2NU2I

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTREYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B, Protease B
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2nu2I00
1HJAI 2OVOA 1SGNI 1CHOI 2NU3I 2SGEI 1SGYI 1OYVI 1IW4A 3B4VC 2SGQI 1CT0I 2GKVA 1YU6C 1SGRI 1OVOA 1H0ZA 2F3CI 2N17A 3SGBI 3OVOA 3HH2C 2KMQA 2NU1I 2BUSA 5JHWC 1LR9A 3SGQI 2ERWA 2SGPI 3SEKC 1TURA 2KCXA 1CGII 2QQDA 1UVGA 2XRCA 1TBRR 1TGSI 4OVOA 2JYYA 2GKTI 1PPFI 2WCYA 1IY5A 2LEOA 1IY6A 1AN1I 4SGBI 2P6AC 1HPTA 4GI3C 1TUSA 1Y1CA 2NU4I 5DAEA 1TIHA 2JZMA 2N52A 1PJUA 3TJQA 1NUBA 2JXDA 2SGDI 1SGQI 2GKRI 4HGUA 1SGDI 1BUSA 1DS3I 1SGPI 1M8BA 2V53A 1TBQR 2N71A 2B0UC 1UUCA 1BMOA 2KMRA 1LR7A 2KMOA 2NU0I 2M5XA 1CT4I 1R0RI 2QQCA 1M8CA 3QTLD 1YTPA 1FYBA 1Y1BA 1MT1A 1LR8A 2SGFI 1OMTA 1UVFA 1CSOI 1CE3A 2NU2I 1SGEI 1OMUA 1PCEA 1DS2I 1CGJI 1Z7KB 1HDLA 1CT2I 2KMPA 1N13A 1KMAA 2ARPF
chains in the Genus database with same CATH superfamily
1HJAI 2OVOA 3TOAA 2X52A 2FNFX 1SGNI 4WP4A 3UGLA 1CHOI 2NU3I 2J87A 2SGEI 2ENZA 3TOBA 9WGAA 2DIPA 3KY9A 1SGYI 1OYVI 1IW4A 3B4VC 2SGQI 1CT0I 2OZUA 1MJ9A 2RIJA 5FUXA 3UOEA 2GKVA 1YU6C 1SGRI 3R5DA 1OVOA 3TO9A 3TO6A 1KBEA 1R79A 3UGDA 3OL0A 2V1CC 5E3RA 4FKDA 1XBTA 1H0ZA 1PTQA 2F3CI 5HI7A 3R5AA 2V1CA 2ORWA 2N17A 1KBFA 2CWHA 2ENNA 5E3PA 3OVOA 3SGBI 1WGTA 3UEJA 3HH2C 5FUVA 4L9MA 2LUYA 2KMQA 2CWGA 1Y8FA 2BUSA 1LR9A 1WTJA 2NU1I 5JHWC 1ULNA 3TJQA 3SGQI 2ERWA 2SGPI 1K7VA 3SEKC 1FY7A 1TURA 1K7TA 2UZ3A 1X74A 4UXHA 5EX3A 2VRWB 2KCXA 1CGII 2QQDA 2E73A 5CCLA 1MJBA 1UVGA 1XA6A 2XRCA 3RU0A 5J8CA 1U5KA 1TBRR 1TGSI 1FARA 4OVOA 1WGCA 5E3QA 1HEVA 2JYYA 2GKTI 2OD1A 4B6DA 1PTRA 2GIVA 3GOXA 2CJSC 3QAHA 1PPFI 2RC4A 2WCYA 3TO7A 1IY5A 1FAQA 2E5RA 2LEOA 1IY6A 1AN1I 3UGIA 1ULKA 1MJAA 3CXLA 4SGBI 3OXFA 1V1IA 3QWPA 4A24A 2Y0MA 2P6AC 1HPTA 3OXGA 2WVJA 2DKVA 3VDPA 4GI3C 1TUSA 2L8EA 1W3SA 1Y1CA 2ELIA 1Z2IA 2NU4I 3UEYA 3FSXA 4E1RA 4DNCA 1Q9BA 1P9GA 1W4RA 5DAEA 1TIHA 1V1HA 1XX6A 1PJUA 2GVIA 1NUBA 1NXUA 2JZMA 2N52A 2ODDA 3E59A 7WGAA 2DB6A 2JXDA 2SGDI 5CCMA 1SGQI 3E2IA 2A20A 2GKRI 1TBOA 2JW6A 4HGUA 2WGCA 2ROWA 1SGDI 1BUSA 1DS3I 1K7UA 1SGPI 2L7XA 3VE5A 3VDUA 1TBNA 1M8BA 2V53A 2QQ0A 2LB7A 2YUUA 5HQ8A 1TBQR 2N71A 2B0UC 1UUCA 1S20A 1BMOA 2YQPA 2K9HA 1P9ZA 3BJIA 2KMRA 5FUWA 1LR7A 2KMOA 2NU0I 3PDNA 1WKXA 4E1PA 2W0TA 1TOTA 2B8TA 2M5XA 1CT4I 1R0RI 3FSYA 2QQCA 1M8CA 3QTLD 1YTPA 4AMLA 1RFHA 1FYBA 4UXJA 1Y1BA 1UHAA 1MT1A 2CWFA 1LR8A 3D00A 5EX0A 2SGFI 1VDDA 2ORVA 1OMTA 1UVFA 3R5BA 2N1AB 3R5CA 4JCVE 5J8FA 1CSOI 1CE3A 3MEKA 2PQ8A 5FUYA 2NU2I 1SGEI 2QPOA 1OMUA 3OXLA 1PCEA 4UXIA 1DS2I 1CGJI 2OU2A 2QQEA 4MPIA 1X4SA 1Z7KB 1HDLA 2UVOA 2J9RA 2JA1A 1CT2I 2KMPA 1N13A 3FC3A 1KMAA 3UFFA 1ULMA 2ARPF 2X3TA
chains in the Genus database with same CATH topology
1HJAI 2OVOA 2FNFX 1SGNI 3UGLA 1CHOI 2NU3I 2J87A 2SGEI 2ENZA 2DIPA 3KY9A 1SGYI 1OYVI 1IW4A 3B4VC 2SGQI 1CT0I 5FUXA 2GKVA 1YU6C 1SGRI 1OVOA 1KBEA 1R79A 3UGDA 3OL0A 2V1CC 4FKDA 1XBTA 1H0ZA 1PTQA 2F3CI 5HI7A 2V1CA 2ORWA 2N17A 1KBFA 2ENNA 3SGBI 3OVOA 3UEJA 3HH2C 5FUVA 4L9MA 2LUYA 2KMQA 2NU1I 2BUSA 1Y8FA 1LR9A 5JHWC 3TJQA 3SGQI 2ERWA 2SGPI 3SEKC 2UZ3A 1TURA 5EX3A 4UXHA 1X74A 2VRWB 2KCXA 1CGII 2QQDA 2E73A 1UVGA 1XA6A 2XRCA 3RU0A 1U5KA 1TBRR 1TGSI 1FARA 4OVOA 2JYYA 2GKTI 2OD1A 4B6DA 1PTRA 3GOXA 2CJSC 1PPFI 2WCYA 1IY5A 1FAQA 2E5RA 2LEOA 1IY6A 1AN1I 3UGIA 3CXLA 4SGBI 3OXFA 1V1IA 3QWPA 4A24A 3OXGA 2P6AC 1HPTA 2WVJA 3VDPA 4GI3C 1TUSA 2L8EA 1W3SA 1Y1CA 2ELIA 2NU4I 3UEYA 4E1RA 1W4RA 5DAEA 1TIHA 1V1HA 1XX6A 1PJUA 2GVIA 1NUBA 2JZMA 2N52A 2ODDA 3E59A 2DB6A 2JXDA 2SGDI 5CCMA 1SGQI 3E2IA 2A20A 2GKRI 1TBOA 2JW6A 4HGUA 2ROWA 1SGDI 1BUSA 1DS3I 1SGPI 2L7XA 3VE5A 3VDUA 1TBNA 1M8BA 2V53A 2QQ0A 5HQ8A 2YUUA 1TBQR 2N71A 2B0UC 1UUCA 2YQPA 1BMOA 3BJIA 2K9HA 5FUWA 2KMRA 1LR7A 2KMOA 2NU0I 3PDNA 4E1PA 2W0TA 1TOTA 2B8TA 2M5XA 1CT4I 1R0RI 2QQCA 1M8CA 3QTLD 1YTPA 1FYBA 1RFHA 4UXJA 1Y1BA 1MT1A 1LR8A 3D00A 5EX0A 2SGFI 1VDDA 2ORVA 1OMTA 1UVFA 4JCVE 2N1AB 1CSOI 1CE3A 3MEKA 5FUYA 2NU2I 1SGEI 2QPOA 1OMUA 3OXLA 1PCEA 4UXIA 1DS2I 1CGJI 2QQEA 1X4SA 1Z7KB 1HDLA 2J9RA 2JA1A 1CT2I 2KMPA 1N13A 3FC3A 1KMAA 3UFFA 5CCLA 2ARPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJA I;  2OVO A;  1SGN I;  1CHO I;  2NU3 I;  2SGE I;  1SGY I;  1OYV I;  1IW4 A;  3B4V C;  2SGQ I;  1CT0 I;  2GKV A;  1YU6 C;  1SGR I;  1OVO A;  1H0Z A;  2F3C I;  2N17 A;  3SGB I;  3OVO A;  3HH2 C;  2KMQ A;  2NU1 I;  2BUS A;  5JHW C;  1LR9 A;  3SGQ I;  2ERW A;  2SGP I;  3SEK C;  1TUR A;  2KCX A;  1CGI I;  2QQD A;  1UVG A;  2XRC A;  1TBR R;  1TGS I;  4OVO A;  2JYY A;  2GKT I;  1PPF I;  2WCY A;  1IY5 A;  2LEO A;  1IY6 A;  1AN1 I;  4SGB I;  2P6A C;  1HPT A;  4GI3 C;  1TUS A;  1Y1C A;  2NU4 I;  5DAE A;  1TIH A;  2JZM A;  2N52 A;  1PJU A;  3TJQ A;  1NUB A;  2JXD A;  2SGD I;  1SGQ I;  2GKR I;  4HGU A;  1SGD I;  1BUS A;  1DS3 I;  1SGP I;  1M8B A;  2V53 A;  1TBQ R;  2N71 A;  2B0U C;  1UUC A;  1BMO A;  2KMR A;  1LR7 A;  2KMO A;  2NU0 I;  2M5X A;  1CT4 I;  1R0R I;  2QQC A;  1M8C A;  3QTL D;  1YTP A;  1FYB A;  1Y1B A;  1MT1 A;  1LR8 A;  2SGF I;  1OMT A;  1UVF A;  1CSO I;  1CE3 A;  2NU2 I;  1SGE I;  1OMU A;  1PCE A;  1DS2 I;  1CGJ I;  1Z7K B;  1HDL A;  1CT2 I;  2KMP A;  1N13 A;  1KMA A;  2ARP F; 
#chains in the Genus database with same CATH topology
 1HJA I;  2OVO A;  3TOA A;  2X52 A;  2FNF X;  1SGN I;  4WP4 A;  3UGL A;  1CHO I;  2NU3 I;  2J87 A;  2SGE I;  2ENZ A;  3TOB A;  9WGA A;  2DIP A;  3KY9 A;  1SGY I;  1OYV I;  1IW4 A;  3B4V C;  2SGQ I;  1CT0 I;  2OZU A;  1MJ9 A;  2RIJ A;  5FUX A;  3UOE A;  2GKV A;  1YU6 C;  1SGR I;  3R5D A;  1OVO A;  3TO9 A;  3TO6 A;  1KBE A;  1R79 A;  3UGD A;  3OL0 A;  2V1C C;  5E3R A;  4FKD A;  1XBT A;  1H0Z A;  1PTQ A;  2F3C I;  5HI7 A;  3R5A A;  2V1C A;  2ORW A;  2N17 A;  1KBF A;  2CWH A;  2ENN A;  5E3P A;  3OVO A;  3SGB I;  1WGT A;  3UEJ A;  3HH2 C;  5FUV A;  4L9M A;  2LUY A;  2KMQ A;  2CWG A;  1Y8F A;  2BUS A;  1LR9 A;  1WTJ A;  2NU1 I;  5JHW C;  1ULN A;  3TJQ A;  3SGQ I;  2ERW A;  2SGP I;  1K7V A;  3SEK C;  1FY7 A;  1TUR A;  1K7T A;  2UZ3 A;  1X74 A;  4UXH A;  5EX3 A;  2VRW B;  2KCX A;  1CGI I;  2QQD A;  2E73 A;  5CCL A;  1MJB A;  1UVG A;  1XA6 A;  2XRC A;  3RU0 A;  5J8C A;  1U5K A;  1TBR R;  1TGS I;  1FAR A;  4OVO A;  1WGC A;  5E3Q A;  1HEV A;  2JYY A;  2GKT I;  2OD1 A;  4B6D A;  1PTR A;  2GIV A;  3GOX A;  2CJS C;  3QAH A;  1PPF I;  2RC4 A;  2WCY A;  3TO7 A;  1IY5 A;  1FAQ A;  2E5R A;  2LEO A;  1IY6 A;  1AN1 I;  3UGI A;  1ULK A;  1MJA A;  3CXL A;  4SGB I;  3OXF A;  1V1I A;  3QWP A;  4A24 A;  2Y0M A;  2P6A C;  1HPT A;  3OXG A;  2WVJ A;  2DKV A;  3VDP A;  4GI3 C;  1TUS A;  2L8E A;  1W3S A;  1Y1C A;  2ELI A;  1Z2I A;  2NU4 I;  3UEY A;  3FSX A;  4E1R A;  4DNC A;  1Q9B A;  1P9G A;  1W4R A;  5DAE A;  1TIH A;  1V1H A;  1XX6 A;  1PJU A;  2GVI A;  1NUB A;  1NXU A;  2JZM A;  2N52 A;  2ODD A;  3E59 A;  7WGA A;  2DB6 A;  2JXD A;  2SGD I;  5CCM A;  1SGQ I;  3E2I A;  2A20 A;  2GKR I;  1TBO A;  2JW6 A;  4HGU A;  2WGC A;  2ROW A;  1SGD I;  1BUS A;  1DS3 I;  1K7U A;  1SGP I;  2L7X A;  3VE5 A;  3VDU A;  1TBN A;  1M8B A;  2V53 A;  2QQ0 A;  2LB7 A;  2YUU A;  5HQ8 A;  1TBQ R;  2N71 A;  2B0U C;  1UUC A;  1S20 A;  1BMO A;  2YQP A;  2K9H A;  1P9Z A;  3BJI A;  2KMR A;  5FUW A;  1LR7 A;  2KMO A;  2NU0 I;  3PDN A;  1WKX A;  4E1P A;  2W0T A;  1TOT A;  2B8T A;  2M5X A;  1CT4 I;  1R0R I;  3FSY A;  2QQC A;  1M8C A;  3QTL D;  1YTP A;  4AML A;  1RFH A;  1FYB A;  4UXJ A;  1Y1B A;  1UHA A;  1MT1 A;  2CWF A;  1LR8 A;  3D00 A;  5EX0 A;  2SGF I;  1VDD A;  2ORV A;  1OMT A;  1UVF A;  3R5B A;  2N1A B;  3R5C A;  4JCV E;  5J8F A;  1CSO I;  1CE3 A;  3MEK A;  2PQ8 A;  5FUY A;  2NU2 I;  1SGE I;  2QPO A;  1OMU A;  3OXL A;  1PCE A;  4UXI A;  1DS2 I;  1CGJ I;  2OU2 A;  2QQE A;  4MPI A;  1X4S A;  1Z7K B;  1HDL A;  2UVO A;  2J9R A;  2JA1 A;  1CT2 I;  2KMP A;  1N13 A;  3FC3 A;  1KMA A;  3UFF A;  1ULM A;  2ARP F;  2X3T A; 
#chains in the Genus database with same CATH homology
 1HJA I;  2OVO A;  2FNF X;  1SGN I;  3UGL A;  1CHO I;  2NU3 I;  2J87 A;  2SGE I;  2ENZ A;  2DIP A;  3KY9 A;  1SGY I;  1OYV I;  1IW4 A;  3B4V C;  2SGQ I;  1CT0 I;  5FUX A;  2GKV A;  1YU6 C;  1SGR I;  1OVO A;  1KBE A;  1R79 A;  3UGD A;  3OL0 A;  2V1C C;  4FKD A;  1XBT A;  1H0Z A;  1PTQ A;  2F3C I;  5HI7 A;  2V1C A;  2ORW A;  2N17 A;  1KBF A;  2ENN A;  3SGB I;  3OVO A;  3UEJ A;  3HH2 C;  5FUV A;  4L9M A;  2LUY A;  2KMQ A;  2NU1 I;  2BUS A;  1Y8F A;  1LR9 A;  5JHW C;  3TJQ A;  3SGQ I;  2ERW A;  2SGP I;  3SEK C;  2UZ3 A;  1TUR A;  5EX3 A;  4UXH A;  1X74 A;  2VRW B;  2KCX A;  1CGI I;  2QQD A;  2E73 A;  1UVG A;  1XA6 A;  2XRC A;  3RU0 A;  1U5K A;  1TBR R;  1TGS I;  1FAR A;  4OVO A;  2JYY A;  2GKT I;  2OD1 A;  4B6D A;  1PTR A;  3GOX A;  2CJS C;  1PPF I;  2WCY A;  1IY5 A;  1FAQ A;  2E5R A;  2LEO A;  1IY6 A;  1AN1 I;  3UGI A;  3CXL A;  4SGB I;  3OXF A;  1V1I A;  3QWP A;  4A24 A;  3OXG A;  2P6A C;  1HPT A;  2WVJ A;  3VDP A;  4GI3 C;  1TUS A;  2L8E A;  1W3S A;  1Y1C A;  2ELI A;  2NU4 I;  3UEY A;  4E1R A;  1W4R A;  5DAE A;  1TIH A;  1V1H A;  1XX6 A;  1PJU A;  2GVI A;  1NUB A;  2JZM A;  2N52 A;  2ODD A;  3E59 A;  2DB6 A;  2JXD A;  2SGD I;  5CCM A;  1SGQ I;  3E2I A;  2A20 A;  2GKR I;  1TBO A;  2JW6 A;  4HGU A;  2ROW A;  1SGD I;  1BUS A;  1DS3 I;  1SGP I;  2L7X A;  3VE5 A;  3VDU A;  1TBN A;  1M8B A;  2V53 A;  2QQ0 A;  5HQ8 A;  2YUU A;  1TBQ R;  2N71 A;  2B0U C;  1UUC A;  2YQP A;  1BMO A;  3BJI A;  2K9H A;  5FUW A;  2KMR A;  1LR7 A;  2KMO A;  2NU0 I;  3PDN A;  4E1P A;  2W0T A;  1TOT A;  2B8T A;  2M5X A;  1CT4 I;  1R0R I;  2QQC A;  1M8C A;  3QTL D;  1YTP A;  1FYB A;  1RFH A;  4UXJ A;  1Y1B A;  1MT1 A;  1LR8 A;  3D00 A;  5EX0 A;  2SGF I;  1VDD A;  2ORV A;  1OMT A;  1UVF A;  4JCV E;  2N1A B;  1CSO I;  1CE3 A;  3MEK A;  5FUY A;  2NU2 I;  1SGE I;  2QPO A;  1OMU A;  3OXL A;  1PCE A;  4UXI A;  1DS2 I;  1CGJ I;  2QQE A;  1X4S A;  1Z7K B;  1HDL A;  2J9R A;  2JA1 A;  1CT2 I;  2KMP A;  1N13 A;  3FC3 A;  1KMA A;  3UFF A;  5CCL A;  2ARP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...