DT7B 1ZTJA 1UO6A 1LHFH 4Q7ZA 3LJOA 3ZZ7A 4AFQA 3UR6A 1BTPA 2WV5A 3SNDA 4XE4A 2ZDKA 1BUIA 1DXPA 4KGAA 4LXBH 1RJXB 3SUDA 1QQUA 1A1RA 4JYVH 4GAWA 5EOKA 1NM6A 2BD9A 3SU1A 1O2HA 3MU5A 5DJ7A 3ZV8A 4K2YA 4GUXA 1Q3XA 2Y7XA 1MKXK 4A6LA 3UWIA 4JZFH 3EA7A 3QTVH 2UWOA 2F9BH 2J94A 3GY6A 1J9CH 4GCHG 3RXGA 3P8GA 3VB4A 4LK4A 1UVPA 1P04A 1W13U 2ZTYA 2BOKA 1F0UA 1YC0A 1NESE 1GPZA 2XC0A 1NZQH 1JMOH 1ZR0A 1L4ZA 5FCRA 1D6WA 1K9OE 4DVAU 1C4V2 3BEUA 3RXRA 2Q1JA 1O5BB 4FUEA 4K3JA 3GDSA 1EB2A 2OC0A 1HYLA 1UTJA 4ABJA 1A3BH 1M9UA 3BTWE 4X6MA 1MAXA 1DX5M 3ATLA 4OS7A 3PM3A 2Z3DA 1ZLRA 1SGYE 2ZGCA 4ISNA 2VIQA 1JOUB 3KIDU 3GCTF 4FVDA 1A2CH 1YKTA 3STIA 2XNIA 2R3UA 1BRBE 1ZSKA 3RXOA 4A1TA 1W0ZU 5JYIA 3UUZA 2HVXA 1GI5A 1WYKA 4CBOA 1AE5A 4Y79A 2ZCHP 2STBE 4YOGA 3RXFA 2ZGJA 3RC6A 4K60A 1GDQA 1Y5UT 3MH7A 3LGYA 3DUXH 1QURH 4LZ1H 1GBJA 3Q3KA 1THPB 3LH3A 1C1MA 1TAWA 1AFQB 1TYNA 3QLPH 1BMMH 1BMAA 1SGIB 4GVUA 1UJ1A 5JDUB 1RS0A 4OS5A 5T6DA 1DS2E 1FY8E 1TX7A 2BXTH 1TE0A 1NO9H 1MUEB 4I7YH 2XXLA 1GBHA 4U32A 1CSOE 4K69A 2SGEE 4TPIZ 5FBIA 1TNJA 2BLVA 4AYYB 2GDDA 2H5CA 3SV2H 4FXGH 2C8ZB 1OWJA 1THSH 2J4IA 1HNEE 1O35A 1DWDH 2FOCA 4E7RG 1SPJA 1A5GH 3SGQE 1ETTH 3TIUA 3B9FH 1TPAE 5FX6A 4ZXXH 2OC7A 3FP8E 2C8YB 3RXSA 1PJPA 1BBRH 1GMCG 1F5LA 1VJAU 2FOHA 1ZHMA 4UE7H 3VPKA 4DJZB 1EAWA 2QGRA 1XUGA 1C1QA 4K1TA 1TRMA 4ZMAH 1FMGA 4HTCH 2VIWA 4BOHA 1P8VC 1PPCE 1IHTH 5A8XA 2GV7A 1OP8A 3A7YA 1C4U2 3AW0A 3FZDA 2VJ1A 1ARBA 1PPBH 3M7UA 3KGPA 3QWCH 1C5UA 1GBKA 1BDAA 1C1VH 2GT7A 1LMWB 2ZFFH 1RTLA 2Z9IA 1A4WH 3VXEH 1C2HA 1N8OC 1DSTA 1ZPZA 1ZTKA 2FTLE 2OC1A 4IC5A 3QUMP 4THNH 1MTSA 2ZO3H 1YPEH 3E1XB 1C5NH 2XBVA 3A88A 5L30H 1YP9A 2VIDA 1F0SA 3RXUA 1SL3A 4FUGA 2GGVB 2UUKB 1CHGA 3O8CA 4X2YA 1O3EA 3K65B 4TPYA 1SSXA 1SB1H 2GV6A 2J2UA 4NGAH 2DE8A 1HJ9A 2HLCA 2BD7A 2AGEX 1UK4A 1KSNA 2PLXA 1OWEA 5DP6A 3RXHA 1MQ6A 1HUTH 4B2AA 3ZZ5A 1QBOA 6LPRA 3L33A 3AW1A 3A80A 2XCNA 1EXFA 2XW9A 1MU8B 2FZZA 4WMFA 1AVGH 3BIVH 3UNQA 1Y3VA 1YPGH 1O2UA 1O2SA 1BMNH 1LO6A 1TPOA 3MH6A 4X6OA 2BDHA 2FTMA 1XUHA 2BQWB 1CGIE 4WF8A 3ZVEA 1ZYOA 4D76A 2VWMA 2SGPE 1RIWC 2SNWA 1SFQB 1BA8B 2O8UA 3ZZCA 1GHYH 1SBWA 1Y59T 2ZPRA 3KQEA 2F91A 3A89A 1VJ9U 1O31A 1W11U 5CHAB 3VB7A 4ESTE 1DANH 1WCZA 2P3UB 1SGTA 2BZAA 1T7CA 1G36A 5FPSA 1QTFA 4X1NU 1FY3A 1AUJA 3U1IB 4Q80A 4Y8ZA 1IHSH 1IOEA 2OQUA 3BSQA 5C67A 1YCPK 4AG1A 2CN0H 2Y6TA 5F8TA 2A32A 1UVOA 1YBWA 1UTMA 1TABE 1HAVB 2Z9KA 4Y6DA 1TGBA 1Z6JH 2XWAA 3LGVA 2PKAA 3RDZA 2WPLS 4U2WA 2P94A 1TBZH 2HOBA 3GCOA 4MVNA 3MOCA 2IN2A 5EODA 2GCTC 2XWBI 3A7TA 1IQIA 2GX4A 1GCTC 1AFEH 5IYTA 1GJ8B 2J9NA 2PGBB 1S82A 1GG6B 4BXWA 3D65E 4U01A 2ZU3A 3OTJE 5J4QA 1HAXB 1VGCC 3B8JA 3RXLA 4NIWA 1HJAC 1C1TA 2BVXH 4ISOA 1XXFA 1C5PA 3F1SB 1YPJH 2A4RA 4YESB 3TNTA 1ZZZA 1P9UA 3TJNA 1O5DH 1G32B 3U98H 1GHXH 3PROA 2BY5X 2JETB 2ZCKP 1T32A 1XVMA 1AWHB 2EI8A 1DY8A 1ESBA 1C2MA 1O32A 3EE0B 2BXUH 1HV7A 1SOZA 3RXMA 1V2OT 3T5FH 3SUFA 1OPHB 4VGCC 5J4SA 2ALVA 2A2XH 4TWYA 4Y76A 3ATIA 4K8YA 1P11E 3RU4D 2SGAA 3QZQA 1BBRE 3NUMA 1O0DH 2VVVA 1Z8IB 1ZRKA 3NPSA 4XDEA 3TH3H 1DE7H 2ZTZA 2ANYA 3LKWA 2GCHF 3BTDE 1TNIA 1IQEA 1S84A 4X8SH 4MPWA 5LPRA 1KYNA 1ZPBA 1T4VH 1PPZA 2FPZA 3M5MA 3SUGA 2BLOA 1TGTA 2Z3EA 3RXPA 1EP5A 2CMYA 3GDVA 2AERH 4GSOA 3M36A 1HIAA 4JZ1A 1OSSA 1NFWA 1P09A 1ELTA 4MPXA 3HK3B 1UHBB 1GVZA 1FQ3A 1HJ8A 1MD8A 1ZRBA 1MQ5A 4JZIA 1KTSB 1RXPA 3BIUH 1C1OA 3PLPA 4D8NA 1K22H 1LHEH 1KDQB 1P2MA 3HGPA 3A82A 1O3HA 2PKSB 5FPYA 1A0LA 1QY6A 1PYTD 2BDIA 2UUJB 5EG4A 5TJXA 1SVPA 2BVSH 1LQDB 4IN2A 1Z7KA 4ASHA 2ZHQH 1C5XB 1YGCH 1V2ST 1AVWA 3MYWA 3BN9A 3K6ZA 2HWLB 5C1YA 1SHHB 1GHWH 1GI7B 4ZXYH 3QZRA 2G5NA 4UONA 1FONA 5LGOA 1MKWK 2WPMS 4O3TA 1NFXA 1SGFA 3ZZ3A 1UCYK 1CA0C 1C5QA 3URCA 1OOKB 3P17H 2ZFTA 3ZZDA 3PMJA 5EXLA 4D9QA 5A0CA 4RN6A 1NRRH 3A7VA 1FN8A 2Q6GA 2JETC 2AEIH 4K1EA 4BAKB 3TNSA 1DM4B 4LZ4B 1MTNC 3VFEA 2FIRH 3MWIU 1HXEH 3M3VA 1TLDA 2A2QH 2R0LA 5GCHG 2G55A 3MU0A 4HFPB 1BIOA 4CH8B 4NA9H 1XXDA 3AAVA 4I8KA 2ANKH 2XTTB 2DE9A 3LC5A 3PMAB 4WH6A 1ZMJA 4FUIA 1L0ZA 4JZEH 2AMQA 2VB0A 4JYUH 3SHCH 3VEQB 3FP7E 1GJBB 1GBFA 1W2KH 2K1QA 4E7NA 3N7OA 2ILNA 5HYOA 3S7HB 1OWDA 1PFXC 4AB9A 1Y3YA 1ZSJA 5GIBA 3SBKA 1GHVH 1TQ0B 1V2LT 2STAE 1C1PA 3V13A 5DO4H 1ZMLA 3SV8A 1C5YB 3H7OA 3BTEE 4IBLH 1P12E 1HAYB 3PLKA 3SU5A 3DHKH 5F8ZA 1OP0A 2BQ6B 4ABDA 3O8DA 1ELDE 4NSVA 1FI8A 2BX3A 3F9EA 4M7GA 3VB5A 2FM2A 2HALA 4X2VA 2B0FA 2FOFA 2P8OC 2ANMH 1V2VT 1HDTH 1WOFA 3E0NB 4Y10E 1T8OA 1NFYA 3QTOH 3TGIE 2PUXB 1L4DA 4X1QU 4X6NA 4KTCA 1CO7E 3GYMA 1C9PA 1TGCA 1SLUB 1Y3UA 2M5TA 3BG4B 2TGTA 3SI3H 1HJAB 1D6RA 1YPLH 2WV4A 3NWUA 2UWLA 3RXDA 2F9VA 1GBDA 3FFGA 4E05H 3F68H 1G9IE 1DWCH 3V3MA 1DUEA 4H6SB 2D1JA 1GBAA 3FAOA 5GDSH 3BTME 8ESTE 1QRXA 3SNAA 1WBGB 1YPMH 2ZECA 1LTOA 1OX1A 3GISB 1L2EA 3V7TA 1ETSH 1C2FA 2Y7ZA 1QL9A 1SGQE 3EQ0H 4WY3A 1AHTH 3BEIB 1PPGE 1TOCB 3GDUA 1C5ZB 4WXVA 1SHYA 1Z6EA 4Y8XA 1LPKB 2BDBA 3PYHA 3S9BA 2GTBA 1XKAC 3MI4A 5H4IB 5T3HA 1QIXB 1VCWA 4OS6A 4Q2KA 1GJCB 1FLEE 1ESTA 3TK6A 3M61U 2BD4A 5ABWA 1UTQA 2QC2A 3SU0A 3RXTA 1WSSH 4YTAA 5DPAA 1SOTA 1G3CA 1F0TA 1MU6B 4D7FA 5IDKA 1D3QB 2PWXA 2P93A 1Y3XA 2XC4A 6GCHF 3QGJA 3SNCA 1FIZA 1UK3A 4DIHH 2JH5D 2V6NA 1TNLA 2B8OH 3SO3A 7GCHF 1HAZB 2J38A
chains in the Genus database with same CATH superfamily
4CRGA 3TH4H 3TH2H 1GGDC 3MNCA 1EAUA 1JBUH 1SGNE 4DY7B 3DT0H 1S0QA 1QL8A 2A7CA 1GDNA 1GMDG 5DKMA 2OTVA 1AVXA 3PB1E 3UTUH 2BB4A 2ZC9H 3GY8A 4AFZA 3GY5A 2TGDA 4MNYA 3GOVB 1QQ4A 5L2YH 1DITH 5DP8A 3DCLA 4YM9A 4X2WA 4R0IA 2CHAC 2B9LA 1MTVA 2BD2A 1KXDA 4DW2U 3RXAA 1EJMA 1O3IA 1EPTB 5EW1H 2BD3A 2GZ9A 1K1JA 1W12U 3PMHB 3ODDA 5HIZA 1LKBA 5JB8S 3GY4A 2WUBA 2A5AA 1AZZA 3G01A 4Z6AH 3H5CB 2ZKSA 3M5LA 1C1WH 3HKIB 1FY5A 4INKA 4NIYA 1C1RA 2ZFSA 2G8TA 2FO9A 1O3NA 1AFQC 1BB0B 1DT2A 2EQNA 1BHXB 5K0HA 1LHGH 1CT2E 1TOMH 4BAOB 3CNRA 3TPIZ 1AO5A 2D8WA 3LU9B 1G2MA 3RXQA 3UY9A 3MTYA 2P3FH 1EAIA 2BY7X 2BZ6H 5HGGA 1GL0E 2ODYB 3LGIA 3A7XA 4ISHH 2Z3CA 4X2XA 3MH4A 4KP0A 5DP7A 4WXIA 3KHVA 5C94A 1O2JA 2A5KA 2C8XB 5GPIB 2CF9H 1J14A 2LP6A 1BZXE 1ZSLA 1J8AA 1SLWB 2R2WU 2O8LA 1C2KA 3ZYEA 1NROH 1OWHA 1IQGA 4AGKA 4B74A 2RA3A 1KY9A 2PR3A 2W3KA 4OGYA 4ABIA 4X1PU 3PTBA 4B6EA 3M7QA 1WV7H 4ACBA 1GVLA 2LELA 2Z6BD 1SGFG 7GCHG 3N99A 2EEKA 2WUCA 4OS4A 3E0PB 1KDQA 6GCHG 2NU1E 5EJZA 1O3JA 1AMHA 1RD3B 4ZH8A 1CHOF 3L6PA 4WMDA 2HNTF 1YLDA 2P3TB 1L1GA 4INHA 2ZU1A 5FCKA 1WQVH 2A4QA 1DWEH 2O8WA 3E91A 5EGMA 1P10A 1J16A 4AZ2B 1E1QD 3A8AA 3M35A 4XSKU 1WTHD 1TA2A 3UOUA 3MMGA 1NBME 1S6LA 2Y80A 2PUQH 2WYJA 3CS7A 1HLTH 1QRZA 3ITIA 3SV9A 2BDGA 2WZQA 3I29A 1GBLA 4AYVB 5IK2D 1S81A 4JCNA 1C9TA 3ZVAA 3KQDA 1V2WT 3MNSA 1NRQH 3D23A 3PLBA 4MLFB 5AFYH 3SJ9A 4BTIB 2W7SA 2ZWLH 1C5VA 1W8BH 3SGAE 3UR9A 1X7AC 7LPRA 3GCNA 1OYQA 3SW2B 1P2QA 2FMJA 3VGCB 1F0RA 5L2ZH 5E0GA 4CHAC 3E6PH 5JBCS 3PV2A 1FIWA 5T1VA 1LVBA 3U8OH 3MFJA 3A7ZA 2J92A 1NRSH 3T25A 2Z7FE 1P2JA 2RG3A 3CS0A 1UK2A 3PV5A 1NPMA 2GP9B 5A2MH 4RKOB 2BVRH 2ZF0H 3RC4A 3RXCA 2ALPA 1XMNB 2ZU5A 2HRVA 5JPMH 1B0FA 3A8DA 1BBRK 1ZPCA 2H9TH 1MABB 1MTNB 3JZ1B 2FI3E 2IPQX 2SGDE 3I77A 3IITA 1O2YA 1RFNA 4TY6A 4Y7AA 1S0RA 2PKSC 2WPJS 1ANCA 1VR1H 5HIYA 1DFPA 1PPFE 2G51A 3SU2A 4YLUA 3AASA 3AVZA 4CBNA 4A1VA 1SR5C 3E3TA 1TPPA 1ARCA 1P02A 4NWLA 2J95A 2AIQA 1AY6H 2QF3A 3F6UH 2QF5A 2TRMA 2R3YA 3FANA 1GBIA 2JDID 1NU7B 3UQOA 3DA9B 4JK6A 4DCDA 3SOSA 2SFAA 5GCHF 1LKAA 1S5SA 3RLYH 5HM9A 3SI4H 1MKXH 1TWXB 1FAXA 2ZGBH 4B2BA 5C0TA 2VINA 1O34A 4FUFA 4DOQA 1H8DH 2FI5E 2ODPA 2FXRA 1O2OA 1V2MT 3CENA 4I8GA 1OKXA 2JJ2D 3V0XA 1SC8U 1UHBA 3ZIAD 5EQSA 2JH0D 1XUKA 2H1UA 2FOMB 1MMJN 2I6SA 1FX0B 4XBBA 1GJ6A 4IMZA 1QA0A 1NFUA 3KQCA 3SV6A 1O3GA 1LVMA 3NXPA 6CHAB 1SGCA 5F03A 1ESAA 4E06H 1LCYA 2RA0A 2FYQA 1EFRD 1GJAB 4K1SA 1WTGH 1T31A 2ODQA 3RXJA 3LT3A 5ETXA 2Z9GA 3DSPA 1GI6A 1O39A 3OYPA 5EQRA 1G3DA 1D3PB 1UVSH 1NT1A 3TLOA 1QB9A 1VCQA 4AN7A 3O8RA 2F3CE 1AU8A 2R9PA 3TGKE 1CBWB 2PW8H 1DUAA 2FOGA 3HK6B 3BEFB 1ELEE 1YPHE 3GCHB 3UWJH 1P3CA 1Z8RA 2OD3B 2BX4A 4TWWA 3KL6A 1UVUH 1P06A 3UQVA 4CH2B 5HXFA 2PTNA 1O3DA 3RC5A 1H4WA 3GY3A 1CQQA 3DSOA 1ELGA 4R8TB 1N1LA 3RXVA 1QGFA 1FUJA 5EPYA 9ESTA 4XBDA 1IQLA 2GMTB 4AB8A 4TYDA 1P9SA 5C0UA 2XBWA 1SQTA 5DP4A 4J2YB 5DN6D 1DLEA 1UTOA 1KXBA 5C3NA 2RCEA 3QK1A 3RMLH 3RMNH 1C5OH 5FBEA 2UUYA 4AC9A 2ZU2A 1G3EA 3BTTE 2QV1A 3RXKA 3A87A 3ZVDA 5JB9S 2ZA5A 5F53A 1FPCH 1UVTH 4RI0A 1HAOH 3PTNA 4IN1A 1YY3A 3H09A 2GCHG 3MNBA 2GZ7A 1TIOA 1NRPH 3UREA 3KQ5A 4ZKRU 1KLJH 1RRKA 2BY6X 1EASA 3VGCC 1WXRA 1Y3WA 4JYTA 2H9HA 2C8WB 4IW4E 4B73A 3FVFB 3R3GB 3VB6A 1EJAA 3HKJB 4IC6A 1EZSC 2Y5HA 1C2IA 2K0QA 1QL7A 4ASUD 1W0KD 3TITA 1Z71A 1P3EA 4UDWH 1AQ7A 3D49H 4WH8A 4VGCB 3QX5H 5C5OA 1SI5H 1XVOA 2QXJA 2ZGHA 4BAQB 1V2PT 1O3LA 1P2OA 3K6YA 4A1XA 1MAYA 4K5ZA 1GL1A 1QCPA 1ZMNA 2FOBA 2HPPH 4RT0A 2NU2E 1C4Y2 4IS5A 1D9IA 3A85A 2WYGA 4B75A 1ZGVA 4XD7D 5A0BA 5K7RA 4MPVA 1DOJA 1T8NA 1TGNA 2TBSA 3MO3A 1E35B 3EE7A 2HGTH 1SLXB 2O8TA 3TK5A 4BNRA 4AX9H 1W7GH 3OE7D 1GMHG 1W3CA 4GLYA 2A31A 4FVBA 2PSXA 1IAUA 2BD5A 3E16B 2AGGX 4MQAA 3RM0H 4MNVA 3SYJA 2PFEA 4DG4A 1DVAH 3ZZBA 1F92A 2QAAA 3S9AA 1CT4E 2HNTE 2VIPA 1BTUA 4O9VA 1SLVB 2C93B 1VKYA 1TONA 2F9PA 3BTHE 4FU8A 2BD8A 3T28A 2VVUA 1A5HA 3P8OA 3NKKA 4CRAA 1V2UT 3MU1A 1E0FD 3TVJB 4DGJA 2ZP0H 3PWBA 4WVPE 1W0JD 4K8BA 1TMBH 2TGAA 1FPHH 1O2KA 3R0FA 1EOJA 1V2KT 5GJ4B 1EKBB 1W7XH 2GD4B 1E38B 2CHAB 2W6JD 4UFEH 3KYFA 1TALA 2QXHA 3SNEA 3BG8A 2GKVE 2CV3A 2ZPQA 4AGJA 1K1IA 2R0KA 3LC3A 1PPHE 1GCTB 3PO1B 1O2LA 2XRCA 4CHAB 5CDFE 2ZFQH 4GHTA 2GCTB 3SHAH 2ZU4A 4Y71A 3OX7U 1MBQA 2FESH 1V2RT 1E37B 1KTTB 4B1TA 1A7SA 1UCYE 3EA8A 2HPQH 4NA8A 3SU3A 5TCCA 4ZHMU 5C2ZA 2F9OA 1QJ6B 4X0WU 1O2NA 2B7DH 3A84A 4FUHA 1BTYA 4DIIH 3HGNA 4YOIA 4I32A 1BQYA 4ZHAA 1AN1E 1AGJA 2TIOA 3VXFH 2Y5GA 1GI2A 2Z94A 3SQHE 1ELAA 1DXWA 3TGJE 3U69H 2AGIX 3M37A 5EPNA 4DURA 2XC5A 4ZUHA 3MQKC 1BOQA 4P02A 3ATWA 1KXAA 4OS1A 5EJLA 1TRYA 1JRTA 2YMSC 3RP2A 1BHXF 1Q2WA 2CK3D 5T6GA 5FX5A 3LIWA 1GVKB 1C5LH 3BTGE 2AS9A 1MH0A 5I25A 1GMDF 1BMLA 1BRAA 4BTUB 4ABFA 3A86A 4JMYA 2VIOA 2SGQE 3FZZA 2QXGA 4MG3A 3PO1C 1O3FA 2XBXA 1FY1A 4SGBE 4FOUC 5FXLA 2OCVB 4BAMB 1P03A 1GI9B 1KLIH 2UWPA 2HNTC 3CP7A 3QN7A 1W14U 1UW7A 5EW2H 1FN6A 1XUIA 3LGTA 1HAGE 2BMGB 2AIPA 3ENSB 1EATA 3U28C 2YMSB 4I8JA 2A5IA 3VB3A 3DD2H 1GMHF 3O8BA 2J34A 2VU8E 3RXIA 1TB6H 1WU1A 3GS9A 2ZPSA 1O3AA 4XOJA 1ACBE 1L1NA 4TSFD 1KXEA 4NZLA 2ZDAH 1TGSZ 1O33A 1TMTH 1P05A 2BM2A 3SV7A 5FHTA 1HGTH 3MU4A 1HRTH 1V3XA 1UTNA 1C5RA 3AAUA 3E90B 5CMXH 1OYTH 1OWIA 3OU0A 3SJIA 4YOJA 5JBAS 1MZDA 5AHGH 5KGOA 1AB9C 1T8MA 2ZEBA 2TPIZ 1BJUA 2RDLA 1EPTC 4I33A 3V12A 2A7JA 4O97A 2FEQH 2AYWA 2VBCA 4JZDH 5E0HA 5EXNA 1IQMA 2V0BA 3BTKE 2OBOA 4SGAE 3TK9A 1HXFH 5HM2A 4FUJA 1C1UH 3C1KA 2ZHFH 1XKBC 3ELAH 1P2NA 5GXPA 3BTFE 3F9FA 1ORFA 3T29A 3NCLA 2FODA 1BTZA 2FX6A 3SUEA 4H42U 1YF4A 5T6FA 3P92A 1Y5AT 4ISIH 2D26C 1K0HA 2GVFA 2QCYA 2W3IA 2ZDVH 2CF8H 3ZZ6A 1IQNA 2FLRH 1W10U 2QF0A 1SQRA 4YT7H 5C5NA 1TA6A 1HAHH 3F0OA 1OP2A 4ISLA 3FO8D 5TCAA 2ZDNA 1EPTA 1CE5A 3W95A 2Q6FA 1K28D 2PTCE 1IQJA 3GY2A 5C1UA 1QRWA 5AFZH 2RDEA 2XYAA 4TY7A 1PQ5A 2P59A 1SMFE 5E8EH 1E36B 1C2JA 1F5RA 1PQ7A 1GI4A 2FWWA 1HBTH 1O3KA 3QDZB 4CR5A 2F83A 1D3DB 4MDSA 1A0HB 4ZHLU 3GCTG 1EP6A 2Y5FA 3K9XB 2A45B 3ATKA 3MO9A 5BPEA 5CHBA 4NCYA 1J15A 1FDPA 1INCA 2QXIA 1P01A 1YLCA 2FX4A 1K2I1 2AMPA 2J98A 3F9HA 1SGEE 2GT8A 1ZJDA 1O3CA 1TMUH 3QO6A 4BAHB 1HAIH 2UUFB 3RM2H 1HAPH 4F55A 1MKWH 2YMSD 1YM0A 1UCYH 5I46H 5DP9A 5DP3A 3NZIA 1GI1A 4J1YA 4IGDA 3KEEA 4UFGH 4H4FA 2FP7B 4HI3A 1GBTA 1EX3A 2GDEH 2IJD1 2NU0E 3L3TA 1H9LB 1B5GH 3NRLA 1BCUH 2H2ZA 1CBWC 4GCHF 3TJVA 1TNKA 1HFDA 3C27B 2VH6A 3ZZ4A 5LH8A 4ABGA 1CGJE 1C5WB 3EAJA 2JIZD 5JBTA 4Y0YE 4B76A 2CJIA 1KIGH 2C3SA 1T4UH 1VCPA 1WDIA 3WY8A 1MZAA 1GHBG 3A7WA 3P70B 1XM1A 3SU4A 3N7EA 2EI7A 4PROA 2ULLA 1O30A 1AUTC 1LVOA 3LGUA 2QA9E 4O3UA 1EQ9A 5A0AE 3UIRA 1Y5BT 1C1NA 2P95A 2Q6DA 3SJ8A 2FYRA 3OEED 2QYIA 2VNTA 2V7QD 3B23B 3U8RH 2BLWA 2W6ID 2D2DA 7ESTE 1ABJH 4UEHH 4OS2A 1A0JA 2GZ8A 2VH0A 1B0EA 4XFQA 4ABHA 1W0YH 3M5OA 4HZHA 2YNAA 1ZJKA 2L74A 3MU8A 3UOPA 3LH1A 3HATH 1ETRH 3P95A 9LPRA 1GI8B 3GCHC 3SNBA 2VGCC 1NTPA 1GWAA 1O3MA 1K1OA 3T27A 1C5TA 2IOTA 3PRBA 2EI6A 1QHRB 3RXBA 5E2OA 3URDA 2VVCA 2VWNA 1VGCB 2C90B 3ZVGA 2EY4C 2LPRA 2IJOB 1EB1H 1MCVA 4F49A 3E8LA 1FJSA 4IMQA 2FI4E 1V6DA 1FXYA 2GMTC 4D9RA 4BANB 1G37A 1YWUA 2F4LA 2J98B 1QJ1B 3Q77A 1F5KU 4JK5A 3S0NA 1QA7A 1V2TT 2G00A 4B71A 4YO9A 2JH6D 4B2CA 1MBMA 3FP6E 2Y81A 4UD9H 2G4TA 1O2ZA 3U8TH 4AORA 2EA3A 1NS3A 4NIXA 1C2LA 4I86A 1E34B 1DY9A 1QR3E 3MO6A 1VITF 1KMHB 2FOEA 3MH5A 1LDTT 3UNSA 1TNGA 2PGQB 5DSFA 3DFLA 3T2NA 2BDAA 3SZNA 2VWLA 1GI0A 2BHGA 1QNJA 4Y11E 1DLKB 5LPFA 3S7KB 1F7ZA 5HMAA 4Y8YA 2FDAA 1AE8H 1AKSA 1YPKH 1AB9B 2ZDLA 1BITA 1SGDE 1YPHC 3A8CA 4Q7YA 1BRUP 3KQBA 1RGQA 2H5DA 2WPIS 4Q7XA 3SGBE 1TNHA 1Z1IA 3WWFA 3TJUA 3UFAA 3RU4E 5B6OA 2SGFE 3RMOH 1JIMA 1GJ9B 1CHOG 3IG6B 1EZUC 2XBYA 1P0SH 2H9EH 2W7UA 5EIYA 1GHBF 2PKAB 3T62A 2QY0B 3SJKA 1FZZA 1Z8JB 4GPGA 2NWNA 3GICB 1CU1A 1O5EH 1K1MA 1UTKA 5C20A 4A92A 4I31A 3ZVCA 1GJ4H 1UMAH 2FS8A 2V35A 2G52A 3RMMH 1LPZB 1ELBA 1MD7A 1O5CB 3F2HA 4P00A 4YLQH 2WPHS 4F4OC 1Z8GA 3OEHD 5CHAC 8GCHG 1LHCH 2AFQB 4NSYA 2PV9B 1JWTA 2FLBH 3TJOA 3P8FA 4NA7A 3I78A 1WUNH 2OQ5A 2V3HH 2BTCE 6ESTA 4QT8C 4CRCA 5E0JA 5F6MA 1AWFH 2ZIQH 3OSYA 2B5TB 1CA8B 1D4PB 3U1JB 1C5MD 2G4UA 2YOLA 1Y8TA 1NC6A 2NU4E 2ZG0H 1EOLA 1K1LA 2H6MA 2ZCLP 1LVYA 1UTPA 5A8YA 1FAKH 3Q00A 1S85A 4I8LA 2OBQA 1Q31A 1QJ7B 2VIVA 2RFKC 2OINA 2FS9A 2G81E 4NFEA 4NZQA 1J17T 4FETA 1G3BA 2W5EA 5EXMA 3STJA 3P6ZB 1ELVA 3VG8A 5EU8A 1PQ8A 5L6NH 4AFUA 2ZHWH 1GBEA 1GG6C 1U6QA 1O3BA 2QIQA 1VZQH 1O5GH 1SGRE 1N6YA 1O37A 1GHZA 1O2MA 2BY9X 1CGHA 1DWBH 1UTLM 3W94A 5A09A 1TFXA 3F2FA 1O3OA 1QFKH 2OUAA 1PQAA 3P8NA 2FOAA 1ANDA 2A0QB 1H1BA 1TBRH 1ZTLA 3KCGH 1N6XA 5AF9H 4NFFA 5GWZA 2OXSA 3FN8A 5CE1A 5SGAE 4CRFA 1O2WA 3JZ2B 4X6PA 1CT0E 1SFIA 2OC8A 1OXGA 3RLWH 4GHQA 2XOKD 4RSPA 3KF2A 1V2QT 2VWOA 3NK8A 2SNVA 1BT7A 4WWYA 1KXFA 5FPTA 2F9NA 1WQSA 1QB6A 2BDCA 1HB0B 3Q3YA 1AZ8A 1S6FA 3ZVBA 3WW7A 4FUDA 4A5TS 2WINI 1RTFB 3SZEA 3UNRA 2KFWA 1MTUA 1V2JT 2ZFPH 4NG9H 1RIWB 3Q3XA 4M9FA 4A7IB 1A61H 2DUCA 3LPRA 3LDXH 2ASUB 1AKSB 4CR9A 2TGPZ 3BV9B 1A5IA 1AI8H 2ZZUH 2BLQA 3RUOA 4AOQA 2WPKS 4INLA 1C2EA 2IPHA 4CREA 2ZQ2A 1GMCF 1V2NT 5AVDA 2QN5T 3ODFA 4KELA 2ZTXA 3ESTA 1O2TA 8LPRA 1O2PA 1S6HA 3U9AH 1O2IA 1DSUA 3TU7H 4Q4LA 3BG4C 1IQFA 2I6QA 1ELCA 2ZFRH 4WJG2 1GBMA 1WAYB 1C5SA 4BTTB 2THFB 4MNWA 4O03A 4D7GA 4X1RU 1O5FH 1O2RA 5DP5A 2KAIB 1OWKA 2P8OB 3PV4A 5C1XA 4ZAEA 2A4GA 2W26A 2BY8X 2PSYA 1T8LA 3ZZ9A 3BF6H 5G4BA 1K21H 1JRSA 2P16A 4RKJB 1LPGB 1O2GH 2O9QA 4ZROA 4ZKOU 1EAXA 1TQ7B 1GJ5H 2Z9LA 1O38A 4AFSA 2XNDD 1C2GA 1XX9A 1GBBA 2YNBA 3H7TA 1OS8A 3A81A 1FY4A 1GBCA 3GYLB 3T26A 1H8HD 3LONA 4X8UH 5ESTE 3Q76A 1N8OB 3RXEA 4Y7BA 1TPSA 3DFJA 1E79D 5DGJA 3SQEE 1EJNA 4ABAA 3S9CA 1EZXC 3LJJA 1S83A 3MHWU 5PTPA 2ZQ1A 3S69A 3LGWA 4YZUA 3SJOA 2V3OH 1C2DA 1OHHD 4H6TA 4NIVA 3UPEA 5EJ1A 1O5AB 3ZYDA 1NRNH 4ZKSU 1BJVA 3BTQE 1LHDH 1GGDB 3OFND 2BQ7B 2AMDA 2ZHEH 2KCAA 5A8ZA 1NY22 5DK1A 1XUFA 2ANWA 2ZI2H 1SQAA 1CA0B 4AG2A 1BTXA 1JIRA 4ABBA 4ZCNA 1AIXH 5ESBA 1SQOA 8GCHF 1G2LA 3N7DA 1GCDA 3GY7A 4UFDH 3SORA 1P2IA 1SG8B 1MCTA 3EYDA 2O8MA 1RTKA 2ZNKH 3ZV9A 3M3SA 3W1EA 2OP9A 2PHBA 3ATMA 2ESTE 4FU7A 1ZHRA 3M3TA 1BRCE 3LOXA 1YYY1 4NWKA 1TX6A 1YCPM 2ZHDA 4MNXA 1D3TB 2EC9H 1G30B 1A46H 2ZGXH 4I8HA 1P57B 2ZDMA 1Z1JA 4X8TH 4Z0KA 5LPEA 1L1JA 1K1PA 1TRNA 1ZHPA 1GJDB 4XBCA 1ABIH 1CVWH 3KNXA 4BXSA 1TX8A 1IQKA 4CRBA 4Y0ZE 2BOHB 4MTBA 4X8VH 1BTHH 1O3PB 4UFFH 1ANEA 1ZGIA 1F2SE 2KZ4A 1KXCA 1P2KA 3A83A 1O2XA 1H9HE 2R2MB 5DG6A 3SN8A 1HPGA 4LOYH 3PWCA 1GHAG 1H9IE 2LNCA 3OY5U 1O2QA 1PYTC 7KMEH 3M5NA 1ZOMA 2G5VA 1VITG 1FV9A 1NN6A 1YCPH 3OY6U 4HGCA 4ZKNU 3EGKH 2Z9JA 1ANBA 3M7TA 1EZQA 1DPOA 3F9GA 1C1SA 4OGXA 3RU4T 2F9UA 6CHAC 4ABEA 2BYAX 4FU9A 4KTSA 4U30A 5BRRE 2Y82A 3PMBB 1A3EH 2A1DB 3OAAD 1ID5H 4YXWD 2BDYA 1HIAB 3ZZ8A 1QBVH 3K2UA 1DICA 2V3MA 1O2VA 1XUJA 2AH4X 4WMEA 1LQEA 4FUBA 3SU6A 5F8XA 1VITH 1QB1A 4CRDA 2KAIA 3ZZAA 4YT6H 5FAHA 1GDUA 1HCGA 3A8BA 4KTUA 4FUCA 4XRNA 2K8IA 1QBNA 3HPTB 2A7HA 3EDXB 5EQQA 2C4FH 4X1SU 1FNIA 2CXVA 1IQHA 1H8IH 1SGPE 3EA9A 1KLTA 4KKDA 3MNXA 1NU9A 1EUFA 4Z1MD 2CGAA 1MTWA 1DDJA 4MPUA 5E2PA 1O36A 2OLGA 8KME2 3KN2A 1JXPA 1GJ7B 2VGCB 5JBBS 2XCFA 1GHAF 1AD8H 1TBQH 1K1NA 3KYGA 2A4OA 3QGNB 1B7XB 2JKHA 1HAVA 3D62A 3ZVFA 1THRH 1ELFA 1BTWA 3IWMA 1GI3A 1PPEE 2NU3E 4DT7B 1ZTJA 1UO6A 1LHFH 4Q7ZA 3LJOA 3ZZ7A 3F2GA 3UR6A 4AFQA 1BTPA 2WV5A 2M2AA 4XE4A 3SNDA 2ZDKA 1BUIA 1DXPA 4KGAA 4LXBH 1RJXB 3SUDA 1H8ED 1QQUA 1A1RA 4JYVH 4GAWA 5EOKA 1NM6A 2BD9A 2HLDD 3SU1A 1O2HA 3MU5A 5DJ7A 3ZV8A 4K2YA 4GUXA 1Q3XA 5HKKD 2Y7XA 1MKXK 4A6LA 3UWIA 4JZFH 3EA7A 3QTVH 2UWOA 2KR7A 2F9BH 2J94A 3GY6A 1J9CH 4GCHG 3RXGA 3P8GA 3VB4A 4LK4A 1UVPA 1P04A 1W13U 2ZTYA 2BOKA 3FOAA 1F0UA 1YC0A 1NESE 1GPZA 2XC0A 1NZQH 1YLNA 1JMOH 1ZR0A 4ACAA 1L4ZA 5FCRA 1D6WA 1K9OE 4DVAU 1C4V2 3BEUA 3RXRA 2Q1JA 1O5BB 4FUEA 4K3JA 3GDSA 1EB2A 2OC0A 1HYLA 1UTJA 4ABJA 1A3BH 1M9UA 3BTWE 4X6MA 1MAXA 2KM0A 1DX5M 3ATLA 4OS7A 3PM3A 2Z3DA 1ZLRA 1SGYE 2ZGCA 4ISNA 2VIQA 1SKYE 3FKSD 1JOUB 3KIDU 3GCTF 4FVDA 3UAIC 1A2CH 1YKTA 3STIA 2XNIA 2R3UA 1BRBE 1ZSKA 3RXOA 4A1TA 1W0ZU 5JYIA 3UUZA 2HVXA 1GI5A 1WYKA 4CBOA 1AE5A 4Y79A 2ZCHP 2STBE 4YOGA 3RXFA 2ZGJA 3RC6A 4K60A 5GNDA 1GDQA 1Y5UT 3MH7A 3LGYA 3DUXH 1QURH 4LZ1H 1GBJA 3Q3KA 1THPB 3LH3A 1C1MA 1TAWA 1AFQB 1TYNA 3QLPH 1BMMH 1BMAA 1SGIB 4GVUA 1UJ1A 2L6OA 5JDUB 2HVYB 1RS0A 4OS5A 5T6DA 4HG6A 1DS2E 1FY8E 1TX7A 2BXTH 1TE0A 1NO9H 1MUEB 4I7YH 2XXLA 1GBHA 4U32A 1CSOE 4K69A 2SGEE 4TPIZ 5FBIA 2QF4A 1TNJA 2BLVA 4AYYB 2GDDA 2H5CA 3SV2H 4FXGH 2C8ZB 1OWJA 1THSH 2J4IA 1HNEE 1O35A 3PRDA 1DWDH 2FOCA 4E7RG 1SPJA 1A5GH 3SGQE 1ETTH 3TIUA 3B9FH 1TPAE 5FX6A 2WHXA 3DSGA 4ZXXH 2OC7A 3FP8E 2C8YB 3RXSA 1BMFD 1PJPA 1BBRH 4F48B 1GMCG 1F5LA 1VJAU 2FOHA 1ZHMA 4UE7H 3VPKA 4DJZB 1EAWA 2QGRA 1XUGA 1C1QA 4K1TA 1TRMA 4ZMAH 1FMGA 4HTCH 2VIWA 4BOHA 1P8VC 1PPCE 1IHTH 5A8XA 2GV7A 1OP8A 3A7YA 1C4U2 2PP6A 3AW0A 3FZDA 2VJ1A 1ARBA 1PPBH 3M7UA 3KGPA 3QWCH 1C5UA 1GBKA 1BDAA 1C1VH 2GT7A 1LMWB 2ZFFH 1RTLA 2Z9IA 1A4WH 3VXEH 1C2HA 1N8OC 1DSTA 1ZPZA 1ZTKA 2FTLE 2OC1A 4IC5A 3QUMP 4THNH 1MTSA 2ZO3H 1YPEH 3E1XB 1C5NH 2XBVA 3A88A 5L30H 1YP9A 2VIDA 1F0SA 3RXUA 1SL3A 4FUGA 2GGVB 2UUKB 1CHGA 3O8CA 4X2YA 1O3EA 3K65B 4TPYA 1SSXA 1SB1H 2GV6A 2J2UA 4NGAH 2DE8A 1HJ9A 2HLCA 2BD7A 2AGEX 1UK4A 1KSNA 2PLXA 4RT1A 1OWEA 5DP6A 3RXHA 1MQ6A 1HUTH 4B2AA 3ZZ5A 1QBOA 6LPRA 3L33A 3AW1A 2KCOA 3A80A 2XCNA 2GJGA 1EXFA 2XW9A 1MU8B 2FZZA 4OM9A 4WMFA 1AVGH 3BIVH 3UNQA 1Y3VA 1YPGH 1O2UA 1O2SA 1BMNH 1LO6A 1TPOA 3MH6A 4X6OA 2BDHA 5C17A 2FTMA 1XUHA 2BQWB 1CGIE 4WF8A 3ZVEA 1ZYOA 4D76A 2VWMA 2SGPE 1RIWC 2SNWA 1SFQB 1BA8B 2O8UA 3ZZCA 1GHYH 1SBWA 1Y59T 2ZPRA 2JJ1D 3KQEA 2F91A 3A89A 1VJ9U 1O31A 1W11U 5CHAB 3VB7A 4ESTE 1DANH 1WCZA 2P3UB 1SGTA 2BZAA 1T7CA 1G36A 5FPSA 1QTFA 4X1NU 1FY3A 1AUJA 3U1IB 4Q80A 4Y8ZA 1IHSH 1IOEA 2OQUA 3BSQA 5C67A 1YCPK 4AG1A 2CN0H 2Y6TA 5F8TA 2A32A 1UVOA 1YBWA 1UTMA 1TABE 1HAVB 2Z9KA 4Y6DA 1TGBA 1Z6JH 2XWAA 3LGVA 2PKAA 3RDZA 2WPLS 4U2WA 2WV9A 2P94A 1TBZH 2HOBA 3GCOA 4MVNA 3MOCA 2IN2A 5EODA 2GCTC 2XWBI 4B6FA 3A7TA 1IQIA 2GX4A 1GCTC 1AFEH 5IYTA 1GJ8B 2J97A 2J9NA 2PGBB 1S82A 1GG6B 2F43B 4BXWA 3D65E 4U01A 2ZU3A 3OTJE 5J4QA 1HAXB 1VGCC 3B8JA 3RXLA 4NIWA 1HJAC 1C1TA 2BVXH 4ISOA 1XXFA 1C5PA 3F1SB 1YPJH 2A4RA 4YESB 3TNTA 2AHME 1ZZZA 1P9UA 3TJNA 1O5DH 1G32B 3U98H 1GHXH 3PROA 2BY5X 2JETB 2ZCKP 1T32A 1XVMA 1AWHB 2EI8A 1DY8A 1ESBA 1C2MA 1O32A 4TT3D 3EE0B 2BXUH 1HV7A 1SOZA 3RXMA 1V2OT 3T5FH 3SUFA 1OPHB 4VGCC 5J4SA 2ALVA 2A2XH 4TWYA 4Y76A 3ATIA 4K8YA 1P11E 3RU4D 2SGAA 3QZQA 1BBRE 3NUMA 1O0DH 2VVVA 1Z8IB 1ZRKA 3NPSA 4XDEA 3TH3H 1DE7H 2ZTZA 2ANYA 3LKWA 4DT4A 3AK5A 2GCHF 3BTDE 1TNIA 2OK5A 1IQEA 1S84A 4X8SH 4MPWA 5LPRA 1KYNA 1ZPBA 1T4VH 1PPZA 2FPZA 3M5MA 3SUGA 2BLOA 1TGTA 2Z3EA 3RXPA 1EP5A 2CMYA 3GDVA 1NBMD 2AERH 4GSOA 3M36A 1HIAA 4JZ1A 1OSSA 1NFWA 1P09A 1ELTA 4MPXA 3HK3B 1UHBB 1GVZA 1FQ3A 1HJ8A 3WWBA 1MD8A 1ZRBA 1MQ5A 4JZIA 1KTSB 1RXPA 3BIUH 1C1OA 3PLPA 4D8NA 1K22H 1LHEH 1KDQB 1P2MA 3HGPA 3A82A 1O3HA 2PKSB 5FPYA 1A0LA 1QY6A 1PYTD 2BDIA 2UUJB 5EG4A 5TJXA 1SVPA 2BVSH 1LQDB 4IN2A 1Z7KA 4ASHA 2ZHQH 1C5XB 2KCPA 1COWD 1YGCH 1V2ST 1AVWA 3MYWA 3BN9A 2WPDD 3K6ZA 2HWLB 5C1YA 1SHHB 1GHWH 1GI7B 4ZXYH 3QZRA 2G5NA 4UONA 1FONA 5LGOA 1MKWK 2WPMS 4O3TA 1NFXA 1SGFA 3ZZ3A 1UCYK 1CA0C 1C5QA 3URCA 1OOKB 3P17H 2ZFTA 3ZZDA 3PMJA 5EXLA 4D9QA 5A0CA 4RN6A 1NRRH 3A7VA 1FN8A 2Q6GA 2JETC 2AEIH 4K1EA 4BAKB 3TNSA 1DM4B 1QZ8A 4LZ4B 1MTNC 3F0PA 3VFEA 2FIRH 3MWIU 1HXEH 3F3BA 3M3VA 1TLDA 2A2QH 2R0LA 5GCHG 2G55A 3MU0A 4HFPB 1BIOA 4CH8B 4NA9H 1XXDA 3AAVA 4I8KA 2ANKH 2XTTB 2DE9A 3LC5A 3PMAB 4WH6A 1ZMJA 4FUIA 1L0ZA 4JZEH 2AMQA 2VB0A 2KCYA 4JYUH 3SHCH 5KEDA 3VEQB 3FP7E 1GJBB 1GBFA 1W2KH 2K1QA 4E7NA 3N7OA 2ILNA 1E1RD 5HYOA 1OWDA 3S7HB 1PFXC 4AB9A 1Y3YA 1ZSJA 5GIBA 3SBKA 1GHVH 1TQ0B 1V2LT 2STAE 1C1PA 3V13A 5DO4H 1ZMLA 3SV8A 1C5YB 3H7OA 3BTEE 4IBLH 1P12E 1HAYB 3PLKA 3SU5A 3DHKH 5F8ZA 1OP0A 2BQ6B 4ABDA 3O8DA 1ELDE 3OTPA 4NSVA 1FI8A 2BX3A 3F9EA 4M7GA 4Q63A 3VB5A 2FM2A 2HALA 4X2VA 2B0FA 2FOFA 2P8OC 2ANMH 1V2VT 1HDTH 1WOFA 3E0NB 4Y10E 1T8OA 1NFYA 3QTOH 3TGIE 2PUXB 1L4DA 2QE7D 4X1QU 4X6NA 4KTCA 1CO7E 3GYMA 1C9PA 1TGCA 1SLUB 1Y3UA 2M5TA 3BG4B 2TGTA 3SI3H 1HJAB 1D6RA 1YPLH 2WV4A 3NWUA 2UWLA 3RXDA 2F9VA 1GBDA 5FL7D 3FFGA 4E05H 3F68H 1G9IE 1DWCH 3V3MA 1DUEA 4H6SB 2D1JA 1GBAA 3FAOA 5GDSH 3BTME 8ESTE 1QRXA 2J5UA 3SNAA 1WBGB 1YPMH 2ZECA 1LTOA 1OX1A 3GISB 1L2EA 3V7TA 1ETSH 1C2FA 2Y7ZA 1QL9A 1SGQE 3EQ0H 5KECA 4WY3A 1AHTH 2WSSD 3BEIB 1PPGE 1TOCB 3GDUA 1C5ZB 4WXVA 1SHYA 2KX4A 1Z6EA 4Y8XA 1LPKB 2BDBA 3PYHA 3S9BA 2GTBA 1XKAC 3MI4A 5H4IB 5T3HA 1QIXB 1VCWA 4OS6A 4Q2KA 1GJCB 1FLEE 1ESTA 3TK6A 3M61U 2BD4A 3UB0A 5ABWA 1UTQA 2QC2A 3SU0A 3RXTA 1WSSH 4YTAA 5B6LA 5DPAA 1SOTA 1G3CA 1F0TA 1MU6B 4D7FA 5IDKA 1D3QB 2PWXA 2P93A 1Y3XA 2XC4A 6GCHF 3QGJA 3SNCA 1FIZA 1UK3A 4DIHH 2JH5D 1TNLA 2V6NA 2B8OH 3SO3A 7GCHF 1HAZB 2J38A
chains in the Genus database with same CATH topology
4CRGA 3TH4H 3TH2H 1GGDC 3MNCA 1EAUA 1JBUH 1SGNE 4DY7B 3DT0H 1S0QA 1QL8A 2A7CA 1GDNA 1GMDG 5DKMA 2OTVA 1AVXA 3PB1E 3UTUH 2BB4A 2ZC9H 3GY8A 4AFZA 3GY5A 2TGDA 4MNYA 3GOVB 1QQ4A 5L2YH 1DITH 5DP8A 4YM9A 4X2WA 4R0IA 2CHAC 2B9LA 1MTVA 2BD2A 1KXDA 4DW2U 3RXAA 1EJMA 1O3IA 1EPTB 5EW1H 2BD3A 2GZ9A 1K1JA 1W12U 3PMHB 3ODDA 1LKBA 5JB8S 3GY4A 2WUBA 2A5AA 1AZZA 3G01A 4Z6AH 3H5CB 2ZKSA 3M5LA 1C1WH 3HKIB 1FY5A 4INKA 4NIYA 1C1RA 2ZFSA 2G8TA 2FO9A 1O3NA 1AFQC 1BB0B 1DT2A 1BHXB 5K0HA 1LHGH 1CT2E 1TOMH 4BAOB 3TPIZ 1AO5A 2D8WA 3LU9B 1G2MA 3RXQA 3UY9A 3MTYA 2P3FH 1EAIA 2BY7X 2BZ6H 5HGGA 1GL0E 2ODYB 3LGIA 3A7XA 4ISHH 2Z3CA 4X2XA 3MH4A 4KP0A 5DP7A 4WXIA 3KHVA 1O2JA 2A5KA 2C8XB 5GPIB 2CF9H 1J14A 1BZXE 1ZSLA 1J8AA 1SLWB 2R2WU 2O8LA 1C2KA 3ZYEA 1NROH 1OWHA 1IQGA 4AGKA 4B74A 2RA3A 1KY9A 2PR3A 2W3KA 4OGYA 4ABIA 4X1PU 3PTBA 3M7QA 1WV7H 1GVLA 2Z6BD 7GCHG 1SGFG 2EEKA 2WUCA 4OS4A 3E0PB 1KDQA 6GCHG 2NU1E 1O3JA 1AMHA 1RD3B 4ZH8A 1CHOF 3L6PA 4WMDA 2HNTF 1YLDA 2P3TB 1L1GA 4INHA 2ZU1A 5FCKA 1WQVH 2A4QA 1DWEH 2O8WA 3E91A 5EGMA 1P10A 1J16A 4AZ2B 3A8AA 3M35A 4XSKU 1WTHD 1TA2A 3UOUA 3MMGA 2Y80A 2PUQH 2WYJA 3CS7A 1HLTH 1QRZA 3ITIA 3SV9A 2BDGA 4AYVB 3I29A 1GBLA 1S81A 4JCNA 1C9TA 3ZVAA 3KQDA 1V2WT 3MNSA 1NRQH 3D23A 3PLBA 4MLFB 5AFYH 3SJ9A 4BTIB 2W7SA 2ZWLH 1C5VA 1W8BH 3SGAE 3UR9A 1X7AC 7LPRA 3GCNA 1OYQA 3SW2B 1P2QA 2FMJA 3VGCB 1F0RA 5L2ZH 5E0GA 4CHAC 3E6PH 5JBCS 1FIWA 3U8OH 1LVBA 3MFJA 3A7ZA 2J92A 1NRSH 3T25A 2Z7FE 1P2JA 2RG3A 3CS0A 1UK2A 1NPMA 2GP9B 5A2MH 4RKOB 2BVRH 2ZF0H 3RC4A 3RXCA 2ALPA 1XMNB 2ZU5A 2HRVA 5JPMH 1B0FA 3A8DA 1BBRK 1ZPCA 2H9TH 1MTNB 3JZ1B 2FI3E 2SGDE 3I77A 3IITA 1O2YA 1RFNA 4TY6A 4Y7AA 1S0RA 2PKSC 2WPJS 1ANCA 1VR1H 1DFPA 1PPFE 2G51A 3SU2A 4YLUA 3AASA 3AVZA 4CBNA 4A1VA 1SR5C 3E3TA 1TPPA 1ARCA 1P02A 4NWLA 2J95A 2AIQA 1AY6H 2QF3A 3F6UH 2TRMA 2R3YA 3FANA 1GBIA 1NU7B 3UQOA 3DA9B 4JK6A 4DCDA 3SOSA 2SFAA 5GCHF 1LKAA 1S5SA 3RLYH 5HM9A 3SI4H 1MKXH 1TWXB 1FAXA 2ZGBH 4B2BA 2VINA 1O34A 4FUFA 4DOQA 1H8DH 2FI5E 2ODPA 2FXRA 1O2OA 1V2MT 3CENA 4I8GA 1OKXA 3V0XA 1SC8U 1UHBA 5EQSA 2JH0D 1XUKA 2H1UA 2FOMB 1MMJN 2I6SA 4XBBA 1GJ6A 4IMZA 1QA0A 1NFUA 3KQCA 3SV6A 1O3GA 1LVMA 3NXPA 6CHAB 1SGCA 5F03A 1ESAA 4E06H 1LCYA 2RA0A 2FYQA 1GJAB 4K1SA 1WTGH 1T31A 2ODQA 3RXJA 3LT3A 5ETXA 2Z9GA 1GI6A 1O39A 3OYPA 5EQRA 1G3DA 1D3PB 1UVSH 1NT1A 3TLOA 1QB9A 1VCQA 4AN7A 3O8RA 2F3CE 1AU8A 2R9PA 3TGKE 1CBWB 2PW8H 1DUAA 2FOGA 3HK6B 3BEFB 1ELEE 1YPHE 3GCHB 3UWJH 1P3CA 1Z8RA 2OD3B 2BX4A 4TWWA 3KL6A 1UVUH 1P06A 3UQVA 4CH2B 5HXFA 2PTNA 1O3DA 3RC5A 1H4WA 3GY3A 1CQQA 1ELGA 4R8TB 1N1LA 3RXVA 1QGFA 1FUJA 5EPYA 9ESTA 4XBDA 1IQLA 2GMTB 4AB8A 4TYDA 1P9SA 2XBWA 1SQTA 5DP4A 4J2YB 1DLEA 1UTOA 1KXBA 5C3NA 2RCEA 3QK1A 3RMLH 3RMNH 1C5OH 5FBEA 2UUYA 2ZU2A 1G3EA 3BTTE 2QV1A 3RXKA 3A87A 3ZVDA 5JB9S 2ZA5A 1FPCH 1UVTH 1HAOH 3PTNA 4IN1A 2GCHG 3MNBA 2GZ7A 1TIOA 1NRPH 3UREA 4ZKRU 1KLJH 1RRKA 2BY6X 1EASA 3VGCC 1Y3WA 4JYTA 2H9HA 2C8WB 4IW4E 4B73A 3FVFB 3R3GB 3VB6A 1EJAA 3HKJB 4IC6A 1EZSC 2Y5HA 1C2IA 1QL7A 3TITA 1Z71A 1P3EA 4UDWH 1AQ7A 3D49H 4WH8A 4VGCB 3QX5H 5C5OA 1SI5H 1XVOA 2QXJA 2ZGHA 4BAQB 1V2PT 1O3LA 1P2OA 3K6YA 4A1XA 1MAYA 4K5ZA 1GL1A 1QCPA 1ZMNA 2FOBA 2HPPH 2NU2E 1C4Y2 4IS5A 1D9IA 3A85A 2WYGA 4B75A 1ZGVA 5A0BA 5K7RA 4MPVA 1DOJA 1T8NA 1TGNA 2TBSA 3MO3A 1E35B 2HGTH 1SLXB 2O8TA 3TK5A 4BNRA 4AX9H 1W7GH 1GMHG 1W3CA 4GLYA 2A31A 4FVBA 2PSXA 1IAUA 2BD5A 3E16B 2AGGX 4MQAA 3RM0H 4MNVA 2PFEA 4DG4A 1DVAH 3ZZBA 1F92A 2QAAA 3S9AA 1CT4E 2HNTE 2VIPA 1BTUA 4O9VA 1SLVB 2C93B 1TONA 2F9PA 3BTHE 4FU8A 2BD8A 3T28A 2VVUA 1A5HA 3P8OA 3NKKA 4CRAA 1V2UT 3MU1A 1E0FD 3TVJB 4DGJA 2ZP0H 3PWBA 4WVPE 4K8BA 1TMBH 2TGAA 1FPHH 1O2KA 3R0FA 1EOJA 1V2KT 5GJ4B 1EKBB 1W7XH 2GD4B 1E38B 2CHAB 4UFEH 1TALA 2QXHA 3SNEA 3BG8A 2GKVE 2CV3A 2ZPQA 4AGJA 1K1IA 2R0KA 3LC3A 1PPHE 1GCTB 3PO1B 1O2LA 2XRCA 4CHAB 2ZFQH 4GHTA 2GCTB 3SHAH 2ZU4A 4Y71A 3OX7U 1MBQA 2FESH 1V2RT 1E37B 1KTTB 4B1TA 1A7SA 1UCYE 3EA8A 2HPQH 4NA8A 3SU3A 5TCCA 4ZHMU 5C2ZA 2F9OA 1QJ6B 4X0WU 1O2NA 2B7DH 3A84A 4FUHA 1BTYA 4DIIH 3HGNA 4YOIA 4I32A 1BQYA 4ZHAA 1AN1E 1AGJA 2TIOA 3VXFH 2Y5GA 1GI2A 2Z94A 3SQHE 1ELAA 1DXWA 3TGJE 3U69H 2AGIX 3M37A 5EPNA 4DURA 2XC5A 4ZUHA 1BOQA 3ATWA 1KXAA 4OS1A 1TRYA 1JRTA 3RP2A 1BHXF 1Q2WA 5T6GA 5FX5A 3LIWA 1GVKB 1C5LH 3BTGE 2AS9A 1MH0A 5I25A 1GMDF 1BMLA 1BRAA 4BTUB 4ABFA 3A86A 4JMYA 2VIOA 2SGQE 3FZZA 2QXGA 4MG3A 3PO1C 1O3FA 2XBXA 1FY1A 4SGBE 5FXLA 4BAMB 2OCVB 1P03A 1GI9B 1KLIH 2UWPA 2HNTC 3CP7A 3QN7A 1W14U 5EW2H 1FN6A 1XUIA 3LGTA 1HAGE 2BMGB 2AIPA 3ENSB 1EATA 4I8JA 2A5IA 3VB3A 3DD2H 1GMHF 3O8BA 2J34A 2VU8E 3RXIA 1TB6H 1WU1A 2ZPSA 1O3AA 4XOJA 1ACBE 1L1NA 1KXEA 4NZLA 2ZDAH 1TGSZ 1O33A 1TMTH 1P05A 2BM2A 3SV7A 5FHTA 1HGTH 3MU4A 1HRTH 1V3XA 1UTNA 1C5RA 3AAUA 3E90B 5CMXH 1OYTH 1OWIA 3OU0A 3SJIA 4YOJA 5JBAS 1MZDA 5AHGH 1AB9C 1T8MA 2ZEBA 2TPIZ 1BJUA 2RDLA 1EPTC 4I33A 3V12A 2A7JA 4O97A 2FEQH 2AYWA 4JZDH 5E0HA 5EXNA 1IQMA 2V0BA 3BTKE 2OBOA 4SGAE 3TK9A 1HXFH 5HM2A 4FUJA 1C1UH 3C1KA 2ZHFH 1XKBC 3ELAH 1P2NA 5GXPA 3BTFE 3F9FA 1ORFA 3T29A 3NCLA 2FODA 1BTZA 2FX6A 3SUEA 4H42U 1YF4A 5T6FA 3P92A 1Y5AT 4ISIH 2D26C 2GVFA 2QCYA 2W3IA 2ZDVH 2CF8H 3ZZ6A 1IQNA 2FLRH 1W10U 2QF0A 4YT7H 5C5NA 1TA6A 1HAHH 1OP2A 4ISLA 5TCAA 2ZDNA 1EPTA 1CE5A 3W95A 2Q6FA 1K28D 2PTCE 1IQJA 3GY2A 5C1UA 1QRWA 5AFZH 2XYAA 4TY7A 1PQ5A 2P59A 1SMFE 5E8EH 1E36B 1C2JA 1F5RA 1PQ7A 1GI4A 2FWWA 1HBTH 1O3KA 3QDZB 4CR5A 2F83A 1D3DB 4MDSA 1A0HB 4ZHLU 3GCTG 1EP6A 2Y5FA 3K9XB 2A45B 3ATKA 3MO9A 5BPEA 4NCYA 1J15A 1FDPA 1INCA 2QXIA 1P01A 1YLCA 2FX4A 1K2I1 2AMPA 3F9HA 1SGEE 2GT8A 1ZJDA 1O3CA 1TMUH 3QO6A 4BAHB 1HAIH 2UUFB 3RM2H 1HAPH 1MKWH 1YM0A 1UCYH 5I46H 5DP9A 5DP3A 3NZIA 1GI1A 4J1YA 4IGDA 3KEEA 4UFGH 4H4FA 2FP7B 4HI3A 1GBTA 1EX3A 2GDEH 2NU0E 3L3TA 1H9LB 1B5GH 1BCUH 2H2ZA 1CBWC 4GCHF 3TJVA 1TNKA 1HFDA 3C27B 2VH6A 3ZZ4A 5LH8A 4ABGA 1CGJE 1C5WB 3EAJA 5JBTA 4Y0YE 4B76A 2CJIA 1KIGH 2C3SA 1T4UH 1VCPA 3WY8A 1MZAA 1GHBG 3A7WA 3P70B 1XM1A 3SU4A 2EI7A 4PROA 2ULLA 1O30A 1AUTC 1LVOA 3LGUA 2QA9E 4O3UA 1EQ9A 5A0AE 3UIRA 1Y5BT 1C1NA 2P95A 2Q6DA 3SJ8A 2FYRA 2QYIA 2VNTA 3B23B 3U8RH 7ESTE 2BLWA 2D2DA 1ABJH 4UEHH 4OS2A 1A0JA 2GZ8A 2VH0A 1B0EA 4XFQA 4ABHA 1W0YH 3M5OA 4HZHA 2YNAA 1ZJKA 3MU8A 3UOPA 3LH1A 3HATH 1ETRH 3P95A 9LPRA 1GI8B 3GCHC 3SNBA 2VGCC 1NTPA 1GWAA 1O3MA 1K1OA 3T27A 1C5TA 2IOTA 2EI6A 1QHRB 3RXBA 5E2OA 3URDA 2VWNA 2VVCA 1VGCB 2C90B 3ZVGA 2LPRA 2IJOB 1EB1H 1MCVA 4F49A 3E8LA 1FJSA 4IMQA 2FI4E 1V6DA 1FXYA 2GMTC 4D9RA 4BANB 1G37A 1QJ1B 3Q77A 1F5KU 4JK5A 3S0NA 1QA7A 1V2TT 2G00A 4B71A 4YO9A 2JH6D 4B2CA 1MBMA 3FP6E 2Y81A 4UD9H 2G4TA 1O2ZA 3U8TH 4AORA 2EA3A 1NS3A 4NIXA 1C2LA 1E34B 1DY9A 1QR3E 3MO6A 1VITF 2FOEA 3MH5A 1LDTT 3UNSA 1TNGA 2PGQB 3DFLA 3T2NA 2BDAA 3SZNA 2VWLA 1GI0A 2BHGA 1QNJA 4Y11E 1DLKB 5LPFA 3S7KB 1F7ZA 5HMAA 4Y8YA 2FDAA 1AE8H 1AKSA 1YPKH 1AB9B 2ZDLA 1BITA 1SGDE 1YPHC 3A8CA 4Q7YA 1BRUP 3KQBA 1RGQA 2H5DA 2WPIS 4Q7XA 3SGBE 1TNHA 1Z1IA 3TJUA 3UFAA 3RU4E 5B6OA 2SGFE 3RMOH 1JIMA 1GJ9B 1CHOG 3IG6B 1EZUC 2XBYA 1P0SH 2H9EH 2W7UA 1GHBF 2PKAB 3T62A 2QY0B 3SJKA 1FZZA 1Z8JB 4GPGA 2NWNA 3GICB 1CU1A 1O5EH 1K1MA 1UTKA 5C20A 4A92A 4I31A 3ZVCA 1GJ4H 1UMAH 2FS8A 2V35A 2G52A 3RMMH 1LPZB 1ELBA 1MD7A 1O5CB 4YLQH 2WPHS 4F4OC 1Z8GA 5CHAC 8GCHG 1LHCH 2AFQB 4NSYA 2PV9B 1JWTA 2FLBH 3TJOA 3P8FA 4NA7A 3I78A 1WUNH 2OQ5A 2V3HH 2BTCE 6ESTA 4QT8C 4CRCA 5E0JA 5F6MA 1AWFH 2ZIQH 3OSYA 2B5TB 1CA8B 1D4PB 3U1JB 1C5MD 2G4UA 2YOLA 1Y8TA 1NC6A 2NU4E 2ZG0H 1EOLA 1K1LA 2H6MA 2ZCLP 1LVYA 1UTPA 5A8YA 1FAKH 3Q00A 1S85A 4I8LA 2OBQA 1Q31A 1QJ7B 2VIVA 2OINA 2FS9A 2G81E 4NFEA 4NZQA 1J17T 1G3BA 2W5EA 5EXMA 3STJA 3P6ZB 1ELVA 5EU8A 1PQ8A 5L6NH 4AFUA 2ZHWH 1GBEA 1GG6C 1U6QA 1O3BA 2QIQA 1VZQH 1O5GH 1SGRE 1N6YA 1O37A 1GHZA 1O2MA 2BY9X 1CGHA 1DWBH 1UTLM 3W94A 5A09A 1TFXA 1O3OA 1QFKH 2OUAA 1PQAA 3P8NA 2FOAA 1ANDA 2A0QB 1H1BA 1TBRH 1ZTLA 3KCGH 1N6XA 5AF9H 4NFFA 5GWZA 2OXSA 5CE1A 5SGAE 4CRFA 1O2WA 3JZ2B 4X6PA 1CT0E 1SFIA 2OC8A 1OXGA 3RLWH 4GHQ