2NU8A

C123at mutant of e. coli succinyl-coa synthetase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNTPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 109
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu8A01
2G76A 4HX5A 5HA5A 3DMYA 4CM9D 5FWNA 4R01A 4H7PA 4CMGA 3IJPA 5FFFA 4IMRA 3RKUA 3ADPA 3GZ4A 1NR1A 3HQ4O 1JLLA 1TT5B 1ENOA 2VNSA 2VYVA 4OKNA 1VJ1A 1WVGA 3E8XA 3VHRA 4NG5A 4WNIA 1JAYA 5ADHA 3DQPA 1RYEA 4BNUA 2PGLA 3ADOA 4BGUA 5C5IA 2OO5A 4L75A 2DM6A 1F06A 4WLEA 1KOLA 1K6XA 5DCYA 5JY6A 4YRAA 2FOIA 1MXHA 4DQUA 2FR0A 3GMSA 3JQFA 3NTOA 3D64A 4MVJP 3FTPA 1ZVMA 4N7RA 2DTXA 4BNGA 1LNQA 1NNUA 3MWDB 1XG5A 1UP7A 5F5NA 4CLOA 2FPGB 4I8XA 3MZ0A 3L6DA 4RDHA 2ILTA 4XYEA 1LDBA 4IDCA 1H2BA 1PQWA 3OH8A 7MDHA 4K6CA 4CMIA 4FW8A 3RQSA 2HMWA 4XCVA 3D5QA 5LCXA 1SZJG 2Z95A 1XA0A 1H6AA 4Y8VA 4XRRA 4WEQA 1ISFA 3V1YA 2B5VA 5KJFA 5JXWA 4NJMB 4BNLA 2VNAA 4XDYA 1HE3A 4L0QA 2GRAA 2NTVA 3OJ0A 4GWGA 1KEVA 1R4NB 2O3RA 2ZCVA 4RGBA 1DBVO 4ALIA 1GUYA 4CQMA 2BI7A 4NMHA 1BXKA 2NV6A 4AJ2A 1TLTA 3GVXA 4OSPA 5HWSA 2DQ4A 2OL4A 4ZA2A 4TWRA 4AJJA 4YB8A 4GLLA 3I9KA 3GDFA 3DMTA 2W2LA 4KDEA 3PHLA 1AUPA 3ZU4A 2CSUA 1FDSA 3AFNA 5ENDA 1A27A 2NTJA 1IZ0A 1LRJA 2V65A 4AG3A 3MEQA 1XLTA 3W6UA 1X0VA 3C24A 3Q3CA 4JK3A 3G3EA 4IPTA 3GZNA 5ER9A 2CDAA 3RUDA 1HRDA 3PRJA 2BGLA 5TT1A 3RFXA 3JQBA 5G2OA 1IE3A 3WGTA 3OECA 5JAMA 3LU1A 4NU5A 4F6LA 4J4TA 1IHXA 3I9LA 2DFVA 3WLFA 3E82A 4R5MA 1Y8QB 5B4TA 1ZMOA 2PV7A 3WGQA 2VTEA 3OM9A 1PS0A 2G82A 2V6MA 3V2UA 2VUTA 2RH8A 1MV8A 4PG4A 3WXBA 4FPXA 2R6JA 5CPFA 2J3HA 5G0VA 3DL2A 4M1QA 3W4KA 3WQQA 4DQVA 4AJPA 1Q1NA 3TSCA 3MJVA 4CMJA 4GH5A 3A4VA 2ZYAA 3NX4A 1I01A 1E3WB 4OXKA 5IN4A 2B4RO 4ZU3A 1C1DA 3QE3A 3X2EA 2EHDA 3C8MA 4EJ0A 2X6TA 1Z82A 3VZRA 3WWZA 3LC7O 3BHJA 1FMCA 4JJFA 3RUEA 4E0BA 4HUJA 4W99A 4CUJA 3ZWWA 3AJRA 4D3DA 9LDTA 4GKBA 1F17A 5IF3A 4FC7A 4ILKA 2X0NA 1EUZA 3ZNNA 1I3NA 3GDGA 1WDKA 2NUAB 4BIIA 1PL8A 2G17A 3S2FA 3IKTA 1ZCJA 2X5JO 3QV1A 1LX6A 4Z0HO 4PLHA 5F1KA 2D3TA 4GSLA 3JQAA 2QW8A 2VHXA 1LLDA 4E31A 2QYTA 3ST7A 1N1GA 1EK6A 4JCOA 4J90A 3MOIA 1PU2A 2OOSA 4ALNA 5MDHA 2Q45A 2CDBA 2W2KA 2ZKLA 4E5NA 4GX2A 2D5AA 4DLLA 3L9WA 2P9CA 4ZICA 2WWRA 2PY6A 2X4GA 1KVSA 3AUTA 4IJUA 4OM8A 5F1OA 5A03A 3IL2A 3GGOA 2DBZA 4YEDA 5IAAA 2NVUB 1EZ4A 5DP1A 1DOHA 3LT1A 3WGOA 1AXEA 2ZB8A 3ROKA 3VVCA 4KP7A 3HDQA 2FRDA 3QWAA 2H63A 3I9MA 1GV1A 3JYNA 3UCEA 1E3SA 1E77A 4IZIA 3UCFA 3DEYX 5B37A 1BMDA 2GSDA 3PYMA 1UH5A 1F8GA 4ZQHA 2Q46A 3QQPA 4BMSA 2PNFA 3B1FA 2X5KO 4INAA 4WLFA 4D46A 3FBGA 2EG9A 3OIFA 4BNVA 3IP3A 2VRCA 2VWQA 3UFXA 1QLJA 1P1HA 2GERA 1HEUA 3EVTA 1WDLA 5DCWA 1PS8A 3O8QB 4MOWA 1OFGA 2QZ9A 3RD5A 3KLPX 4DLAA 3VOSA 4E2WA 3K31A 3GUCA 3JYPA 3WTBA 3ZNQA 1BXGA 1R37A 4DC1A 4IQ0A 4XQ9A 3D3WB 1EUDB 3MJTA 3ETEA 3ZZNA 3AM5A 1S6YA 3E9MA 4JBGA 1JU9A 3NT4A 2HRBA 3LT2A 3DBHB 1NXQA 4M49A 1DC5A 3GQVA 2HU2A 1C1XA 2GN9A 4YCAA 1T1SA 1U28A 1X7DA 2P4HX 3GGPA 2XXJA 1LEHA 3NDIA 5GMOA 3FTNA 3TJRA 3JQBC 3OIDA 4B7XA 2YDYA 4UEOA 3BA1A 3WG9A 1LDEA 2AW5A 4CL8A 4ND2A 3NDJA 4GAEA 5KVQA 4RPGA 3NJ4A 3BMNB 4J16A 5AXAA 2FMUA 1WNTA 1L7EA 1IL0A 4XR4A 1VLLA 4A0SA 4GVXA 4KUGA 4CM1A 1K89A 3G49A 3D5TA 1JKJB 3RFTA 4B4UA 4M8SA 1QLHA 1V35A 2A4KA 2Q4BA 3VKVA 2AQ8A 2W4QA 2Q2WA 3DB2A 2ZTLA 3NKLA 4IJKA 4D45A 3HUDA 5EN4A 2E48A 3U4IA 4XKJA 2YV2A 1IZ9A 1PR3A 2Q49A 1WMBA 2VT2A 2YDXA 5I7EA 2BFAA 3ZV3A 3NV9A 4QFDA 3A28A 1NPDA 4HBGA 5A05A 4PLPA 4Z6KA 2EP7A 2QX7A 2W2LD 3LK7A 3PWZA 4FDAA 4ESOA 5I8ZA 4PVCA 1HDRA 4CLRB 1MP0A 5TX7A 1GY8A 3AK4A 3F9IA 2YQ5A 2HCTA 4EDFA 3A1NA 3ZU2A 2ZB7A 1P0FA 1HLDA 1WLYA 2GN4A 2IZ1A 4WCDA 5JMPA 1XQ6A 4ITUA 1NVGA 2IZ0A 1B0AA 3SC4A 5K9ZA 2BF7A 1EK5A 1I3KA 3JQ9A 1WAMA 3P19A 4K1LA 4XIYA 3WTCA 1Z75A 3ANNA 4OGWA 4CM6A 3VH3A 5KVVA 4IGFA 2B5WA 1P44A 1HYHA 1NQTA 4UEJA 1C0PA 4KUEA 2J3IA 1NPYA 2JFFA 3JQCA 1XHLA 4KDFA 4PGFA 4BNZA 1B8PA 3TZKA 2ZIZA 5JE8A 3P2YA 4CPDA 4U0JA 5I8WA 2QG4A 4FN4A 2V6GA 3AY3A 3L0DA 1PZHA 1I32A 4KWHA 1ULSA 4D43A 4XQEA 3VZPA 2ZATA 1N92A 3IS3A 2I99A 1KIFA 1YL5A 4YT2A 1ZSVA 1E3IA 2I65A 1YXMA 3LT4A 2FY8A 3LC2O 3QP9A 2OUIA 3FF4A 4FOSA 3VZQA 4EW6A 1Y9AA 4GSKA 4II3A 1ZO8A 2EWMA 3N7UA 4A10A 4L4SA 5ICSA 5DZSA 4W4TA 3CUKA 3RBVA 1KETA 3E9QA 4KQWA 2DAPA 1FK8A 3AFMA 3B20A 3JQEA 3JYLA 2DT5A 3AI3A 4WK6A 1T2CA 3C1AA 1HDZA 1NYTA 2HK9A 3W6ZA 3ZI0A 3U3XA 1GZ6A 1W6UA 5KJ1A 3FD8A 1ZSYA 3N58A 4D0SA 3IAHA 4MKRA 3ZV5A 1Q0HA 4C7JA 1B3RA 4FFLA 4CLRA 2Y67A 1Z7BA 2F1KA 2Q1TA 1Q7GA 3EZLA 3PJGA 3QWHA 4E4YA 4NFHA 1K6JA 1A72A 1NWHA 4PZEA 4NZ9A 2PZKA 3H7AA 1E3EA 1LSJA 2JCXA 2CD9A 1I5RA 4YDRA 4IBOA 5BNFA 5L4LA 2XPCA 4M86A 4CODB 3RUIA 1SNYA 4Q9NA 1R16A 1AHHA 4OH1A 3C3XA 3BHIA 2E82A 3HFSA 2GCGA 5CDYA 1LSSA 4MP6A 3PQEA 1HE4A 4RZIA 1SCUA 3F5QA 4EUFA 2CMDA 1YL7A 3Q11A 2VOEA 4IXTA 1DHTA 4K6FA 4PLTA 3H9QA 4MP3A 1OC4A 1JKJA 3F46A 4I5DA 4PG6A 3ZNOA 1I33A 3Q2IA 1CWUA 2X8LA 4DWVA 1BHSA 3EY4A 1TVEA 1YDWA 3TL3A 1ML3A 4RO0A 4J7UA 4Q3BA 4XGKA 3M1AA 4WOJA 4CM8B 1OAAA 2I3GA 3DZBA 4L74A 1YWGO 1ZW1A 1WPQA 1T24A 5KNLA 4IDBA 2YYYA 5H83A 4Q3AA 2AMFA 4XDZA 3TNLA 3T7EA 5HTOA 3MTJA 3PJFA 2HMUA 3ABIA 3CKYA 3TL2A 1IYZA 5A04A 1GPJA 1AXGA 1SAYA 3C7AA 1E1LA 1B15A 4D44A 3ZHBA 1QV6A 2G0TA 5KKCA 1X13A 1LBEA 1PWXA 2CFCA 1K6IA 3BXXA 3D0OA 4NI5A 3K96A 4BKRA 2OFPA 5HS6A 3HADA 3SEFA 4E32A 4AJOA 4F6CA 4DIBA 4YVFA 1JDJA 1O95A 1E6UA 2BFMA 2IZZA 3FPCA 2X1HA 1UP4A 2B83A 1JVSA 1UXHA 2CDCA 2Y66A 3AOGA 3CPSA 4TRJA 4ALLA 4MIEA 2HMVA 4UUPA 3ANLA 2P68A 3U4CA 3D4NA 3R0IA 3GNTA 1FDVA 4AICA 3PEFA 1D1SA 3KUXA 4OJNA 3VVBA 3HNPA 4ALKA 1GUFA 1E5LA 1EEHA 3AU8A 5U1PA 3UCXA 4PLFA 4YPOA 2O3UA 2Q99A 2PZLA 1DFHA 3OMLA 2CVOA 3WNQA 3AUSA 2ZTVA 2GGSA 1LRLA 3LF2A 4Z0TA 4XQGA 2QZZA 4RLHA 3WLEA 1XELA 4WUVA 5L9AA 3FPLA 4XGNA 1HDXA 3QRWA 4RLSA 5A3JA 5KOIA 4CUZA 3QVXA 5ITVA 4PZCA 4OMUA 4PG7A 5JSFA 3U09A 1NASA 2P5UA 1DXYA 1DRWA 4OL9A 4OSOA 4WKGA 4E3ZA 4BQPA 1GTMA 1TB4A 2HQ1A 2D4AA 2P2SA 1UXKA 3JQ8B 4CM4A 5CEEA 4BB5A 3LZ6A 1W4ZA 3L9XA 3CIFA 3BTSA 5T8KA 2D0IA 5GY7A 4TRRA 2HMTA 4BNFA 2J8ZA 4CLDA 1SB8A 2UDPA 4ZQBA 2VYVD 3B6ZA 4IM7A 4NFYA 2GDZA 1SOWA 2GD1O 3IMFA 3GAZA 3PTZA 2GASA 3ZGYA 5IJZA 3WX0A 1MXFA 2GZ3A 1XGKA 2PZJA 4HV4A 4OOFA 4NBWA 3I52A 3TOZA 2E49A 4BNJA 2C59A 1UUFA 3BMCB 4PLYA 4Q3NA 3OF2A 1W8DA 2VWPA 2ZJ1A 1J6UA 1DLIA 4WASA 5EPOA 3GVPA 1X7HA 3GAFA 3KYDA 1B7GO 3MJEA 4DPLA 4NIMA 2BLLA 3IUSA 3ANMA 4B3JA 1NTOA 1XKQA 2OBYA 3PK0A 4IY1A 4M54A 4D3SA 1HWYA 1UXIA 4KWIA 3BHMA 1M75A 2QRKA 2XAAA 4YJFA 3JQ9C 1KC3A 3WIDA 3H2ZA 3ZWBA 4PLCA 2YY7A 2JCYA 1HXHA 3JD4A 9LDBA 3WGZA 4GLOA 4R41A 1RPNA 4JN6B 2NU7A 2GUGA 3WR5A 4MVJG 1EVIA 5FI3A 4I5GA 1A4IA 5HS4A 2X86A 2W98A 1MC5A 3KYDB 4OXYA 1HETA 3FCOA 5H82A 2WD7B 4MVJI 4Y9DA 5B4UA 2GO1A 3BMCA 1X1TA 3KSZO 2AG5A 3JQGB 2UUPA 1UZMA 4E21A 4IUYA 4PRKA 3PQDA 2BGKA 1R15A 3CINA 5JC1A 4DPKA 1PJTA 2OZPA 4C7KA 3VDQA 5IZCA 2VHWA 4R9RA 2ZB4A 1E1KA 2ZCUA 1BVRA 3IOYA 5CDTA 3JD2A 1LC3A 4LK3A 1R12A 3RFVA 4LSWA 4CR8A 4IJWA 1R4NA 4GPD1 3ASUA 4CQMB 2EP5A 3E03A 4W7HA 2HAEA 1H94A 4Z9YA 4BV8A 1ZXLA 3PYXA 4EGFA 5K6AA 4WLUA 1ZKMA 3RUCA 4DREA 8ADHA 5JDIC 3FSRA 4CQLA 4TRMA 4CM4B 4P4NA 4MVJA 2WYWA 3UGKA 3GVHA 4L73A 4BMNA 3MJ4A 4MVJH 4HKTA 4IJVA 1YQXA 2EERA 4YJHA 1B16A 3I23A 3PXXA 2Y1GA 3DOJA 1HZZA 3ETDA 5DP2A 5FEUA 5JYEA 2FPGA 5L4SA 4D42A 4RPJA 4CLOB 3FWZA 3PZBA 3DHEA 4R68A 1PQUA 2D5CA 1ID1A 2LDXA 1YO6A 4N5NA 3ZNPA 3G0OA 1U4OA 2FPIA 5ILGA 4UAGA 4U5QA 5EQFA 4DRYA 4X54A 2J3KA 2DVMA 1A4UA 1D4FA 5FYDA 1KVUA 3AOEC 1O6ZA 4FIZA 5G4KA 1LDMA 1Y5MA 2HLPA 5EL0A 1SMKA 2EJVA 4CL3A 5L51A 3S1LA 3ZWOA 3ZU5A 1EQUA 1ENYA 1J0XO 1GAEO 4BUCA 3IP1A 1XCBA 3RWBA 2R00C 2NQ8A 3DZHA 4DIOA 2PKQO 2EV9A 4WECA 4AJ4A 5G0TA 4EJ6A 1QSGA 4M89A 4R5HA 2Q4EA 2VYND 1SEPA 2VRBA 1MG0A 4N5MA 3WNVA 4RVHA 3I3OA 1ZEJA 4CMKA 2HO5A 4E5MA 5L95A 4QFCA 3ZN2A 3L4BA 3INGA 3QVWA 4Y6RA 3W8FA 4IS3A 4OYRA 2GN6A 2NACA 5L7YA 5BSHA 2EF1A 3LC1O 3AWDA 1HT0A 4KZPA 2B37A 1LXCA 4MP8A 1YDEA 2OBNA 1C0KA 3KSDO 2DFDA 2JCVA 3EVNA 3K30A 4KUHA 3N74A 4XR9A 3D3EA 3GRKA 3KYCB 1VL6A 4BO5A 4Y6PA 2NM0A 4LRSB 3H3FA 1EBFA 3VH2A 2O2SA 4YACA 4WLVA 1U4SA 4EEXA 5JS6A 1ADGA 3DAPA 5L3ZA 3TZHA 4YAKA 3V1UA 2VYNA 1T2DA 1U1IA 3HDHA 2PK3A 1V3TA 4J9VA 5G4KB 1ARZA 1Y8RA 2IEBA 2VQ3A 2RCYA 2O50A 1K2WA 1T1RA 3VPXA 5COQA 3B1KA 3OQBA 4BMVA 1PJSA 2G5CA 3M2PA 3QWFA 3QSGA 2BMAA 3WQRA 1DC6A 1BDBA 2FR1A 3ZDFA 1GZ4A 1OOEA 3HJAA 4U0KA 2NU8B 3T7CA 5JMWA 1CQJB 1VJTA 1ZXBA 3GN1A 3GC6A 4GMGA 4YJHB 1A9ZA 3FNGA 1BRMA 1KERA 2IEDA 3WYBA 4RVFA 3WSWA 4LVCA 1DIGA 5JDCC 1GQ2A 3FHLA 5G0SA 3WOHA 4HY3A 1YL6A 4CQLB 1DEHA 1DC4A 1PGNA 1C3VA 4RVGA 4YA6A 1A7AA 1GYRA 3KV3O 1LI4A 3RUFA 1GPDG 1JA9A 2AE2A 2A9FA 3D4OA 1V9LA 3DR3A 4QSMA 3X2FA 2NADA 3PZRA 1TA4A 1C0LA 2QRLA 2B36A 2DPHA 4ZHSA 4TMFA 4Z3DA 3OBBA 1MFPA 1T4BA 3GVCA 5G0WA 4DIFA 1LJ8A 3CZMA 3K9QO 3TZ6A 1UJMA 4DA9A 4EBFA 2D1YA 2O4CA 3R6DA 1DIBA 1HDOA 2BD0A 3JQGA 1GYPA 4MPDA 3ZWYA 4BS9A 4E30A 2V6FA 3TRIA 1XU7A 3RUHA 1E3LA 1PR9A 1ZMTA 4FSHA 4CQMD 2C20A 2PGDA 4II2A 2FSVA 3M1LA 1GZ3A 2X58A 4P8RA 3U4HA 4B8WA 4NQZA 2NU7B 1T25A 1X1EA 5CAEA 2E6UX 3GHHA 4M55A 5F3RA 5GZ6A 1CIVA 3KLMX 1ISJA 1KEPA 3OETA 3HG7A 2IXAA 3GNQA 3DMTC 1B14A 1E7WA 3VDRA 1GEGA 1G0NA 1DRUA 4YJFB 4RJTA 2AQIA 2BELA 3NYWA 5EQDA 4EUHA 3U62A 2JFGA 1O0SA 1V3UA 1SO8A 3KVOA 3LYLA 4JJGA 3C7DB 4QX6A 3GR6A 4UEKA 1XWFA 3LVFO 4ID9A 3RAJA 1H0KA 3RC2A 3INRA 4GQAA 4B8ZA 5IN5A 5AXDA 5H81A 4GGOA 3RIHA 1UDCA 3SXPA 2IODA 4E13A 3RCBA 3MWEB 5KJ6A 4GWKA 5TQVA 1VE9A 3CXRA 4J7XA 4U6QA 4R1UA 2JHFA 2IYPA 3DBLB 3RC9A 2CF5A 3KEOA 4E33A 4FC6A 3KETA 1YGYA 2Y0DA 3RJ5A 5TLSA 5AQ1A 3T4XA 1J4AA 4HADA 2HK7A 3WBBA 3TDKA 3OFSA 3UKOA 2BRUA 4RF4A 2QQ5A 2YV3A 4ZQEA 4BNMA 4KOAA 4BB6A 4N54A 4JXKA 2H9IA 3Q9NA 4LMRA 2HRZA 1P31A 5C7IO 1EDZA 4J1SA 1PSDA 2OXIA 4DPMA 4YTEA 3JQ8A 2CNBA 3GOHA 1HYGA 3QY9A 3LDHA 2OP1A 3ZWAA 1E1MA 3CMCO 5ILOA 1SB9A 1E6WA 2Y1DA 5HRUA 3OHSX 1GL3A 3H9JA 1G1AA 3BTUA 5A3VA 4B4VA 1RM0A 3H6KA 1GEEA 1D7OA 2VHVA 4J9UE 3QW2A 2C54A 4DL9A 5BNTA 2Q3EA 1KVTA 3IQDB 2HJRA 2WTBA 4R54A 3RU7A 5HM8A 4CMHA 1Y6JA 1QV7A 1FXSA 4DQXA 3GNSA 3DTYA 4FFOA 4B79A 2XF8A 4CV3A 3ZWCA 1Q0LA 5AVOA 4JJIA 3ZH2A 5JDCA 1JWAB 3D4PA 2D2IA 3INTA 2V7PA 2X9NA 3AM3A 3G17A 4Z3KA 3BMNA 3PVZA 3TWOA 4CV2A 4HFJA 4Q3EA 1HDYA 1U3VA 1YOVA 1G6KA 3GDOA 1SOVA 3RKRA 3CMMA 2V6BA 1DB3A 3KXDA 4R4JA 3M2TA 2BFPA 4DUPA 1SPXA 4W9NA 3L77A 3S55A 4QUKA 2NU6B 1PJQA 5CDUA 4RV9A 3AU9A 3AY7A 3H5AA 4RQUA 4TKMA 3DBHA 1GUZA 1BGVA 2WSBA 4BVAA 3PLNA 3U0BA 4TROA 2I76A 4OO3A 3DZJA 1K0UA 2GNAA 3OSUA 4CMAA 2RBEA 3D3WA 3CE6A 4OHUA 4TQGA 4F46A 3Q1LA 2VRCD 2E4AA 3QVSA 1DIRA 4NDNE 1UP6A 4E2ZA 3K5PA 1GU7A 3QLJA 2VOJA 1R4MA 2NU6A 3UUWA 4W7IA 1CRWG 1ZBQA 4I9HA 4HXYA 1DIAA 1X15A 4Q39A 2RHRA 4Y6SA 3FR8A 1ZSNA 1H2HA 4J6FA 1ZK0A 3UFXB 4OIMA 3DONA 4IMPA 1NVTA 3WYEA 1YBMA 4NU6A 1IPEA 4D79A 4Q3DA 4UUMA 3WYCA 4CM8A 1HSOA 2NVWA 4XEHA 1MX3A 1FDUA 1UAGA 1H9BA 2LDBA 4QO7A 1FF9A 1KY4A 3VPFA 3SX2A 3WSVA 3TFOA 3JV7A 4QT0A 1NFQA 2R00A 3FR7A 1YE3A 1SCUB 4XJTA 4IDAA 4R69A 4WE3A 4CMBA 5DT9A 2W2KB 4A27A 4FFNA 4Y98A 3LLSA 4RORA 1VC2A 3GGGA 2VUSA 1M2WA 3PHHA 2C82A 3F6YA 3UXYA 2HSDA 1U5CA 3DZFA 5TGDA 1QR6A 2C0CA 2C2XA 3RC1A 3JQ6A 5J23A 5CEJA 4CM9A 2WD8A 4JNKA 5L4NA 2VHYA 4W6ZA 4O5OA 4WCFC 5A02A 2DPGA 4GKVA 3DBVO 1M67A 1U8FO 3ZV6A 3HFGA 2Y99A 5TRTA 3ZHZA 2E37A 1LLQA 3VTFA 3UW3A 1PZEA 4ND4A 2EGHA 3A9WA 1V0JA 4BKQA 4FFPA 2O3QA 3F4BA 4B7UA 2W8ZA 1EMDA 5JAQA 2BI8A 3KB6A 1CDOA 2ZQYA 3DBLA 1YBVA 2DBQA 2FZEA 1N5DA 1U9JA 3GN2A 4J2OA 4OAQA 3AW9A 3WICA 1YQGA 2Y68A 5K6AC 1B8VA 4DBZA 4J2HA 3ICCA 4E2XA 4N5LA 1UXJA 1I2ZA 3K2EA 3MJSA 3OQ1A 1JW9B 5DBIA 3U5TA 1ZH8A 3PQFA 1LUAA 1W73A 3RROA 5I7VA 1MB4A 3NTQA 2VT3A 3L07A 3NAQA 3ZV4A 4BO2A 1Z7EA 3EHEA 5T6BA 2CZCA 3HE3A 3DHNA 5A5EA 4XQCA 3ZHYA 1PEDA 4BNWA 5A9TA 2Z1NA 1WXDA 1ISGA 4FD3A 4J4BA 3E5MA 5A5FA 4EI2A 4BHTA 2YUTA 3PJEA 1LSUA 3PDJA 4FJ1A 1M76A 1I36A 1H5QA 1PIWA 4BNXA 1HTBA 3DFUA 3ZW8A 3ONEA 4Y67A 3AUAA 1DRVA 5B1YA 5CAEB 4ZN6A 2EKLA 5IDYA 1NHWA 1HDCA 1LQUA 1TT7A 3DZIA 2EW8A 3SLKA 1EQ2A 3OJOA 3QA9A 3RC7A 5G4LA 2H6EA 2EGGA 1GADO 1P45A 3VPHA 4YR9A 3ON5A 3R1IA 3I5MA 2PH3A 2C5EA 3TOXA 1H9AA 1X7GA 2I3AA 3ROMA 3P2OA 3GLQA 4URFA 4XA8A 1WDMA 1GCOA 5B4VA 5DBFA 1QORA 3O26A 4FB5A 1L7DA 1E7RA 4RF2A 2FN7A 3GF4A 1LDGA 1P1JA 4MDHA 3MTGA 1ENZA 4AJHA 2GF2A 1RWBA 4RDIA 3E18A 4K9DA 4RVUA 2PZMA 5JO0A 3IIEA 4R51A 4NJMA 3O38A 5C37A 1PGJA 4FQ8A 3H5NA 2Y0EA 3BMOB 2VN8A 3S2IA 2P9EA 4GBJA 3E9NA 3GEGA 2Q1WA 1T2FA 4HFMA 3VTZA 4CMEC 3SVTA 1SC6A 5CG2A 3O4RA 5BSFA 4CMIB 3ICPA 5GZ3A 3EGOA 4EUEA 2X0JA 2C7GA 1Q0QA 2NU8A 3PWKA 4B7CA 4WJZA 1D8AA 3Q6IA 4YXFA 3CH6A 5TC4A 3BZUA 1D3AA 2ZB3A 3CSDA 4GMFA 5EJ2A 4BKOA 2AA3A 4N18A 1K3TA 1PX0A 4I5EA 1ENPA 4PRLA 1GFSA 1ZJYA 1E6EA 3DOCA 4IQ8A 1PZFA 2O7SA 1Y8RB 1PZGA 1ZK4A 4E5YA 4O0LA 3WDSA 1N9GA 4CV0A 3LSYA 1KVRA 1JLLB 1TT5A 2RH4A 4F3YA 4PIVA 3WMXA 3WS7A 1I0ZA 6ADHA 1ADCA 3PIDA 1C14A 5U9CA 1O5IA 4OQYA 1OC2A 1R0SA 3GG2A 3LLVA 1D1TA 3CTMA 1U2GA 5A9RA 1AHIA 4PG5A 5FF9A 2AQKA 3IJRA 3BIOA 1A7KA 1GDHA 1C1XB 3DTTA 4CM3A 3MOGA 3PP8A 2ZK7A 5JNLA 2IYOA 3ORFA 1DAPA 3GA0A 4ONEA 2ZYGA 3I9NA 4LCJA 4ZJUA 5IDXA 3QJ5A 2ZTMA 4O59O 3KSUA 3DFZA 1KEWA 4Z9FA 4AJNA 1EUDA 4L9RA 1E1NA 3JQAD 4G2NA 2VUUA 4I9NA 4I9UA 3KBOA 2AG8A 1I2BA 1F0YA 1P1RA 2D8AA 1HDGO 1EVZA 3GHYA 1P1IA 4XJSA 4E12A 2Y0CA 4ND5A 1I2CA 1Y81A 2PD4A 1PL6A 3G1UA 1NAIA 4J43A 1ZK3A 3DC2A 3NGXA 4BO6A 2CY0A 1OMOA 4YBZA 4ROSA 3WGIA 5JY1A 1QRRA 3PYLA 5JCJA 1W0CA 3OJFA 2NWQA 3W4IA 3Q2KA 3P7MA 5COAA 1RJWA 5L53A 5I9NA 4B4OA 3EZYA 4YRDA 4J1TA 1NQOA 2NNLD 3GFGA 1JVBA 2BGMA 1EVJA 4RQTA 3W1VA 4A5OA 3SLGA 5A9SB 3K2BA 1R0LA 1MC4A 2NVUA 4BV9A 2FPIB 3H3JA 3BYZA 3DOOA 1YB4A 3OQ6A 4L8VA 3GRPA 4XX0B 1UZLA 2P9GA 2RIRA 4OQZA 4YAEA 2A35A 5THQA 5EESA 3STHA 1IB6A 4R1TA 2CUKA 3ZCXA 3UAGA 5B12A 3GEDA 4XWYA 3WB9A 4DBVO 4R1SA 4A7PA 1WP4A 3GMDA 4DC0A 1UDBA 1I8TA 2IXBA 1LDYA 5JAZA 4LCEA 2CVZA 1EDOA 4HFNA 3JQDA 4K28A 2WYVA 3ENKA 4WCFA 1NFFA 2AXQA 1H6BA 1PGPA 3OEYA 3HB5X 1LQTA 4RPKA 2NUAA 1C0IA 1QMGA 5T67A 5AXBA 2VZ9A 5KWEA 3QVTA 1I10A 1ONOA 2AHRA 5A4DA 4YJDA 1MLDA 2WEKA 4EJMA 1G0OA 3P5SA 1GCUA 3SC6A 3GG9A 1XU9A 5TT0A 3JYQA 2GZ1A 3UH1A 1PJ2A 4LISA 4OOEA 4FJ2A 1T2AA 3PGXA 3KRTA 4MKZA 3I9OA 4IQGA 2J5QA 4LW8A 4ND1A 1C1DB 3VAZA 4YYZA 1E3WA 1U3UA 4GX0A 4BGIA 1T2EA 1MFZA 3PFFA 3MCVA 3RBXA 4A73A 1XDWA 4BO3A 3GY0A 1E92A 2P4QA 2WD7A 4FFRA 4RPHA 2I6TA 1PJ4A 1KYQA 3TF5A 4BKPA 1NPTO 4B3HA 5JAIA 1WZEA 4AJIA 1R66A 5ES3A 2HK8A 5AOVA 3U49A 1Y8QA 1HE5A 4IINA 3VKUA 3ITKA 1LLUA 4XRGA 1NX6A 3GUYA 1Q2XA 3L6OO 1O9BA 3TQHA 4EYEA 3KTDA 1CQIB 4QXMA 3KEQA 2Z5LA 1JN0A 4BNKA 4XYLA 1MGOA 4I1IA 2Y05A 4WGGA 3OP4A 4CUKA 2JAPA 3Q0EA 1RYDA 4XYGA 3JD0A 3WGYA 2C2YA 1PGQA 3ETGA 1PTJA 1P1FA 4GVLA 1RM5A 3ULKA 2O4UX 2XOXA 1DSSG 4KTTE 1XR3A 3L6EA 4MVJE 3EW7A 5JYDA 4CJXA 3LT0A 4XD2A 2VWHA 1DIHA 1Q7BA 2WJPA 2ET6A 1SBYA 4PLZA 4W9NC 2O3TA 4G81A 2OGUA 4QQRA 1YRLA 4C4OA 1BVUA 5LC1A 4U6SA 3NDRA 1QG6A 4DVJA 1F12A 4WPGA 1U3WA 2D59A 4J1NA 3ZU3A 2AEFA 4NBTA 3L4SO 5IFLA 3CEAA 1ISMA 4CR6A 4JLWA 2HKIA 3H8VA 1NR7A 1YB5A 5KVCA 5L40A 1WZIA 2FP4A 3ONFA 4NBVA 5KJCA 4J0FA 1HE2A 5KIAA 4IZHA 2FHSA 1PGOA 2UV8A 4PZDA 4R16A 3WGGA 3VH4A 1I30A 1ISHA 4GX1A 1LC0A 1ZZEA 4L76A 4FOOA 1VSVA 3OIGA 2I66A 4FS3A 2WMDA 1BWSA 1EVYA 2F00A 3MJCA 3T4EA 5C7OO 2O3SA 3MWDA 4H3VA 1IOLA 4XX0A 1M66A 2JHGA 5I9MA 3F4LA 1B3BA 4GX5A 4QTZA 2GPTA 2X22A 5K0ZA 1YONA 2HMSA 1Y5RA 4U7WA 1E7YA 4UVEA 2EJWA 4RCVA 1BSVA 4RZHA 2WE8A 3PDUA 3VZSA 3E6AA 5DULA 3BAZA 5JLAA 1BDMA 1U7HA 5TJ9A 4YT4A 2I67A 4HNGA 1VKNA 2PR2A 2ZJ0A 5ICMA 2AEJA 2SCUB 1B26A 2PLAA 3KO8A 5JFOA 2DTEA 1TI7A 4J49A 3V2HA 4S3MA 3RU9A 5EERA 3NJ8A 4WEOA 2Y1CA 4UVHA 1HL3A 5IXSA 2EW2A 3WWYA 2Y1EA 3RI3A 5L7TA 1J49A 2HUNA 4B4WA 5ER6A 5I7SA 1FJHA 2QHXA 8LDHA 2UUOA 1YJQA 1ONPA 4JROA 4NK4A 2Z1MA 1QYVA 1EE9A 3BMQA 1VRWA 1P1KA 2PA3A 3A06A 4DXHA 4IGEA 2XXBA 1VM6A 4MVJF 3OA0A 5COBA 5JO9A 3GEMA 4G65A 2NU9B 3UHAA 4GGPA 2HDHA 2PD3A 1UR5A 4TKLA 1PJBA 3Q9UA 4LSMA 3RASA 3WJAA 4AJKA 2B0JA 1CEQA 4A26A 2VCYA 3D1LA 2WE7A 3E48A 4CM5A 4BNYA 1P0CA 2JL1A 1EUCA 2CVQA 3KZVA 2NQTA 2J6IA 4YJGA 4UVGA 1RM3A 3W8EA 4HNHA 2IDZA 2J3JA 3ROQA 4BGVA 4PFJA 1LU9A 2C7VA 3HN7A 4F45A 3AY6A 4TSKA 2NVBA 2O48X 4G5HA 4ALJA 4QEDA 2BKAA 2C07A 4FGSA 4PG8A 4QECA 3NT2A 2PGJA 3FN4A 1N9GB 2P5YA 4K26A 1GYQA 1V3VA 1H93A 2JKVA 2UVDA 4L4RA 1QYXA 1CJCA 4BL5A 3UVEA 4NFSA 3ITDA 4D7AA 2W90A 3H9GA 4AJEA 5MGBA 2I9PA 2QRJA 3M6IA 1HLPA 2OMEA 2YW9A 4H16A 2Q2QA 1NQ5A 3I6IA 4WLNA 5EMHA 4UVDA 2DBVO 1DO8A 2IE0A 4NHEA 3PHJA 4I08A 1CF2O 1ORRA 3IDSA 3WBFA 3SJUA 3NGLA 5IXYA 4XB2A 3JSAA 4XGIA 4L4XA 1LA2A 1MG5A 3RSHA 1ADFA 5I9LA 3JD3A 3K73O 1N2SA 2B4TO 4J0EA 4BNIA 4BNHA 5IDQA 3C1OA 3BMOA 3UN1A 5TSDA 2VZ0A 4BOYA 3NTRA 1YB1A 4UUOA 6LDHA 2JD1A 3OA2A 3GPIA 5FI5A 1PJLA 1YBAA 3WMWA 3DO5A 5KKAA 3V2GA 5TIIA 1OZAA 1PJ3A 1ZEMA 4JQCA 2HJSA 4S1VA 4RVSA 5DF1A 5IG2A 4AVYA 4ND3A 4D3FA 2Q2VA 2Q1UA 3PGJA 3V8BA 4P4GA 5BSEA 1KS9A 1LRKA 3F5SA 4ZRMA 4Z0PA 1E7MA 3RBZA 3H65A 5CHEA 3VPGA 1YS4A 3HHPA 1HSZA 1LLCA 4WOKA 4XIJA 1B8UA 3OICA 2DTDA 3L4BC 2J5RA 1BW9A 3ZWXA 4B3IA 1GQYA 5IDWA 1N7HA 3ZW9A 3HDYA 5BNIA 3JD1A 3A14A 2PKRA 4TVBA 5C3MA 2DLDA 4LRTB 3QVOA 4P22A 3DAFA 4YAIA 3ZWMA 1VL0A 1ZK2A 2R2GA 2BFOA 2DU8A 4AFNA 3DXFA 2Q50A 3ROPA 4HP8A 5T57A 3KOUA 2A94A 5JW6A 1H6DA 3AUUA 1HKUA 2X7HA 4CMCA 3EAGA 4JIGA 4JP3A 4U8GA 2A92A 4BO8A 1E0DA 1Z73A 2C5AA 3I1JA 1NQAO 2VZ8A 1N8KA 3R3JA 1BG6A 1NHGA 5THKA 3JYOA 1X0XA 4H15A 1P74A 4BO4A 3PLRA 3O03A 1VL8A 1H6CA 3O9ZA 2PD6A 1NBOA 1P33A 3DBRB 2YHUA 1L1FA 4NNJA 1GD1O 3H9EO 4LN1A 2YV1A 4BO1A 1A9YA 1YH3A 5KTKA 3S2GA 3RUAA 1AE1A 2O7QA 3G1TA 4E5PA 1WMAA 5TJHA 1ZK1A 5DOZA 5T5QA 1PL7A 5BQFA 1DJQA 2TMGA 2H1SA 4TZKA 3GT0A 2DC1A 4BNNA 1BXZA 4RF3A 3V5NA 5ENVA 3AOEA 4YAJA 4KQXA 3U4DA 3U9LA 1T26A 2DUUA 4BO0A 2O2YA 2PWZA 3HN2A 1GQQA 4J91A 4P38A 1IPFA 1KVQA 2EEZA 1CERA 1P9LA 2AE1A 3R3SA 1OI7A 1QKIA 4MIYA 3F1LA 4MKXA 1DHRA 5BSGA 4YQZA 1JAXA 7ADHA 1WWKA 2FWMX 4YT5A 3TN7A 3I83A 3E5RA 1NM5A 3NEPX 2UYYA 4XYBA 2GN8A 4DMMA 3FNEA 1I24A 1K5HA 3JQ7B 1IULA 5JDIA 1VPDA 4W82A 2FPPA 2YZ7A 4PN3A 1XIVA 4GI2A 4A03A 3CZRA 4JP2A 3JCZA 4R3WA 2X9VA 3HZZA 2AQHA 4J3FA 4HWKA 4EITA 2J5KA 1I3MA 1P77A 4UREA 4ZRNA 3WIEA 1YJ8A 3QWBA 4ZQGA 5CEFA 2YJZA 2JAHA 3GVIA 4PLWA 1ADBA 1BTOA 4FR5A 2GR9A 5IZCC 3OJEA 3JQFC 3NUGA 4E5KA 5A06A 4E6PA 4YJGB 2WDZA 1R4MB 1EUCB 3KM0A 1R6DA 5C7LO 5F1PA 1VSUA 3UOGA 1GR0A 4JBHA 5IZ4A 1OBFO 4O6VA 2YHIB 5CP8A 3HWRA 4JGBA 4MINA 4R3NA 2YHIA 1U7TA 5ITWA 1IUKA 1BXGB 3H4VA 4AJ1A 1JQBA 1KY5A 3V1TC 1EE2A 1KBZA 4ZQFA 2O23A 3QIVA 4WLOA 4NBRA 3S8MA 4MIOA 4O1MA 3VH1A 3O8QA 4FFMA 1NAHA 3HB4X 3OEWA 1QXSA 3SJ7A 3H2SA 2QYSA 3PI7A 5F5LA 4D41A 1VI2A 3D7LA 5CPBA 2GZ2A 1PJCA 2RAFA 4PCVA 1UAYA 1AN9A 1E7QA 2SCUA 1M6WA 1YOVB 1A71A 2PFGA 4GL4A 3WQSB 2GLXA 3TZCA 2X23A 3QHAA 2GYYA 3PWSA 1QP8A 4CLEA 5JC8A 3W8DA 2QIOA 1NWCA 5JCXA 4NJOA 4CMEA 2FPPB 3HSKA 4YT8A 1VJ0A 4DYVA 1TEHA 3H5RA 4TVOA 1S7CA 3JQ7A 1PS9A 3OJLA 2ZYDA 2NSDA 3IC5A 3GH3A 1LTHR 3AM4A 5JPIA 4WNCA 1Z45A 4Z9XA 3ENNA 4EEZA 1ZFNA 2YFHA 4TRNA 1UXGA 1J5PA 1NFRA 1R0KA 3C85A 3KHUA 4FBGA 5BT9A 4RPLA 2G1UA 1U8XX 4BNTA 4IDDA 1DC3A 4RF5A 4ALMA 3LQFA 1N1EA 3FI9A 4J7CA 1XSEA 3RVDA 5L45A 4YQYA 1EBUA 1V6AA 3FBTA 5I7FA 3VPSA 3WFJA 1UZNA 3JQAB 1PWZA 1GV0A 5EIOA 1YVEI 1ONNA 2CF6A 4UVIA 5T8KC 1IHYA 2X9GA 2UAGA 3K8ZA 2FP4B 1DAOA 4IDEA 4LMPA 5CFZA 1DLJA 3ASVA 1O94A 2VWGA 4DYDA 3GFBA 4RL6A 3W4JA 5CDGA 3G79A 5LDGA 3VC7A 2YQ4A 4BKUA 1A5ZA 2Y1FA 1HZJA 4D0RA 1YQDA 2ZQZA 4IIUA 1XQ1A 3ZHXA 3DBRA 5TF4A 1ZIDA 2NLOA 4CLHA 4YRBA 1ISIA 3MWEA 1XYGA 4M87A 3JTMA 4MO2A 4AL4A 1F14A 1NVMB 5T64A 1KEUA 2TMDA 4FJ0A 1CYDA 1HF3A 4ZGWA 3IKVA 4PLGA 1LSOA 4BQRA 5G0UA 3DHYA 3NT5A 2B35A 4IS2A 5EINA 2FR8A 1VKOA 5HBRA 3DWFA 1WW8A 2DKNA 3C1TA 3FNHA 4YAGA 4MJLA 2NTNA 3AI2A 1E3JA 5DN9A 1CQIA 1MUUA 3TZQA 3WGHA 5DBGA 3PJDA 5KVSA 4CR7A 1ZUD1 4KMSA 3PFWO 4O63O 2VTDA 3GZNB 1BW9B 1JTVA 1T4DA 2JD2A 3WFIA 1MA0A 4EZBA 4I5FA 2FSSA 3PHIA 2X0IA 4P4LA 4HFRA 2X5OA 4TZTA 1Q7CA 5AYVA 3ZWVA 3EYWA 1U3TA 1X14A 5DDIP 5TS3A 4MVJD 5DOVA 1DFGA 2B4QA 3PIIA 5KJEA 4NR0A 4BO9A 5JBIA 2Y93A 1KC1A 2ZTUA 4NH4A 5CG1A 1LDNA 2Q1SA 3K6JA 4AJLA 2OHXA 2PTGA 1RM4A 1B2LA 4LVUA 4J4HA 3GK3A 3S2EA 4FCCA 4KTVE 2H5LA 3I9JA 4IDFA 4Q3CA 1DJNA 2EIHA 3ONDA 5GZ1A 1O89A 5CDSA 1IY8A 3DZKA 3EMKA 3SBOA 5JCJD 4A2CA 5L7WA 2IRWA 2Y1OA 2EKQA 2I5PO 3QWIA 4DLBA 2JJYA 1XEAA 1DDOA 4WCFB 3I6QA 4LGVA 4CV1A 4ZD6A 1U2DA 2POQX 2BH9A 1V8BA 4XB1A 1E7SA 1JKIA 3EK2A 4YWJA 4PVDA 2YFQA 3IUPA 4NK5A 5DCUA 5TNXA 2OP0A 1CQJA 1QYCA 1Z6ZA 1YKFA 3EC7A 3ZWNA 1DPGA 1EFKA 1FDTA 3C7CB 1TXGA 1FDWA 1RKXA 3B1JA 4OKIA 5F21A 1ZJZA 1QYWA 1ULUA 4RVDA 4FGWA 4R9SA 1CETA 3TFQA 1AGNA 2WYUA 3DDNA 3AI1A 2AEMA 5DNAA 4PLVA 3UICA 5A9SA 3I4CA 2PH5A 4QO8A 2C29D 5AXCA 1Z74A 3BTOA 1DFIA 3COSA 4CLXA 4MVJM 2JFHA 3H9UA 2DUWA 3E1KA 2JD0A 4JX8A 3WJ7A 1EFLA 2X0RA 3I4FA 5BR7A 2OORA 3K92A 1ZNQO 3PPIA 1E5QA 3F3SA 3RJ9A 2O3JA 4JBIA 4XZ3A 3F1KA 3FRJA 3FNFA 4IDGA 4CM7A 5U4QA 2EKPA 1JWBB 3EDMA 3PHGA 1N7GA 4R1NA 3DAGA 4BGEA 2EXXA 4OXNA 2RHCA 1M6HA 1I3LA 3LF1A 4BO7A 3KYCA 5A1TA 3GPDG 2WM3A 4NBUA 1JKFA 4DGSA 2BHLA 3UF0A 1PQPA 4NPCA 2NU9A 4J1QA 1UDAA 2DBRA 3EUWA 1U5AA 1Y9EA 2FZWA 3TPCA 4IIVA 1Y7TA 1Y1PA 2P91A 1P3DA 5KCZA 3B70A 1O8CA 4E2YA 4XYMA 3BMQB 1QYDA 4ZVVA 2VHZA 4UULA 4UUNA 3ZWPA 3NRCA 4DTIA 1F8FA 3DZGA 1NP3A 1HYEA 4IXWA 3F47A 4DMLA 3BTVA 3HDJA 5LDHA 2B69A 3KYBA 1SEVA 2PKQP 3FWNA
chains in the Genus database with same CATH superfamily
2DPMA 5EHGA 4HX5A 3DMYA 3KOOA 4S1PA 2ZSEA 4H7PA 4L8FA 3H4IA 4CMGA 1VRVA 2WD9A 1YTLA 3HH8A 3DL4A 4JQYA 3ENQA 1JLLA 5AKJA 4ITVA 2I7TA 2J31A 2OBXA 1FXUA 1ZCFA 2NPIA 3RRXA 3IRUA 2R87A 5ADHA 1FTWA 4PSCA 4BFTA 4BNUA 4N12A 4BRZA 2OO5A 4L75A 3AONB 4C5BA 2FSHA 2JGRA 1QH1B 4WLEA 3O8CA 2AFIA 4YRAA 2G0NA 4DQUA 2Q3FA 2FR0A 5SV2A 4HH4A 3D64A 4BNGA 3LW7A 5CCBA 1JG4A 3C3WA 3RVSA 1A9QA 1UP7A 4EGAA 4B81A 1TO6A 4EPXA 3MZ0A 3KSBC 3D6MA 1IBMB 3INNA 3ZCQA 5C80A 4EHHA 3AG5A 3EZXA 4PXSA 4JU8A 5CMLA 2ILTA 4IDCA 3OE7A 1M0TA 3OH8A 4FUQA 4TYQA 4K6CA 7MDHA 4NESA 3WK9A 5KYYA 4FFBA 3IEUA 4FDUA 3CPJB 2Q6LA 3A6LA 3D5QA 4DNXA 1QOZA 4Z4QA 2ZQ5A 4HDNB 4PINA 4FK8A 1AUVA 5JU6A 3N8NA 4I55F 3EPHA 1ISFA 1J2UA 5JXWA 4BNLA 3K0BA 4HPXB 3PD1A 2OCPA 4L0QA 3P9PA 4DHWA 3IXQA 4GWGA 3OJ0A 4HQKA 1KEVA 1R4NB 2O3RA 4ALIA 4CQMA 1M5RA 4D9HA 4EG0A 2GRJA 1BXKA 1XAIA 3E9ZA 4EW2A 3VYRB 3NUQA 4Y2YA 2G70A 4GRIA 2ATIA 1JPVA 3IBCA 3T1HB 3KZCA 4OSPA 2MSDB 2DQ4A 3GJXC 3UATA 1VCIA 4RTMA 5IC4A 4QRHA 5CLJA 2JGLA 2JW5A 2H57A 1PYDA 1P5FA 4AJJA 1BOFA 3BWXA 3I9KA 3QYAA 3GDFA 4GLLA 3ZDRA 1OZFA 4KDEA 4Q4HB 5DLPA 3GLVA 4PC2A 3AEXA 4QYIA 4YRFA 1FDSA 1PV1A 2WTXA 3BIFA 1A27A 1ULTA 5DFAA 2JZOA 2PSDA 4KE9A 3WDMA 3ZHOA 3IELA 4ZIRB 2PJZA 3TK1A 1ZRSA 3A32A 4KRYA 1Y6FA 2WM2A 1Q84A 2H4XA 2FGKA 3U7GA 1ZNWA 4UFNA 2VYCA 4JBXA 4F8YA 5KWJA 1X7YA 3GRAA 4XFDA 3VR5A 2VJPA 2HV8A 3M9XA 1AN0A 5SY9A 3FX2A 2F8TA 1WXWA 4UHCA 1P2UA 2Q07A 3E27A 3F71A 3FFWA 4O2BA 1A0OA 3CGWA 4Y1GA 2DETA 3I2FA 2DY1A 5JAMA 1D6MA 5IVHA 4NU5A 5EXEA 3RVLA 4F6LA 4J4TA 1V5EA 5ELLA 4P0PB 3N2GA 5HMLA 5L6LB 2QM8A 3OCYA 5B4TA 1SC1A 2PV7A 2YZNA 4UPVA 3AUFA 2VTEA 2G82A 2V6MA 1C0EA 1CRZA 2YJNA 1MV8A 3V3KA 1FMJA 3TR5A 1L7VC 4GOMD 3TXYA 2ZI9A 4Q82A 4B7ZA 3DL2A 2O1WA 4NYJR 2WA1A 1OAKA 1JJ7A 2NXNA 1TYCA 3LHDA 1R00A 1V47A 1N2IA 4MYRA 4FI3C 1YULA 3A4VA 4CMJA 5CDFE 1V7PC 3MSXA 4R9VA 1DKNA 4QVGA 2C95A 3V7WA 1E98A 2VIIA 5EJAA 4YC7A 4OXKA 1CC1S 5IN4A 4ZU3A 1Y42X 2JLAA 1YMVA 2NGRA 3MAGA 3TCKA 1H2FA 3CCCA 1EJBA 2Q3BA 3GARA 4JEHA 4CFSA 3UJ8A 4BCCA 2NV2B 3WWZA 1SCJA 4TTQA 2W2TA 821PA 4ZU6X 1V11B 4QGHA 4LXUA 1Z4OA 4OUKX 1TZJA 2PH1A 5B1EA 5C8XA 2UUCB 3DT8A 4QQ8A 1U9CA 1R5JA 3HB9A 3BGVA 4IIFA 4DJJA 4KITB 2V7BA 4ZO9A 1IJEA 1BKYA 4U9UA 1PL8A 2EX1A 2G17A 3I12A 4FT2A 2NUAB 2XUHA 2LZ0A 1TO1E 5DTIA 4PLHA 5F1KA 2DRIA 4R2JA 3KXPA 4GSLA 3QX9A 1G2PA 5JCZA 4Y6OA 3BB1A 3JQAA 4EVSA 4Q9AA 5LP6A 3JZIA 3DMHA 3G0BA 2QYTA 4P7KA 2CK3A 1EK6A 4HGOA 2Q7XA 1KDVA 1XNJA 4JCOA 5JSZA 1PU2A 4FGZA 1YASA 2I8AA 2OLEA 3OOYA 5K3BA 2G1KA 2Q3JA 4GX2A 1QQBA 3E3MA 1NXXA 2A78A 4BX3A 3DLBA 1QP0A 2UYQA 1G7TA 1JAIA 3MQ2A 1KA9H 2PY6A 3AUTA 5A03A 1AV7A 2QD5A 1FA9A 5IAAA 4YEDA 5JJKA 1EZ4A 2O8NA 3A05A 3MG9A 4PRZA 2OQRA 3WGOA 1AXEA 1VXOA 1QVVA 4GPEA 2HBYA 4KAJA 2GPYA 5D84A 3VVCA 2HTFA 4C7XA 3N8IA 3UCEA 3W79A 1E3SA 3DYBA 3H2HA 3S28A 3DEYX 3RADC 2EFHB 4IDHA 4MRVA 4UDOA 3SZGA 3VSBA 2X5XA 3C6QA 1J25A 5I48A 1O6GA 3GLFA 3EUAA 2Q46A 2PMDA 3FBGA 3SJAA 3WLSA 5L6MB 5F9HA 4JLJA 4BNVA 1ZCAA 2AMYA 3UFXA 4GC9A 4EUSA 4JC4A 3PF9A 4LFCB 4BAGA 1HEUA 3HABA 4G8JA 4BFUA 1DKOA 4CTJA 4DFDA 2OHVA 3NH6A 3HJRA 4LDZA 4JY7A 2C42A 1EG7A 1MAAA 1UBNA 1WB5A 4KSYA 4V3CA 1AS3A 4L08A 3WKCA 1RAAA 1FFYA 2JEOA 4MEAA 4MJ7A 4JLDA 4RSMA 4UXIA 1WDWB 5AJZA 3WTBA 2QGNA 3UAVA 2I9KA 3BWYA 3VZCA 3WB1A 4FZJA 1KAMA 2CCJA 3ZNQA 2CMGA 5EOVA 3U16A 3MD0A 3WK8A 2AUMA 2QTTA 3MJTA 4BXOB 5BSUA 4Q9DA 1Q50A 2W2MA 3QTTA 4AZ0B 4EA9A 3EF0A 3E9MA 3PNVA 1JU9A 2EIXA 1LB1B 3B5EA 3MLBA 5L3RA 5HSGA 2C2KA 2CHVA 3EZ2A 1M8GA 3ILSA 3V7UA 1EDEA 3LT2A 3PLAE 3DBHB 1NXQA 5CTJA 1YZ3A 4JUAA 4RUKA 1E66A 3L3BA 1C1XA 2Z98A 4KL8S 4MVWA 1N6KA 1T1SA 1U28A 2WTNA 4I6EA 2KBEA 4OLHA 4ZU1X 2HD4A 3VSCA 1LEHA 1PNVA 4MDYA 3NDIA 4X3OA 4QOEA 2V6JA 3FOBA 3FTNA 3U3OA 4B31A 1P7YA 2D1FA 4YCLA 4K9KA 5CXQA 3BCRA 4GHWA 4EHJA 5F98A 1OGYA 2WV9A 4PSKA 1XRSB 1SK8A 2BR4A 4KQ9A 1R64A 3WG9A 5TMPA 2GB4A 1HZZC 1FTSA 3NDJA 4WMLA 4RPGA 2UVPA 9ATCA 4J16A 5AXAA 1RFLA 2YIJA 5CLFA 3DEIA 3MCWA 4LXIA 3OT5A 4W5OA 3ZK9A 3IOMA 2HPZA 1YRBA 4KUGA 1XRNA 4CM1A 5HZGA 3CHYA 2XTNA 4R98A 1YJXA 3NFRA 1UOPA 3T3PB 2ODBA 2WWGA 2JLCA 4B3FX 2FKAA 1NW7A 4I5IA 3GJ4A 3VU0A 2G1JA 4XASA 3NKLA 4IJKA 3U26A 4D45A 5AW2A 1UAAA 1IVNA 3O8LA 5CVVA 1XEXA 2IYQA 4B2LA 1XZHA 3E9YA 3QU7A 3QU4A 1FTNA 4EPVA 1WB6A 3ROXA 3C98A 2QY9A 4X1KB 4CU5A 1HYBA 2YV2A 1KSJA 3MD9A 3UFBA 4OYHA 3SS9X 1SUDA 2Q49A 4MITA 4WERA 5EJMA 1FFHA 4J0QA 5FNZA 2ST1A 4D25A 3QEJA 1XP5A 3IHLA 3L82B 1XDGA 2E5FA 3BILA 1K7XB 1BJTA 2E9SA 4IFEA 1AF7A 2GK4A 2CE7A 4PLPA 4QDZA 4Y1FA 3OZCA 4Q4AA 1JAZA 1Q7RA 4JJ4A 1FDOA 1M1YB 3I8OA 3LK7A 3OPYI 4QSHA 1VGRA 1LVGA 3U60B 3DKKA 1NF9A 4HNAA 5KNBH 4E5VA 1ZW6A 3EPKA 4O4HA 3TZEA 1CY2A 4X8MA 4RJIA 3R8FA 3E84A 2F4VB 5HUHA 4GYJA 4EY4A 2AXEA 3A1NA 1ZJ5A 4ZWNA 3V8NA 2DWCA 3ZU2A 2WIFA 3NRBA 1HLDA 3AP1A 3PVCA 1GG9A 3SU8A 3S3TA 1XQ6A 4JVOA 4LHEA 4ITUA 4RH1A 4DRXA 1U80A 3UIEA 3BSSA 1T5LA 5K9ZA 2H2HA 4LTNA 3HA2A 4D4JA 4MPRA 1DO2A 1MEJA 4ZFNA 4HGQA 4Y30A 1OXXK 1RCTE 3WTCA 4GL2A 2D7CA 4K3VA 2J4CA 4CDMA 3VH3A 3DE1X 5KVVA 4IGFA 3QNMA 1JJVA 1J24A 3EH1A 4NE2A 5BOVA 3NXSA 1P44A 1NZDA 4UEJA 1C0PA 2JFFA 4L4ZA 3UG6A 4LJ9A 4BNZA 1ZN7A 5CJPA 2PS3A 1LH0A 5JE8A 2HZBA 1XTRA 3HKBB 5HW0A 1UPCA 1PFWA 3WNDA 3UGTA 2DY0A 1ZH2A 1NNSA 2IKQA 2VDWB 3DFKA 4L4UA 1L8OA 3SP1A 3UV7A 4ACAA 3SQXA 2A9JA 4AF7A 2BOVA 2JGFA 2FG5A 2AFVA 1PTKA 4TLEA 3RTDA 4D43A 2ZATA 2O8BB 4G0OA 3FPBA 4NCXA 5LIPA 3KK0A 3FSJX 1M2HA 1EDDA 1RWPA 3ESXA 2RHDA 4F3TA 1SCAA 1YXMA 1YR7A 2FY8A 2R6CA 3PA6A 3P5BA 1IIRA 1SQGA 5EVCA 4CE6A 4LOHA 4BTEA 3QP9A 1V5WA 4JC5A 3VZQA 2HA5A 5K3DA 2OORC 1PTJC 1UJBA 4HI0E 1XYYA 3IP8A 1ZO8A 1UWLA 2F67A 5DISB 1JBKA 3N7UA 2XGGA 5K0LA 4A10A 1Y6GA 4R2KA 4CDRA 5DX1A 1YUMA 1R5NA 5DZSA 3PQ6A 3MM4A 4EFDA 1VB5A 3HM2A 4BX2A 1JXMA 5A5DA 1FNNA 2YL2A 1D2HA 1BNCA 1VL5A 1SOAA 3D8UA 4JZYA 5TVGA 4EM6A 3L1JA 2DT5A 2A9OA 5ALWA 3K16A 1SJ9A 1T0BA 4JFRA 4ZCMA 1FPMA 3C1AA 1HDZA 3K1AA 2HK9A 3P2MA 1JF8A 1PBNA 4GOLD 4TUYA 5EEGA 3TB4A 3N2EA 1IM8A 1XLVA 1X74A 3V55A 5BPFA 1JNYA 4EIWA 1W6UA 1QTRA 1CB7A 1T13A 5TPZA 3WFZA 4N3AA 1D5WA 4IHQA 3JQRA 4X71A 1Q0HA 4O25A 1Z7BA 3CEHA 3PJGA 3QWHA 1PT9A 1IVSA 4KIUA 1NWHA 1G20E 2IHVA 4KJZA 2WIKA 5C2JB 1Z39A 2CD9A 1QIFA 2AF3C 2RC6A 3W5BA 4CODB 1FTGA 1OXVA 2OWDA 3X1DA 3L7KA 2PDAA 1QHEA 3N87A 5E3JA 4B75A 3ITNA 2JFYA 4HSGA 1I2MA 1AHHA 4OH1A 2C31A 5AHWA 2IU0A 3C3XA 1SC9A 4FSDA 2E82A 4CQNA 1R9NA 2GLUA 1LSSA 3I04M 3KALA 4MP6A 5EE1A 1IZZA 5FPQA 5IYZB 2QBYB 1BO6A 2ZYTX 2JEZA 1NLFA 1CZHA 1PSWA 3HDVA 4EUFA 3B53X 1WUTA 3Q11A 2P3OA 4QC2A 3ACDA 1YMQA 1DHTA 3NS7A 4MB6A 3D3NA 5CM8B 3ZV4A 1ADJA 4Q9HA 2JLUA 2GWHA 4ZI7A 2CWWA 4MP3A 1JKJA 3WK4A 4I5DA 1G8KA 1Z06A 4ZVRA 3WSTA 3DP7A 1TADA 3T54A 3GMTA 3OVMA 4GE0A 4HLUC 2JFZA 3TL3A 2R1TB 4W8OA 4J94A 4J7UA 2ACWA 4M0KA 4WOJA 3L41A 4RIFA 4WXEA 3DZBA 1XVTA 3H5VA 3E2IA 2D4HA 4HL6A 2C3OA 2GAJA 3H11B 3OTWA 2YHSA 4N0PA 4D9EA 3UK1A 1T1JA 3RGGA 1JAHA 1G9TA 2PLRA 2AMFA 4KZKA 2CXHA 2JARA 3Q6NA 3QFSA 1AGPA 3PJFA 4HPWA 4WOCA 2F48A 3SHTA 5BWCA 5KNDH 1WOYA 2VTBB 2OZLA 2EL7A 4WKNA 1Y4ZA 4HDKB 1FS4A 2A0XA 4LJ6A 3PEVA 1L7OA 3NNDA 1I4EB 1J8MF 1KTIA 1UM9B 1K2VN 3A9RA 5KKCA 1LBEA 2FEWB 1K6IA 4GWLA 1UMCA 4M21A 4CHGA 3D0OA 2DQZA 3OEHA 4M0UA 1L5VA 1LCIA 3EJWA 4KO2S 2Z8ZA 3W06A 1CB0A 1N5KA 1NW8A 3K96A 1GNPA 5HS6A 3I2YX 4M8IA 4F6CA 3DFFA 1LWOA 4DIBA 2R751 3VHLB 3DJFA 4AF8A 4YVFA 1JDJA 2C5FA 1O95A 3WWPA 1JG7A 2X1HA 1TX4B 1UP4A 2B83A 2Z0MA 3DG9A 2GF9A 3FWYA 4B6GA 2CDCA 3STVA 4P6VF 4E1AA 3QSYA 1NRJB 1IQUA 2HMVA 5CDHA 3IDZA 5CGQB 3HJGA 5I3ZA 5TB5A 3E22B 3B52X 3PEFA 5HOQA 1NZJA 3EULA 3LUBA 4C3OB 2IDJA 3WGVA 4S0XA 3LOUA 1DX6A 4PX2A 2YMLA 1E5LA 3NHWA 1Q0SA 2EFEB 2QRHA 2I6GA 2JATA 1T6ZA 3KHSA 3NLLA 2G4LA 5C32A 1ZD4A 2O3UA 4JOQA 4P36A 2DFTA 4EPYA 5LZ2A 3OOEA 5AK5A 2XF2A 2R5WA 3BREA 1S2NA 1ZRNA 1SXJA 4DYHA 1JR3D 5BN5B 5E4JA 2ZSJA 2CVOA 2O07A 3WNQA 1XZDA 3GXBA 4Z0TA 5KNCD 3AETA 1DV1A 1OI2A 2QZZA 3VPAA 1XELA 2QRQA 3WLEA 4WUVA 3MGKA 5BSVA 1HDXA 4JI5B 3R7BA 1KFCB 3MINA 1VKHA 3C3EA 2B6NA 4N39A 1PCXA 3VPDA 5BN3A 2LTAA 3UYKA 4R71A 1EGVB 2W6ZA 2H5IA 1FJ2A 4CUZA 3OAAD 1FFWA 3CXUA 1ZM3A 2XD4A 2AG1A 4PZCA 2X8WA 1G5QA 2QXTA 3WWDA 3U09A 2CVHA 1E2PA 1YGPA 3BVPA 5FLYA 4ZQCB 3NIFB 2AN5A 5C46F 2HRQA 4FTWA 1M6VB 4OL9A 1GCIA 1BX3A 2GXSA 4FHDA 5A0VA 2B82A 4OSOA 4XVQA 4WKGA 3ND7A 3VO2A 3H05A 1PDOA 2AH5A 3A6GA 4M9RA 2HQ1A 2D4AA 3MNFA 3A3YA 4TTIA 3JQ8B 1W36B 4LQ4A 5FWDA 4CM4A 1XVUA 3BRCA 3LZ6A 4BB5A 3MCTA 2VPIA 1YUNA 3JR7A 1XZEA 3LPDA 4QHTA 5F78A 2IUTA 1RC8A 2DWPA 4P54A 4BATA 4C03A 3I9V6 4BNFA 2NP7A 2GAFA 3WLJA 1V1RA 2VYVD 3B6ZA 3NP9A 3Q3HA 2A1IA 2FSFA 3QVLA 1SOMA 1C8LA 3OIWA 5JXJA 1K97A 1J39A 1XOIA 2GD1O 3GAZA 4DR6B 2GASA 4ME6A 3K1ZA 3TINA 1IH8A 3ES9A 5AQEA 4C3UA 2GZ3A 2GFHA 4MR8A 1TYEB 5K8TA 3EIHA 1BOOA 3HU5A 3FE2A 3PD7A 2AT1A 1WUYA 3SKYA 3DKPA 2RE8A 2R7KA 3MRXA 3I52A 4NBWA 4D3ZA 2E49A 4PBSA 2AZDA 4QATA 3ORHA 3PPVA 1UUFA 3LXRA 3AF2A 5FTJA 5EIBD 4F3NA 4YLYA 4ZVLA 3KYIB 3WYDA 5IHPA 2CL6X 4IJQA 4OAPA 5A4FS 3NU1A 4YDSA 1J6UA 4WASA 1YI1A 1SUWA 3GAFA 3I1IA 3KYDA 3BXOA 3C5WP 4GRAA 4PZAA 2ZAIA 1ESCA 5E1OA 4LWZA 4WY2A 3A7EA 3WIUA 4EA6A 1NTOA 2OBYA 1RYZA 2NTYC 3PK0A 5LA6A 3G82C 2BEUB 1HWYA 1XT6A 1O03A 1UXIA 4DNFA 4W1PA 1THZA 3TTUA 3BHMA 3F78A 4L0CA 1M75A 2R6GA 4YX9A 3AM1A 1M33A 4GRDA 2I2BA 4YJFA 5LZ4A 1P5RA 2AG0A 1IXZA 3ZWBA 3FKSA 4PLCA 2B9EA 2YY7A 1NIPA 4IVNA 5JS2A 4RK7A 3FPEA 3HNRA 3QNUA 1F0KA 4UMEA 1X1BA 3I5UA 3GBPA 3GUHA 1XVLA 5HGJA 1I80A 3G1WA 2IXGA 3ENWA 1QTIA 2W8BB 2G09A 3SIWA 3KQMA 4BMOB 2PT7A 1A3CA 3A3OA 1LV7A 2W98A 1MC5A 1NVWQ 2XJ4A 1HETA 3DQQA 3GWGA 5H82A 2C2MA 1K98A 1CEEA 3OUUA 1GPYA 1FP1D 5C53B 3IQIX 3KSZO 2AG5A 1ZHHA 2OVBA 2UUPA 4Q02A 4FOPA 4KAFA 1P0PA 3ZKAA 3T4PA 4ZTZB 4PRKA 3AIOA 1NVEA 3KEFA 4CW7A 3TR6A 3CINA 2H9AA 3B1XA 4IZOA 2OZPA 4OATA 2QNIA 3VDQA 4R9RA 2ZB4A 4JVNA 1OBHA 3U44A 4GS5A 5LQJA 1MGPA 2C78A 2G88A 4M88A 2E4WA 2JVJA 4LK3A 4LSWA 5HE9A 2H7YA 1PV4A 1C3XA 3WO0A 4S04A 2EP5A 3O5AA 4W7HA 1H94A 1N5MA 1KR5A 2P0YA 3C43A 4PU0A 4F4UA 4KRXA 2XUAA 1FCJA 2B1JA 3TB6A 3VVMA 1GL9B 1ZKMA 8ADHA 1YA8A 4KVAA 5IYZF 4HGYA 1F2UA 5LZ9A 2WYWA 3L8YA 3GP5A 4BMNA 1ICIA 4J3JA 4IJVA 1E89A 1KORA 5BUZA 3PXXA 3T3GA 2VDQB 2Y1GA 5BOSA 1HZZA 2XGSA 3ETDA 3M33A 3IP6A 3VV3A 5BRAA 5FEUA 4V02A 5EPUA 1TECE 1BCSB 4D6YA 2UVQA 2XCQA 2FPGA 2SBTA 2XODA 4D42A 4CLOB 5CT5A 5L4SA 1VG1A 5KVAA 2GI4A 1Z33A 1ID1A 3CR7A 2W22A 5ALIA 5ILGA 3ZWQA 1YVRA 4TWZA 4NICA 5E7QA 3BMXA 4KK3A 3OWXA 3L7OA 4JSTA 4DLSA 5CFOA 2LCQA 4JKIA 6YASA 2IW1A 5JSHA 1OW3B 3AOEC 1O6ZA 3CNHA 4B87A 5LMUB 5F1YA 1NDUA 2H4WA 5E4YA 3BSYA 3SEAA 1W5TA 1IY2A 4H4DA 2VJQA 2E4YA 5EL0A 4A23A 4PSUA 2EJVA 3AJAA 2HHAA 3SZMA 2JDIA 5LJIA 4OK5A 1E2KA 5EMKA 4DCGA 2QP3A 1R7RA 4UQPA 1Y7LA 1DBPA 5KOYA 4BUCA 2YWDA 3IE2A 4RSHA 3W3ZB 1XCBA 4HATA 4CKEB 4DIOA 3OAAA 4GMXA 4V1CI 2O8EA 3EA4A 5SYNA 1XPOA 1A82A 2FCRA 1HORA 1U8EA 5G0TA 4R5HA 3VHXB 1TYDE 4AY4A 3CB4A 3ST7A 3OLWA 4D74A 2MU1A 3QUBA 1Z4MA 2FEPA 2VKTA 2X7JA 2YN2A 3A1SA 4RVHA 5B1SA 2AJBA 2HGSA 2HO5A 5L95A 3CTPA 1NYLA 2RARA 1JFLA 2WWWA 4UBNA 1L7BA 1Y34E 4LZWA 3SMQA 4AS1A 4HTAA 5BR4A 5BSHA 1SVWA 3LC1O 1U2ZA 4KZPA 1ORDA 4H77A 1UMCB 1L8QA 2A1TS 3CF4G 4OFWA 4FI3F 3ZJYA 4AKGA 4TT3A 4P3PA 1X7ZA 3QF7A 3VJKA 4B35A 5J58A 4KNYA 3UWKA 4KUHA 3JZAA 1XV5A 4HDKA 4WZAE 1ODLA 1VL6A 2P1DA 2XSZD 4BO5A 4PO1A 3BE5A 4QPDA 3LFUA 2B92A 2WFZA 1L5WA 4AI6A 4LRSB 1EB9A 3H3FA 3BIXA 3OKCA 2O2SA 2OO3A 4OV6B 1N8TA 4YACA 3THXA 5GJBA 2VP0A 1INLA 1YZUA 1U4SA 2R8RA 3T8YA 4EEXA 1TW2A 1QTNA 2ZWVA 2F6RA 3FUCA 3KJIA 1LPOA 5L3ZA 3SZ3A 1TE2A 4H2DA 2ABWA 3THRA 3HDHA 2R1TA 5G4KB 1OXKB 5LP6C 4E11A 2JS7A 1QQ5A 4IUCS 1XNGA 1R1DA 2O50A 2RCYA 1K2WA 2RKWA 1XMQB 3DUWA 1RIIA 5TPZD 5COQA 3VPXA 5I4BA 3OQBA 1GTZA 2P5TB 1TYZA 2G5CA 2VZEA 3SIPA 4D8YA 4QRDA 2M98A 1E5TA 1S1CA 5CBPA 3O8NA 1GFWA 1PLLA 5FDFA 1I1OA 2XZTA 1NIJA 1THGA 2NUBA 4QDJA 3AVVA 4RGVA 3IUYA 3M82A 1XALA 5L3SB 1CY0A 3NASA 4XM1A 1S4QA 1A76A 4EB6B 3QU2A 4UE2A 1OOEA 2HQBA 3WAGA 4L8YA 1CQJB 2OHHA 1GSOA 1ZXBA 1UBLS 1ZCZA 1BJRE 5FNVF 3O9MA 4RX1A 5KNCH 1A9ZA 2HOQA 4DS3A 4I1VA 1Z0FA 3WSWA 3CSSA 1LF5A 1DIGA 2ZRGA 1XKXA 3NCHA 1F5NA 2VNIA 3UHJA 4NMXB 4FWTA 3FHLA 3ET4A 4CQLB 4HY3A 1YL6A 1DEHA 2OXTA 3AHGA 5PGMA 3KAPA 4KFUA 4RVGA 4PS0A 1OLXA 2PL1A 3IEXA 5D6OA 3A36A 4BIMA 4NARA 3ZDEA 1YRYE 2XEDA 3B7WA 5M29A 4OK6A 2JLVA 1RYFA 3D4OA 3GRYA 3E53A 3H0CA 1DL5A 1PFYA 2NADA 4N49A 5AOCA 1I7SB 2CNNA 3IPRA 4PNPA 2EWVA 4ZZIA 2HCFA 5AW0A 3T5GA 4QXRA 4MUAA 4PCUA 5EIBC 3UOAB 1OH8A 1KP3A 2I80A 5J1TB 3RVOA 1UQTA 1LD3A 1N2EA 1JEDA 2I6FA 2O4CA 1RE1A 3R6DA 4TWAA 2E7ZA 2BD0A 3LGAA 5JZVA 3SVLA 4UNIA 4ZZ0A 3W5UA 3ADBA 3JQGA 2UZ0A 3UT5B 3DCYA 5KOJB 3WRYA 2BHSA 1HK7A 3TRIA 1XTBA 1GRRA 1YB6A 2HEIA 2SICE 2ZVQX 2FNAA 3TLZA 2AB0A 3RUHA 1E3LA 2GTIA 5E8JA 4QVIA 1SA0A 1DAHA 4FSHA 1A2OA 4IGAA 1P4GA 2C96A 1ATZA 5M5BA 4P8RA 3M1LA 1W5BA 1SHUX 4OLFA 3U4HA 4AMZA 4B8WA 1RVV1 1T25A 5CAEA 4MULA 4PYRA 4RPCA 3HG7A 3HXQA 3ZK8A 3OC0A 3DMTC 5KTMA 4DXAA 5HKKA 2WZQA 3K0FB 1WB9A 1YR3A 2XNHA 3AR4A 4I2VA 3W8RA 3K9LA 1YZQA 2AQIA 4PSVA 4C6HA 2Y1WA 4KWTA 4MS3B 4B17A 1MDFA 2JFGA 3I05A 3KOYA 1SO8A 2QRGA 3DMPA 3KVOA 1TJNA 3OTGA 4N3GA 2C1ZA 3ZOKA 2BMEA 2PG3A 2QM7A 3BQMB 2R65A 3M5PA 1T6XA 1UBSB 3LVFO 4QDKA 3L40A 5JI3E 1HC7A 2DHQA 2Q3DA 4B8ZA 2GJSA 2YFYA 3OX4A 3IE1A 5H81A 3RTCA 1OPRA 4OTZA 5JVDF 3MGBA 3R9KA 2SECE 5CNJA 3T12A 4NY1A 3V6MA 5EJ5A 4WACA 1ZL2A 4ZEMA 1H69A 3CR3C 2ANCA 2FEOA 2FUG1 2F43B 3MWEB 4MW7A 4E13A 4GWKA 3CXRA 2HBZA 3K9WA 4R1UA 3CKLA 3GP8A 3DBLB 3SR4A 4OAOA 3FIJA 1MJHA 4L6CA 1QG0A 4BP9A 2Y0DA 3RJ5A 1JDBC 3A9UA 1J4AA 1WCXA 1TTQB 2MR6A 1RRVA 3EE6A 3HV2A 3QLUA 1UMDB 3MMPA 1RQGA 4INOA 3RT1A 3W0LB 4DAEA 5GTDA 4ESVA 5EZ5A 3TDKA 2QGZA 5HBGA 2V98A 4KXQA 1JE1A 3L7LA 2BRUA 3SHOA 2GTPA 2QQ5A 3IO3A 2YV3A 4YHBA 4ZQEA 1U2TA 3SIXA 4BNMA 4BB6A 1CU1A 3HCNA 3LUJA 2QUBA 3Q9NA 4Q7QA 1AMUA 2HRZA 1P31A 2WYIA 3RVRA 4F1KA 2DMRA 1W34A 4GLBA 4DPMA 1LPPA 1RAIA 2VSOA 3QFHA 1T9ZA 2CNBA 4PE5B 3CS3A 5I9SA 4HQNA 3T1TA 3CMCO 4R8SA 4G0WA 3D6FA 1AKVA 2Y1DA 3MLEA 5LMCA 2RGBA 3ZWDA 5IJ9B 5HRUA 2EDCA 2Q62A 2O1XA 5ERXA 3L8DA 3TTWA 1BA3A 2QR2A 4JEMA 1RS0A 1GTG1 4DZRA 2M6LA 1C30B 3S7ZA 3VAAA 5F7XA 2VRNA 2C54A 2CC2A 2GS9A 3GFRA 3MUNA 2XCLA 2KPOA 3CZCA 2RGUA 1VGVA 3LPLA 3N53A 3MT9A 4HAYA 4KO8A 4N9WA 3OZVA 4EA7A 4KIGA 2WTBA 3R6TA 4NONA 4UU1A 4B45A 4CMHA 1JHQA 3KKQA 3EGEA 1RQ7A 1J09A 4IDPA 4HT3B 4ZVPA 5FJIA 1TFRA 2I4OA 5BWNA 3DXYA 4B79A 4F4HA 3AEQA 3A4LA 2XF8A 3ZW7A 4JQZA 4CV3A 5CM9C 1MTOA 1Q0LA 4A36A 4QA9A 3NHLA 5AVOA 3ZH2A 5JDCA 1DO0A 1CS4C 4G01B 1JWAB 3DDCA 1XXHB 2ZSAA 3B82A 4Q7LA 4U02A 2WHPA 1MIOA 1S3FA 2W6NA 4O2AF 1G5HA 4S1NA 4FWIB 1CZNA 3SQOA 3U7QB 4RS3A 1YQTA 2P3QA 4TVKA 4I8DA 1NF8A 1G6KA 4C78A 3IULA 1KI6A 3VX4A 4EWLA 1MO2A 3PX3A 4MDEA 4MHSA 2GVNA 3TUJC 1OZHA 1DB3A 2QSJA 4BVLA 4RKQA 4FDTA 2ZT5A 1KJJA 3IVGA 2EJTA 1TZ2A 1VHDA 2WJAA 3MHPA 4K9RA 4DQKA 3JAWB 3ZDYB 4EVRA 1MMFB 3VZBA 4GOND 1L7NA 4PO8A 4RQUA 3DBHA 1SIWA 3IR7A 4I50B 1GUZA 3DDZX 3PLNA 3AL0C 1RHUA 3V00A 2N75A 2ZIWB 4XJXA 2FZKA 3DZJA 4F3CA 4YAUA 4GICA 1KGSA 3STYA 4EECA 1Z5UA 2AFRA 1JV2B 2XITA 1FRVA 3D3WA 4MUXA 4MW4A 2YR0A 2QJOA 5ALLA 4JI6B 4I81A 2VRCD 1KU6A 2D74A 2FN3A 2K6GA 3E2MA 2HQOA 1TQ8A 4KVGA 4ZOLF 1UP6A 2WF6A 3K5PA 2R11A 1GU7A 1LJUA 1YHYA 5LUAA 4W7IA 4ZOQI 1YIDA 4I9HA 2DKFA 4HXYA 1X15A 3KG2A 4MV9A 5KQRA 4Y6SA 3O8BA 5SY6A 3FR8A 1H2HA 5AMXA 5REQB 1OYYA 3BWVA 1G2OA 4BJ5A 4BEWA 4RTKA 2IHJA 2M6RA 4IMPA 2JF0A 3AIIA 1NVTA 1JEYA 1IWPB 1YBMA 4Z7OB 2HO4A 4NU6A 4Q18A 1W96A 2G3YA 2ZOSA 3VR2A 3L8HA 3ZJ4A 5A2QA 4YIHA 2ZDHA 4Q4CA 1GGKA 1MIOB 1RLJA 4Q3DA 4UUMA 3WYCA 3PDHA 4CM8A 3IQXA 3OT1B 4RIIA 1QANA 2ZUWA 1EFPA 1CUIA 1RKBA 1H9BA 1ZJ6A 1RRGA 2HDWA 2BWJA 3ZGOA 3FB4A 2ZZKA 3L7JA 3PXEA 2VHUA 2WTUA 3VPFA 2GCIA 1JFSA 3SX2A 2ZRDA 3WSVA 1C81A 2ZBUA 3DUFB 4QT0A 1BEEA 2R00A 1YE3A 1SCUB 3B3JA 4LXQA 4PFSA 1WE2A 4IDAA 3KZNA 4XJTA 1UPXA 3GEEA 4TT3D 4CMBA 1EIWA 1B2RA 1QHHB 4B3SB 4AW9A 4FEGA 6ABPA 3AI7A 4EMBA 3NR2A 1JPUA 1WD5A 1U5CA 2WG1A 3QNWA 2C0CA 4NU0A 1PAUA 2OAP1 3R3VA 5G53C 3SS7X 1XRPA 3D2BA 2ZE5A 1FMLA 1JXOA 5EJIA 5CEJA 5J23A 2WD8A 4DR2B 1A98A 3GL9A 3OZUA 3J81k 1QCDA 3R5FA 3F98A 3WB0A 5A02A 3C6KA 1U8FO 1P2GA 3K5IA 3ZV6A 1TZCA 2Q9BA 5DWQA 5TRTA 4CKXA 5CVUA 5B5SA 3RUPA 1G6HA 5JD6A 1TLLA 1P0QA 2H0AA 4HAIA 5DGIA 3VTFA 3AO0B 4JKOA 4WXRA 4MI9A 5I7WA 1ZGCA 4EI9A 3GGJA 3RK0A 3EDOA 2W8ZA 3N2YA 2ZU6A 3VQTA 1BU5A 3H2KA 1I6KA 4U39A 5C8YA 3KB6A 3RNOA 2R1VB 3T9DA 3R3YA 4DVGA 1YBVA 1O1YA 5HKOA 1T8TA 4MUBA 3GN2A 1U9JA 4C1BA 4F7DA 2X8AA 4ZCPA 6Q21A 3H97A 3FSEA 2Y68A 3X1MA 4DBZA 2NT3A 4J2HA 4M36A 3OQ1A 4ZCQA 4MDFA 1ZH8A 1DAKA 2BEVA 1LUAA 3G0CA 3O74A 3PQFA 4J1TC 4URZR 3UXHA 3EYAA 4IW3B 1KIMA 4NZMA 1MB4A 4FHFA 3ZZ0A 3B3FA 2VT3A 2Z56A 4BO2A 4ZDKA 3GLHA 2Q9AA 2H17A 3QVGB 3ZHYA 2G71A 1H8ED 4ZVTA 5GGXA 1BA2A 1OI3A 5KOHB 1S01A 1WXDA 2I6UA 4FD3A 1AF4A 4J4BA 3ZQUA 3MC1A 4J03A 5K6TA 2JCGA 3PJEA 3UA4A 3L4EA 2CJFA 4Y2VA 5KYTA 4IAOA 1PIWA 1SRQA 1AUOA 1ZI6A 5K45A 2ZZMA 3ZDQA 1WDTA 4TSFA 4Y67A 4H08A 2WNIA 4BBPA 2FRXA 3BH0A 3E3NA 1FLVA 1I0LA 4JDUA 5CAEB 2FYTA 4G1UC 1II8B 5IDYA 3MRVA 3I9V1 2V9CA 3BGDA 1Y6QA 2PXCA 1HDCA 1KH2A 1LQUA 1SA0B 2YZKA 3DZIA 4PFKA 2A1UA 4ZIRA 2XUZA 3QA9A 3RC7A 4NYIR 5AVTA 5LLTA 3IMCA 1LF0A 2H6EA 3RVBA 5FLEX 2QAGB 3PCRB 3QMWA 3AGQA 2PH3A 3LGXA 2ERCA 3IPLA 5FHRA 2WQZA 2VSFA 4HG2A 2VBIA 3KQWA 1X7GA 3DLPX 5IBPA 3ROMA 5T3YA 3UK2A 1TPZA 3RRJA 3NHSA 3WRXA 1WDMA 2JFNA 4ARIA 1QORA 1P1BA 2X4IA 3FG9A 1ACLA 3KTFA 5HF6A 4EG4A 3QEMB 5J5AA 4U4AA 1E7RA 1VJCA 4R8MA 2DPLA 1LDGA 1UDXA 2C83A 3VV2A 3LT5A 1Q92A 5CDFA 4X60A 4M1TA 3T9EA 3EXG2 4K9DA 2VAXA 1W0JD 3IIEA 2BPOA 3SYNA 2SKCA 1ZUNB 2O57A 1PGJA 3R8XA 3IVXA 5B2FA 3BMOB 2FSPA 5DNVA 3ZXUB 4GNRA 2P6MA 1DS6A 4RYLA 4CF4A 5KSWB 4NBNA 3E9NA 3VR6H 2DH6A 1PK8A 1I7QB 2Q1WA 3DEAA 3LX5A 3WKDA 1OFUA 5EGSA 4C3ZA 5J2UF 2Y6VA 4CMEC 4RD3A 3CR8A 4HRAA 4NDAA 5J3JA 4CN8A 3RG2A 1TCVA 1CKEA 5EIAA 3LX8A 2HF7A 5CB8A 5EZYF 4EAAA 1AUXA 4B7CA 1U99A 3FHJA 4WJZA 4TM8A 3FTEA 3Q6IA 2ETXA 3P2EA 2IHZA 4YXFA 3CH6A 1MAVA 2QG6A 4MQEA 1D3AA 4F86A 1KJ8A 5EJ2A 3O83A 1A7UA 2AA3A 5GONB 4RA9A 1K3TA 4EG8A 1AC5A 4X62B 4I5EA 2G7MC 1ENPA 1QH1A 4FEEA 5AH0A 1E6EA 2VPTA 2JIPA 4GR9A 1YR6A 1P7CA 4J07A 3U19A 1GG5A 4C05A 1Y8RB 2IOQA 1ZK4A 3PC3A 4BFXA 2CMFA 3RJMA 2IYXA 4CV0A 4B43A 4OI4A 5J4LA 1JLLB 4G0UA 2ZI7A 3KEMA 4EJSB 1P9WA 4ROTA 4Z8XA 3HC7A 3A10A 3UXEA 2BHRA 2P2LA 4IFIA 1X8KA 5JAUA 5LYYA 2QUJA 2GTHA 2YVKA 4IJ5A 3FRHA 3DMFA 1TIBA 4GZ5A 8GPBA 2QTHA 5A9RA 2A0FA 1ECGA 2PR7A 4G5SA 2R60A 5JJBA 1YTUA 2AQKA 2AYXA 3IJRA 3DOUA 1IEXA 3BIOA 5DRTA 5FULA 5HX7A 3FUUA 1E59A 1STOA 2XMGA 3HBFA 4II7A 4CM3A 5DN6A 3EUFA 3ORFA 4URHA 1Y8ZA 4LZOA 1U7UA 4Y9UA 4ZJUA 5F2OA 1D2AA 1YZNA 2GZAA 4K87A 3SHFA 1KEZA 1YC2A 3S8EA 5ICFA 2A5YB 1X42A 2J9YB 2QM0A 3W6NA 1Q1GA 2P1RA 4DE5A 3ELYA 2TS1A 4L9RA 2YMMA 4GR4A 2JKZA 1HPLA 1WHTB 3LCCA 1S1MA 4G2NA 3C3KA 1PO7A 2AG8A 1SC3A 1KZYC 2XWPA 1VIVA 1M8KA 3AERA 3D54D 4FYIA 3DNMA 4KN5A 1KMQA 4N0DA 3C39A 1HDGO 2HK6A 3UH0A 3W7BA 5F7OA 4TYNA 1X1AA 1EVZA 3GHYA 2VPQA 1P1IA 4LK2A 3H1FA 3KLOA 1C3LA 3IQFA 3QE4A 3C7KA 3G1UA 1MBZA 2O52A 4BO6A 4EHDA 1C7EA 4B6SA 1WMSA 3ZVKA 5A0FA 1XMIA 1WU7A 1DUSA 1QRRA 2RMKA 3OX1A 2M9MA 3BSFA 3JVVA 3RRMA 1SIUA 3Q2KA