2NU9A

C123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
285
Chain Sequence
b'SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNTPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 109
structure length 285
sequence length 286
chains with identical sequence D, F, H
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu9A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu9A01
1LDNA 3H2ZA 3RFTA 3F9IA 3HB5X 5DN9A 3KYDA 3STHA 4F45A 1GFSA 4YVFA 4RF5A 1YQXA 1XKQA 5F5NA 3RUCA 4YB8A 3IOYA 4ITUA 4CLHA 1XU9A 8LDHA 1CF2O 3CXRA 1BXZA 4JNKA 1KERA 2PWZA 1R0LA 1GADO 3IL2A 2J6IA 2WWRA 4II3A 3NRCA 2IXAA 2JCVA 4L9RA 4R69A 4E2YA 1ONPA 1ML3A 2O3RA 2JHFA 2DBQA 3DHNA 2YV1A 3DZFA 3QHAA 4GX1A 3DBRB 1EVJA 2I76A 1ZFNA 1YGYA 4Y9DA 2C82A 5ER9A 3K2BA 2EGHA 4GBJA 1DPGA 3IUPA 5JAIA 4Z3KA 3B6ZA 2X23A 3DHYA 1WDKA 2EJWA 2YFQA 2NU9B 4E3ZA 4LVUA 4BNMA 2GRAA 2AE1A 4J7XA 3Q9UA 1PU2A 3I52A 3OJ0A 4O63O 2X6TA 2OFPA 4R5HA 5FYDA 1R6DA 4AL4A 4LCJA 4J0EA 2CDAA 3COSA 2X5KO 3D3WB 4PVCA 1KC3A 2UYYA 4GX5A 3B1KA 2BHLA 3BYZA 1FK8A 1UAYA 3EAGA 5A3JA 2YDYA 4K6FA 1JKIA 4RVSA 2X9GA 3GRPA 1X0VA 1ZK1A 2WMDA 3WFIA 2Y93A 5TX7A 5AXAA 4RPJA 4M86A 3GZNB 4EJMA 1GDHA 2IE0A 1H6BA 2P91A 3OA0A 3NGLA 1XGKA 3IKVA 4WE3A 5EN4A 3ZH2A 1E7WA 1VKOA 3LVFO 5ILOA 3WJ7A 4QSMA 2VOEA 5A02A 1KEVA 4JIGA 1P9LA 1PQPA 5G2OA 3JQAA 3PEFA 3TZHA 2GASA 1SO8A 1ISHA 2A35A 4OKNA 2Z1NA 3OECA 3PIIA 4MJLA 5F1KA 3AFNA 4J1SA 1CJCA 2NU7B 1B3BA 2VWHA 2JAPA 3AI2A 4E2XA 3PZRA 4CLRB 1NHGA 2FMUA 3OQ1A 4OO3A 3DHEA 3RC7A 5I7VA 3C1OA 4FDAA 5L45A 1Q0HA 3UFXB 3GUCA 4MO2A 1BXKA 2H9IA 5KJFA 4TRJA 1N7HA 3I9JA 3VPXA 4JJGA 1L7EA 1AGNA 4CMIA 3BMOA 4DUPA 1YB1A 2D0IA 2WD8A 3QVSA 1E6UA 4BGIA 3QE3A 4BNFA 3H5NA 3JQ9A 3KVOA 3HFGA 2WDZA 4QFCA 1HLPA 1IHXA 1DFIA 4NI5A 5L7YA 3DC2A 4A0SA 4OJNA 5L4SA 2AEJA 1Y9EA 1JKFA 3ROMA 1U3VA 3HN2A 4IIUA 2DPGA 2OP1A 5ILGA 2CY0A 1B14A 1ENOA 4I9UA 4HFRA 3GMDA 5JW6A 3PJGA 3ENKA 4W82A 2NVUA 4PN3A 3F5SA 5COQA 2P2SA 3SXPA 2HMTA 4FCCA 4J6FA 2YV2A 4YJGB 3DONA 3WDSA 3ETEA 5JDCC 4BMVA 1UZNA 1NWCA 2B4TO 3LF1A 2Y1FA 3ZWCA 1ZZEA 1YONA 1B16A 4K28A 5TSDA 1Y8QB 3AOEC 4JP3A 4IQ0A 3K73O 4E21A 4CM3A 2VNSA 1EFKA 2XPCA 4BNHA 3VDRA 2BD0A 1A9ZA 4ZHSA 1W8DA 1Y7TA 2A92A 3HDHA 5F5LA 4BNIA 1RM3A 3RUIA 1MX3A 2I3GA 2SCUA 2VWPA 5JBIA 3T7EA 2ZB3A 5IZCC 1PZEA 1HDGO 4DMLA 1P1HA 3MJTA 1B7GO 3ZWNA 1PJCA 1X0XA 2O3JA 3ZNOA 5BR7A 4PG8A 3AY6A 3DFUA 3H5AA 3W8EA 4ALNA 2CUKA 2Q2WA 4R9SA 3VC7A 4XIYA 3WNQA 4Y6SA 1QRRA 3HE3A 3PTZA 1B8UA 3ZWVA 4IQGA 1N8KA 1JAXA 2PFGA 1LSJA 2CVOA 1FDVA 2NVBA 2B5WA 1YKFA 4QX6A 3RU9A 3WGHA 5CEJA 5JCXA 5T6BA 1NX6A 1ZMTA 4FFNA 1PJ4A 1B8PA 1NFQA 4E32A 3V2GA 4JBGA 7MDHA 3OSUA 3AI3A 1UXKA 3HZZA 1DEHA 2G1UA 4GVXA 4EZBA 4XJSA 4AJ4A 2VRCA 1JTVA 1KY5A 1U2DA 3HHPA 5A4DA 1NAHA 3AK4A 4YYZA 2G0TA 1ZH8A 3GT0A 5TS3A 1A7KA 1KIFA 1S6YA 3EW7A 1JU9A 4C7KA 5JY1A 4UUMA 2PZJA 4DYVA 3UHAA 1ENYA 3WJAA 1VL6A 2DLDA 5TQVA 2V6MA 3BXXA 4BB5A 1M6WA 3AI1A 2GZ1A 5TLSA 2Q50A 1UZMA 4EEXA 3ON5A 2B37A 4NFHA 2NU9A 1EK6A 2ZYDA 3VH4A 3FNGA 1UXGA 3L6OO 3DMYA 2HCTA 1K89A 3OQ6A 3RIHA 4CLXA 5DBIA 3GK3A 2FR1A 2GCGA 4QTZA 3V5NA 4E0BA 2UUOA 1B3RA 4FGSA 3RD5A 3O4RA 4ZQHA 2BMAA 3DZIA 3Q11A 3I4CA 2YHIB 3K2EA 3Q6IA 4HKTA 1Q1NA 3RU7A 2EERA 1LDGA 1LTHR 1CETA 3H5RA 4Y67A 3TSCA 4OQZA 3A1NA 3FF4A 4QFDA 2P4QA 4L76A 3I23A 3WLFA 4Z0TA 2PD3A 3V2HA 4R01A 3DZBA 1H2HA 4E31A 2OP0A 5B4UA 4P4GA 3GNQA 4IDAA 4S1VA 2VRBA 4D3DA 5KTKA 3WNVA 4OIMA 4RPKA 1MGOA 1DB3A 1C1DB 4M55A 4GMGA 5DOZA 1LJ8A 3JYLA 2CSUA 1E7QA 1WP4A 4YBZA 1Q7BA 4PLTA 1LI4A 1D3AA 5ENDA 1A4IA 1NR1A 3PHGA 2WTBA 2PTGA 5DBGA 1NVGA 3ETDA 4M8SA 1O94A 2VTEA 3ONEA 4PVDA 4A26A 5T8KC 3ASVA 4DBZA 2DTXA 1R4NA 3G3EA 3AM4A 4NU5A 5A9SB 5HS4A 4FFOA 4LRSB 1E1LA 1XWFA 2O3UA 3RJ9A 4WCFA 4MKXA 3GNTA 1VL0A 4AJJA 3UFXA 3OJEA 1DAOA 1Y81A 3CUKA 3WS7A 4CV1A 4KMSA 4HWKA 1J6UA 1C0IA 3EHEA 1LLCA 1E3LA 1P3DA 1CYDA 3UVEA 2HK7A 2RBEA 3WBFA 1E77A 3OM9A 1ZEJA 2GZ2A 5LC1A 1I3MA 3AU9A 1DOHA 2FPPA 1ZJZA 2B35A 4MKRA 3DAPA 3I9OA 1XU7A 4D44A 1QG6A 4W7HA 3RUDA 4MVJM 3NV9A 4PRLA 4CMEC 2BRUA 5A9RA 1M66A 2G17A 2GN6A 1DFHA 1U5CA 1DRVA 1WMBA 5FI3A 4BMNA 4HFNA 4JROA 5L4LA 1LEHA 2E82A 4K1LA 3MOIA 1I32A 4LN1A 1WWKA 3JD3A 5I7EA 4WKGA 1JDJA 4JJFA 3E48A 4DPLA 4FB5A 4CMBA 5BSHA 4LCEA 4BHTA 4CMCA 1O8CA 3FRJA 2QG4A 3HFSA 1T25A 2J5QA 3I9MA 1PWZA 3OJFA 4YJGA 1IZ0A 3EZLA 1P31A 2P5UA 3MJEA 4TRNA 2ZB7A 4YT4A 4W7IA 3DOCA 2TMDA 5A3VA 2W2LA 4XB2A 5JYEA 4YJFA 1GEEA 4J90A 1XCBA 3OJLA 3Q9NA 4GAEA 1YOVA 1CEQA 1U2GA 4BGUA 5IDXA 2YHUA 1AE1A 1R16A 4MPDA 3HDJA 4IXTA 2H63A 4ZQGA 4J16A 2DUUA 4OSOA 4PG5A 1HDXA 3NYWA 3JQ7A 4IY1A 3S2EA 1J49A 3IIEA 1YS4A 4P22A 1DLJA 2G82A 2RH8A 1U4OA 4XJTA 1GUFA 1XELA 4RGBA 1NXQA 1GR0A 3QWHA 4I5GA 4OSPA 5ER6A 4W9NC 2OMEA 1GV1A 2O23A 3GEDA 3PHHA 4YQYA 3U9LA 5JS6A 4TSKA 3V1YA 1TA4A 1EVZA 2J3JA 2EJVA 1GQQA 2HQ1A 4H15A 3N58A 3MTJA 3GA0A 1X15A 3KBOA 3UOGA 1UDBA 4GKVA 2Q4EA 1EUZA 3NT5A 4DPMA 1E7RA 4E2ZA 3WOHA 5AVOA 1D1TA 2VWGA 2W90A 3RC2A 4FFLA 4EEZA 2X22A 3UUWA 4RDHA 3RJ5A 2EGGA 3PWSA 5JSFA 2O48X 3ROPA 4NK4A 2IEBA 3WGGA 4B7UA 4CM4A 5COAA 1MXHA 1SBYA 3HN7A 2DVMA 4UEOA 1U3UA 1H9AA 4WASA 3RBZA 3WX0A 1T26A 2AE2A 4BNJA 3ZV6A 1I2ZA 2GSDA 2JFGA 5ADHA 3VZRA 1T2EA 3KOUA 1U4SA 3NJ4A 4R16A 3WICA 3RI3A 4NJMA 1DC4A 3DBVO 3LT0A 1IZ9A 4L74A 4GX2A 4YRDA 5T8KA 1T2FA 3LT1A 2PGLA 1QV7A 3B70A 4YJDA 3ICPA 1BW9A 2C7GA 4Q39A 3GUYA 3VZPA 3VZQA 1Y8RA 2IZ1A 5DBFA 1FDUA 1I24A 4J1QA 1DDOA 2NVWA 3I9LA 3WG9A 2YHIA 4Q3CA 5EQDA 5L7WA 4CLDA 3TOXA 3NTRA 4WLUA 4AJ1A 3WWZA 1UP4A 4PZCA 1OC2A 2DAPA 1R4MA 4CMHA 3F1KA 1AXGA 1K6JA 5HM8A 2EXXA 2DPHA 1PJTA 1PGJA 5JPIA 1Q2XA 3UW3A 4CV0A 3QQPA 2HK9A 2P9GA 4I5FA 5THQA 2PGDA 3PWKA 1PR3A 2OBNA 1YQGA 4O1MA 2D5CA 2OGUA 2ZTUA 3G1UA 2PZMA 4OOEA 4S3MA 4YAEA 5F1PA 1YXMA 3U4CA 4BO4A 3BZUA 2GN9A 5DF1A 1I0ZA 1PJLA 3FD8A 3GVCA 1LNQA 4OYRA 5EMHA 1KYQA 1TXGA 1M6HA 4BQPA 7ADHA 1XYGA 1DC3A 1MFZA 3DL2A 1R12A 4N18A 2J5RA 1QV6A 4CLOA 4AJ2A 2DUWA 3AY3A 4L75A 4ND5A 2GERA 4D45A 3RKRA 1EUDA 5A9SA 1QYCA 1RM0A 1PJ2A 1PSDA 3FNEA 4L4XA 4ZQBA 3WGTA 1A27A 4P4NA 3F3SA 2VHWA 1LDEA 3WR5A 5A5EA 3IP1A 3DXFA 3K5PA 2HJRA 4PLGA 4ZRMA 3JD4A 3JQFC 2BFOA 2JD0A 3HUDA 1UXIA 4AJEA 4BO0A 4D0RA 2H5LA 4N7RA 5ICMA 2AEMA 3U4DA 2D3TA 3LSYA 1VJ1A 2IEDA 4F3YA 4Z9FA 1NPYA 4MKZA 1V3UA 1LXCA 1TT5B 4UUOA 1IL0A 3WFJA 3PPIA 4E2WA 2C20A 4RPGA 3L4SO 3TFOA 4XYBA 1DRWA 4E12A 4W99A 4MOWA 1HDRA 4W9NA 4DC0A 5L51A 1ENPA 1QMGA 4CM9D 3PYLA 1C14A 1CERA 5C7IO 5KJ1A 3PK0A 3CTMA 3BHIA 5KIAA 3IAHA 5K9ZA 4AVYA 2FPGB 5L9AA 4JLWA 2RH4A 1GUZA 4F46A 5CEEA 1A71A 1KY4A 4IBOA 4IDFA 1ZK4A 1Z73A 2R6JA 5ENVA 3ANLA 5DNAA 1ID1A 1C0LA 5KVCA 2I66A 2ZQYA 3NJ8A 3FI9A 5TRTA 2Z95A 4WOKA 3I4FA 4CODB 3CIFA 4PLZA 4YQZA 2DBRA 2Q4BA 5JO9A 3L4BA 1X13A 4RLSA 4B8ZA 1LC3A 4Y6RA 3EY4A 4KUHA 3ZWAA 1GCUA 4I9NA 4YDRA 2G5CA 1ENZA 1IYZA 3CPSA 2W4QA 3D4NA 2PD6A 4PLVA 4DBVO 3MEQA 4B4VA 1IUKA 5BNIA 1OBFO 2BFPA 3FWNA 4YTEA 1A7AA 1U1IA 1DAPA 1MV8A 3GDGA 3OETA 3PQFA 4YAGA 4EI2A 4MDHA 2AG5A 3G0OA 3ZWBA 3PLRA 4PIVA 1N9GA 3G79A 3DZJA 4ESOA 4AFNA 2J8ZA 1E1NA 2RCYA 1XQ6A 5EL0A 1NHWA 2HUNA 2UAGA 2WM3A 1YH3A 3CSDA 4XA8A 4TVOA 1U28A 5IJZA 3FPLA 2OZPA 3CH6A 1U7TA 2IYPA 3GGOA 3MCVA 4OMUA 2VHVA 5KJEA 3ZWYA 4BO9A 2A94A 1S7CA 1YDEA 2E37A 4LMRA 2UUPA 5IZ4A 3R3JA 2I9PA 3ZW9A 4U6QA 3W8FA 3ANNA 3RUAA 1FJHA 2OHXA 1YBMA 4TROA 3PQEA 2YY7A 3JQ6A 1DXYA 1J0XO 3DBLB 2I5PO 4FSHA 1HETA 4XB1A 3TL3A 5B1YA 5JDIA 2C2YA 2E48A 1KC1A 1GQ2A 1A4UA 3M2TA 3OF2A 4O5OA 4ALIA 3OHSX 5G0TA 5KOIA 5KVSA 4BNVA 4B4WA 1QXSA 4PZEA 2JD1A 2DU8A 4JN6B 3K30A 4RF2A 3ZNNA 1KVSA 4DXHA 5KWEA 1BRMA 3BMQA 3FR8A 1YJQA 3ZCXA 4ZVVA 1PGOA 4YT2A 3GEGA 1Y1PA 4ND3A 4RPLA 3LK7A 3QWBA 3NTOA 5K6AC 4XGNA 4XGIA 2AQ8A 1FMCA 2EP7A 3PJEA 4NH4A 5CEFA 1IOLA 4D42A 2D2IA 5CDYA 3P2OA 1B2LA 2WD7B 1GAEO 3LZ6A 2OOSA 1M76A 3WQSB 1I3NA 1CQJB 4IMPA 1EE2A 3GC6A 4FC6A 3WB9A 5DZSA 3ZWOA 3H9EO 2FR0A 4CLEA 6ADHA 2B36A 1PIWA 4ZD6A 1BGVA 2LDBA 4EJ0A 4MVJG 3G1TA 5IG2A 2JFHA 2X1HA 3QW2A 3GGPA 5BSFA 1GYPA 3JQFA 2QX7A 3C7DB 1PJ3A 5L40A 5CP8A 2PD4A 3F4BA 3SJUA 3PYMA 3TNLA 3VOSA 4B4OA 2YV3A 3QJ5A 3U09A 3IJPA 5U4QA 1JLLA 2C5EA 1ZW1A 5BQFA 2C07A 2P4HX 3ZNPA 1CWUA 4DA9A 5CG2A 2RHRA 3IMFA 1PJSA 1Z6ZA 3C1TA 3DBHB 3LQFA 4XQGA 3D7LA 4Z0PA 4UREA 3VPHA 5A5FA 1GL3A 4MVJF 1LDMA 3WGIA 5G4KA 2HK8A 3SBOA 5K0ZA 3H7AA 4CM1A 4CR6A 2VWQA 4QQRA 1HE3A 2Y1CA 4CPDA 1PJQA 4NG5A 1HKUA 2XXJA 3WLEA 3RBVA 4BNWA 3QWFA 1QSGA 1ARZA 1ULSA 4CM6A 2JCXA 4AJIA 5IXYA 2GLXA 3JV7A 3BTSA 1E0DA 3F1LA 4BNLA 1JAYA 2B0JA 1HYEA 3LT2A 5KCZA 3TRIA 2BLLA 4ZU3A 5A04A 4TKLA 3WYEA 4FOSA 4MVJA 1HDCA 3RBXA 4DL9A 1LSOA 3B20A 3I9NA 4P8RA 5G0VA 4BQRA 3KSZO 3PYXA 1ZSNA 2LDXA 3ZV5A 1V6AA 4E6PA 1AHIA 2CZCA 5ITVA 3DZHA 2V6FA 4IDCA 3LU1A 3O38A 1AXEA 3PJFA 4ZRNA 4XIJA 4DREA 2GDZA 2W98A 1JWBB 2PA3A 1XQ1A 1DHTA 4OXYA 5CAEB 1YQDA 2NU8B 3HJAA 2DM6A 4CJXA 4XGKA 2CVQA 2ZJ1A 4P38A 1QYXA 2PZLA 4NHEA 4Y6PA 1WPQA 4RQTA 2P5YA 1EVYA 1YE3A 2X4GA 2X5OA 1N1EA 4QEDA 5DP1A 3WGYA 5KVVA 2ZATA 5IAAA 3DZKA 4XYGA 2QZ9A 3MWEB 4DYDA 4EW6A 3N7UA 3RFXA 2YW9A 3DMTC 4BV8A 2FWMX 2FPGA 5JAQA 1P1IA 2NWQA 3GG9A 4R68A 2ZCUA 1YJ8A 1I8TA 3SEFA 1C1XA 2C5AA 1E7SA 3SLKA 4WECA 1H2BA 3AJRA 4IS2A 4JGBA 1EBUA 3FTPA 4G5HA 4X54A 1T2CA 3INGA 2ZB4A 4IQ8A 3JQGA 4ND2A 1E3SA 2YFHA 3FN4A 4MVJI 4GMFA 1ZJYA 2DT5A 3ZU5A 3WWYA 1P77A 3HDYA 3KHUA 1IULA 3KRTA 1PJBA 1ZXLA 3UN1A 4XDZA 4FR5A 3M1LA 3B1JA 1IPEA 2C29D 4FFPA 4R1TA 3VKUA 3RAJA 5BNFA 3GN2A 4J1TA 4GWKA 3E6AA 2PLAA 2I67A 1CIVA 3CINA 3CKYA 3FCOA 1BG6A 5H81A 1QLJA 5G0UA 3VPFA 1W6UA 4IZIA 2QZZA 2I3AA 2WYVA 1T2DA 2PNFA 5KJ6A 4H7PA 1NQAO 1PL6A 2ZTVA 1GD1O 3W6UA 1LLUA 4EYEA 1Q7GA 4ROSA 1P33A 2VCYA 3O9ZA 4RF4A 3UICA 1MB4A 1NTOA 2NM0A 1KVRA 4HFJA 3G49A 3QV1A 4BKUA 4LSWA 3O8QB 1NQTA 4E5MA 2Y05A 5U9CA 3H65A 4XR9A 1O0SA 1ZBQA 1I30A 2OUIA 3NDIA 3FSRA 3OFSA 4D0SA 3AUTA 2EKPA 5B4VA 3QVTA 5A06A 4BNYA 5EINA 4FQ8A 5A03A 5MDHA 2ZIZA 3MOGA 2HJSA 4JJIA 5TF4A 3HNPA 3ORFA 4ZJUA 1R66A 2Q2QA 3U49A 2Z5LA 5EPOA 1HWYA 4YXFA 2AMFA 1C0PA 3EC7A 5JXWA 3U4HA 2P68A 3RUEA 1VE9A 2Z1MA 3GVXA 4IMRA 4J4HA 3IP3A 1BHSA 5IN5A 5TT1A 5EJ2A 3FNFA 4YRBA 1ISJA 2D4AA 3PFWO 1J4AA 3U5TA 2UV8A 2EWMA 3DBRA 4GLOA 2JKVA 4RCVA 5A05A 4FJ2A 2IRWA 3DOOA 1NFRA 4O0LA 5THKA 4Q3EA 4DQUA 1F12A 2CFCA 2VZ0A 3ONFA 1Z7BA 4EGFA 3OBBA 4Q3NA 2Y0CA 4Q3AA 2GF2A 4D43A 1UJMA 2WD7A 1KVTA 4YJHB 2PH5A 2GUGA 3C1AA 1CQJA 2WYUA 4CV2A 1RM4A 4NMHA 2BI8A 1A72A 3WSWA 1U3WA 1ONNA 4BS9A 5MGBA 2X9VA 4KUEA 4AJPA 3D3WA 9LDBA 1RJWA 4R1UA 4BO7A 2FN7A 1CQIB 4J9VA 3TPCA 4E5KA 5FFFA 1E7MA 4NBWA 3SJ7A 1X1EA 2CD9A 2QYSA 2P9EA 1JW9B 1EVIA 3ZHXA 5BNTA 2DFVA 1O6ZA 1H94A 3GZNA 4U5QA 1DBVO 4CV3A 2X5JO 1IE3A 4R1SA 1M67A 4HFMA 3TQHA 4GSKA 1OC4A 3DBHA 4WLOA 2XF8A 1EK5A 1PTJA 1WZIA 2B4RO 3GH3A 3LDHA 2IZ0A 1Q0QA 1NPTO 2BF7A 3TZ6A 3ZDFA 4UAGA 4BO8A 4BV9A 4C7JA 5BSEA 3RVDA 3Q2KA 5LDHA 2NU7A 1IPFA 1VLLA 3ZNQA 2XXBA 2CNBA 2IDZA 4CQMB 4CLRA 4Y8VA 3EDMA 3P5SA 3AOGA 3DAFA 3ENNA 1E6WA 3DEYX 3QWAA 5JDCA 3K92A 3UKOA 3BTUA 4GL4A 3TF5A 4BNTA 1JKJB 1G0OA 1NWHA 1TT7A 3AOEA 2YQ5A 1DRUA 1GZ3A 4A03A 2O2SA 2VHYA 3NAQA 2Q2VA 1AN9A 1TB4A 2EIHA 2TMGA 4MVJE 1MC5A 1I2BA 2HO5A 3E18A 5JC1A 3PDJA 5GY7A 2HRBA 3JCZA 5IZCA 5GZ6A 4ZQEA 5JAZA 4OM8A 3ZHBA 5CAEA 2VUUA 4NDNE 2PZKA 4XR4A 1ZSYA 3RQSA 1QYDA 1I01A 3FPCA 2GYYA 3W8DA 3WYBA 1K0UA 2Q1SA 1NQOA 3CMCO 3ULKA 3O03A 3D5TA 4J7CA 2OBYA 4J2OA 2DKNA 3WQQA 4MP6A 1UP6A 4RVGA 3UF0A 4OKIA 5GZ1A 1ISFA 3FR7A 1M2WA 4OH1A 4K26A 4JBHA 3WMXA 4BNZA 3BMNB 3GHYA 3C24A 4QECA 3H8VA 1OOEA 1HDOA 4FPXA 4OL9A 2GGSA 1N1GA 4YCAA 1OI7A 3WGQA 3KETA 2AA3A 2ZKLA 1Y8QA 1MUUA 4FFMA 5GMOA 4CMAA 4CM8B 4PG7A 1YRLA 3UGKA 4IDEA 5C5IA 1E1KA 4R41A 3ZW8A 1HF3A 1XA0A 2HRZA 3U0BA 3WTCA 3KEOA 2FSSA 3GPIA 3HSKA 3WIDA 4DLLA 3BIOA 3HDQA 4FFRA 3RUHA 4CMJA 2OXIA 2DTDA 1ZNQO 3CZMA 1HE2A 4XWYA 3AUUA 2V7PA 4DVJA 3DTTA 1LRKA 4NIMA 1JA9A 3PQDA 2PKQO 3TZQA 4B7CA 2Y1EA 1NQ5A 1QR6A 1H0KA 3NT4A 3DDNA 3UAGA 3RROA 3FHLA 4AJKA 4M1QA 5L4NA 3V1UA 3ETGA 2Y68A 1WNTA 4KOAA 3KYCB 3KYDB 1MA0A 1F14A 2H6EA 3FTNA 1QKIA 3AFMA 5KJCA 4E13A 3M2PA 1BDBA 1QORA 4B3HA 4J91A 4WNIA 3OEWA 4UEJA 3JYPA 3W6ZA 4PLCA 4EDFA 1VRWA 2Y1GA 2GD1O 3F46A 3NX4A 2C0CA 3PFFA 1Y9AA 1YDWA 2CVZA 3D0OA 4QO7A 1ZKMA 4JP2A 1DLIA 4J7UA 2Y1OA 3ZV4A 1LA2A 4ZA2A 5B4TA 3E8XA 3A06A 3IQDB 4FD3A 4GI2A 2HLPA 4PRKA 5C7OO 4CL8A 4KQWA 3GZ4A 1EE9A 1DC6A 1HYGA 1D8AA 1P45A 5DOVA 4D46A 5KNLA 1E5LA 1I3LA 3GRKA 2D8AA 3QVWA 3DFZA 2BFMA 1F8GA 2EG9A 1BWSA 4PCVA 4RO0A 4NFSA 4WCDA 3VH1A 5B37A 2C7VA 1SCUB 1ISMA 1BXGB 1LX6A 4J43A 2X9NA 4R4JA 5DCYA 2B5VA 2FY8A 4IJVA 3NDRA 3JQEA 4B4UA 1SMKA 4KWIA 4D3FA 4TWRA 1QP8A 1T2AA 1PEDA 4RVHA 3UH1A 4BOYA 2NTVA 4YT5A 3WTBA 5H82A 1VSUA 1QYWA 3RKUA 5JE8A 1WZEA 5ITWA 3PHIA 4F6LA 1BDMA 4N5MA 3GF4A 1BVRA 1T24A 4IUYA 4U7WA 1JN0A 4BO1A 3PZBA 1YL7A 5COBA 5CDTA 1MC4A 4RLHA 4CMEA 3WQRA 4CM9A 3GFGA 3ZN2A 1DIHA 3G17A 3PHLA 4E5YA 1I5RA 4KP7A 1K6XA 3ZWMA 1VM6A 1MG5A 3JD0A 2O7SA 4KDEA 1C1DA 1KS9A 4URFA 1ISIA 1WDMA 5T5QA 1RM5A 3RUFA 1DC5A 3DTYA 1P1RA 3FWZA 1LQTA 4M54A 1W0CA 3K8ZA 5J23A 2O3TA 3LC2O 4KZPA 2O4CA 3JD1A 1DIAA 3OP4A 3SVTA 1HE5A 2Y0EA 4BL5A 1XLTA 1NFFA 1P0FA 3KO8A 1YO6A 3CZRA 3NTQA 4OHUA 1PZGA 3S2IA 4PLHA 2ZTLA 3GMSA 2F1KA 3PJDA 3E82A 3EK2A 3K96A 2NTJA 5KKCA 4IS3A 4WLFA 1WXDA 2IXBA 2C54A 3GAZA 1K5HA 2ZQZA 4QO8A 4TZKA 4Z9YA 2VT2A 1PGNA 3INRA 5AOVA 3L6DA 2ET6A 2GZ3A 1I33A 3C8MA 2JD2A 2X58A 1NR7A 3W1VA 3L9XA 3H3JA 4CMIB 2VTDA 2VYVD 4WNCA 1LSSA 3GNSA 4RVDA 4NNJA 2YZ7A 1UAGA 1MFPA 5B12A 3RC1A 2BH9A 4XD2A 4WLNA 1HDYA 4U0JA 3D1LA 3QP9A 4DIFA 5A1TA 3QWIA 2FP4B 1Q0LA 3AM3A 3EUWA 4P4LA 1NM5A 4KTTE 1MXFA 2Y1DA 3R6DA 5DP2A 1DJNA 4WUVA 1PR9A 2IZZA 2VHZA 4RPHA 1TLTA 4NFYA 3NT2A 5A9TA 4YWJA 3LT4A 4BO6A 3VZSA 2O2YA 1FDSA 4GQAA 4IDDA 2FSVA 4PFJA 4D7AA 1EDOA 4J0FA 4R9RA 1SPXA 1GY8A 3DO5A 4CQMD 8ADHA 3EVTA 2X0IA 3NGXA 1U8FO 3EGOA 4YT8A 3P19A 2B83A 1HRDA 3GVIA 2QQ5A 3EMKA 4IZHA 1GZ6A 4CM8A 4J4BA 5JMPA 2NVUB 1E1MA 1V3VA 3ADPA 4CM7A 3TDKA 3WYCA 3OJOA 1EUCB 1DIRA 4UVHA 1X7GA 3ABIA 5JC8A 4GGPA 1F8FA 2WYWA 3EYWA 1UZLA 2BELA 3H3FA 3MTGA 1BTOA 1GUYA 4EUHA 5EERA 2QRLA 1PL8A 1I36A 5BT9A 3ZV3A 2DC1A 3M1AA 4OXKA 1U9JA 3NEPX 2BGMA 4HX5A 4HV4A 4FJ0A 1OMOA 4IJWA 1XIVA 4N54A 1G1AA 1EDZA 1P1KA 1WDLA 3E9MA 1YB5A 1E3IA 2VYND 1HE4A 4FBGA 3JQ9C 3ASUA 3KM0A 3VAZA 1ONOA 2CDCA 3CEAA 2NQTA 4XRGA 4IM7A 1QLHA 1PWXA 1UUFA 5HA5A 5TT0A 4LK3A 2W8ZA 1E7YA 3DOJA 4U8GA 1O89A 1SOVA 3WMWA 4JK3A 4TQGA 4JXKA 2Q99A 3Q2IA 4U0KA 1W73A 4UEKA 3OEYA 5HWSA 2POQX 4D79A 3KYCA 1GYRA 2AG8A 1F06A 1LRJA 3MJ4A 3IKTA 3AY7A 2NACA 2IODA 4F6CA 4E4YA 5C3MA 1ZUD1 1DO8A 4O59O 2F00A 5AXDA 3KXDA 1EEHA 3R1IA 1FDTA 2VNAA 3I3OA 4GPD1 1NBOA 1DJQA 5AQ1A 2WE8A 1XR3A 4HBGA 3HB4X 3AU8A 3K31A 4WOJA 4I9HA 4TRMA 5TNXA 4L73A 5IDWA 4U6SA 1GEGA 1VJ0A 4WEOA 5JCJD 1VKNA 5DULA 3IDSA 2YDXA 4JQCA 2A4KA 5DT9A 1TI7A 4E5NA 1TEHA 4ALJA 5I9LA 3RCBA 3KYBA 1SCUA 1BXGA 2O7QA 3NDJA 4WGGA 4AG3A 1DSSG 1PX0A 1JQBA 2NNLD 2EV9A 1ISGA 3L9WA 4R3WA 3ZHZA 3GR6A 2ZB8A 1HL3A 2NU6B 4XX0B 5G0WA 4QUKA 3E5MA 5CPFA 1I2CA 3O26A 4NPCA 4RQUA 4AJOA 4NJOA 3BMCB 3D5QA 2JHGA 3KSUA 1RKXA 4O6VA 3WIEA 5JNLA 4WEQA 1PL7A 2O3QA 1AHHA 4TKMA 2RAFA 4RZHA 2J3IA 4UVEA 2FZWA 5FF9A 2J5KA 3ST7A 3H9GA 4B8WA 1WVGA 3LLSA 4CR8A 4ND4A 1FXSA 2IYOA 1AUPA 3I5MA 1R0SA 2NSDA 5BSGA 2P9CA 4E5PA 4I5EA 4BNKA 4MINA 4E30A 2ZJ0A 4RF3A 3AUAA 3GAFA 3P7MA 4DGSA 5IXSA 2BGKA 4TMFA 4ZICA 2AHRA 4R5MA 4GVLA 1K6IA 5JMWA 1ZO8A 3JYNA 2DQ4A 3TJRA 4JCOA 3WGOA 4CR7A 3QY9A 4NQZA 4DMMA 3JQBC 1ZXBA 5FEUA 1R4NB 5FWNA 4L4SA 2VN8A 4IIVA 4BKQA 2GNAA 2PK3A 4WCFB 2E6UX 1PS0A 1TT5A 1P1JA 1PGPA 1EMDA 4PG4A 2VUSA 3ITDA 4ALLA 3U4IA 3MJCA 4OQYA 3GDFA 1NNUA 1UDCA 3PIDA 4IGFA 1OFGA 5JY6A 3WSVA 3ADOA 4BIIA 3GVPA 3RC9A 5L3ZA 3DB2A 3S8MA 3OMLA 4Z0HO 1N92A 2FPPB 1KEUA 4UUPA 3MJVA 5G4LA 4CUZA 2FP4A 2RHCA 3AUSA 3CMMA 3KEQA 4LISA 1D7OA 2QRJA 4KDFA 3S2GA 3E1KA 2EF1A 5CDSA 3QVXA 4TRRA 3IJRA 4FIZA 4YEDA 4HUJA 3UXYA 3OIFA 1UDAA 4YAIA 4FN4A 2X0JA 2V65A 3W4JA 4NZ9A 1XEAA 3GFBA 1SB8A 4BMSA 3AWDA 2FZEA 2EEZA 3NKLA 3ROKA 3EVNA 3PDUA 3PXXA 4ONEA 4PLPA 3JQAD 1LC0A 3L07A 4GSLA 3JQCA 2X7HA 5TC4A 1SB9A 1EUCA 3V2UA 5T67A 1DHRA 3VPSA 4EITA 4I1IA 5CDUA 2FOIA 4ILKA 1PGQA 1KOLA 2VZ9A 3IUSA 4WCFC 3F47A 4MIYA 3LYLA 5K6AA 1ADGA 5C7LO 2YQ4A 3JTMA 4YJFB 4BGVA 2JL1A 4MVJD 1Z74A 1N2SA 2NADA 1YOVB 3HADA 1JVBA 3PRJA 3QRWA 3W4IA 5ICSA 5HRUA 4YR9A 1Q7CA 1LBEA 5I8ZA 5L7TA 4XZ3A 1H9BA 1VI2A 4AICA 2BFAA 4E33A 1HEUA 1X14A 2GN8A 3JQ7B 4PLFA 2Q1UA 4LVCA 3L0DA 4GLLA 3ZHYA 2HMWA 3H9QA 2QHXA 4XEHA 3HQ4O 5JO0A 2PKRA 2ZCVA 3D4PA 3LF2A 2AQKA 1Y6JA 3FBTA 3NUGA 2Y67A 4GGOA 4HADA 4UVIA 1U3TA 4ZN6A 2HKIA 3DBLA 1LDBA 2G76A 1DIBA 4UVDA 1GV0A 1P44A 2DFDA 3MJSA 5IF3A 4AJLA 3I9KA 2HMVA 1GYQA 4GWGA 3JSAA 4J49A 3X2FA 4LRTB 2CMDA 3MWDB 3TL2A 2NQ8A 4BB6A 4JX8A 1ZK0A 2JCYA 1EBFA 4XQCA 5HS6A 2O50A 3PVZA 1IB6A 3DAGA 2C2XA 4A27A 1Z75A 2HMSA 5TGDA 5CFZA 2WJPA 4NR0A 4DQXA 1Y5RA 4CM4B 2YUTA 4Y98A 4L4RA 2BI7A 1A5ZA 1ZVMA 2EW2A 1SZJG 3PGXA 4J3FA 4N5NA 1C0KA 4CQLB 4CUJA 1HSOA 1OZAA 3JD2A 4II2A 3JQ8B 1KVQA 1T1SA 1KEWA 2OORA 1T4BA 1YL6A 1V3TA 5I9NA 1ORRA 4NJMB 1KETA 3DZGA 1GU7A 4W6ZA 3E03A 2O4UX 4IXWA 3JQBA 1TVEA 4XYEA 3OQBA 1D1SA 1RYDA 4FW8A 1BW9B 2PKQP 3GG2A 3ZWWA 1E6EA 4BNXA 2Q46A 1RYEA 5EIOA 5I8WA 3WXBA 1UXJA 2NU6A 4XX0A 1Y8RB 2AXQA 2X0RA 4XQ9A 3BMCA 4YAJA 4RZIA 3EZYA 1ADBA 1V0JA 1RWBA 1L1FA 2EKLA 3MZ0A 1X1TA 1LQUA 3TFQA 1YB4A 3GEMA 3VKVA 4BVAA 4NBRA 3FBGA 4A5OA 4IDGA 1B8VA 1R4MB 1KBZA 1UXHA 2HAEA 5JAMA 3TN7A 3DMTA 4FS3A 1O5IA 2J3KA 4DLBA 3BHMA 1G6KA 3D3EA 5T57A 2W2KB 2NUAB 4NBTA 4YACA 3T4XA 4MIEA 3PGJA 2VRCD 1LU9A 4FJ1A 4MVJP 3ICCA 1ZEMA 3BTOA 3UCFA 1SEPA 2FPIB 4J4TA 4R1NA 5C37A 4IINA 1ULUA 3SC6A 1T1RA 1V8BA 3LLVA 3LC7O 4RVUA 1ZK3A 4XRRA 1ZSVA 5L53A 2Q3EA 3E9NA 3QLJA 2J3HA 3H6KA 4BKOA 3ZI0A 4A73A 1GPJA 2Q49A 4Z9XA 3H4VA 3KLMX 3SC4A 2A9FA 1B0AA 1JWAB 1PS9A 4CLOB 4Z6KA 1ZMOA 1C3VA 5IFLA 1SEVA 1EUDB 4RV9A 3BTVA 4G81A 3T7CA 2AQIA 4DTIA 3OICA 3Q3CA 1E3WB 4DC1A 1U8XX 5EQFA 1YBVA 2NU8A 1Y5MA 3DQPA 1NP3A 3GVHA 3QSGA 4DRYA 1XHLA 3BA1A 1UR5A 3VH2A 4AJHA 3GOHA 3S55A 1NASA 3GDOA 2OO5A 4INAA 4EUEA 3AW9A 3I6QA 1LLQA 4UULA 3DR3A 5HBRA 1Z45A 5H83A 2GO1A 3MWEA 4BNUA 4DQVA 4BKPA 2UDPA 3A14A 4G65A 5DCUA 5JLAA 3GQVA 1IHYA 2D59A 4PGFA 3UCXA 3ZWPA 2WEKA 1LSUA 3C3XA 3KZVA 5JFOA 1PQUA 4GX0A 3ZU4A 4RJTA 1VSVA 3C85A 1HZJA 3GPDG 3VDQA 3VTZA 5CDGA 3FNHA 2X0NA 4LGVA 4RL6A 5TIIA 4B3IA 1VC2A 1LDYA 1R0KA 4BKRA 4PZDA 3U3XA 2Y99A 1D4FA 1O9BA 2ZTMA 2VHXA 1MG0A 3N74A 4G2NA 2PV7A 1UP7A 1WW8A 4M87A 4BO3A 5CG1A 1NVTA 4KUGA 3RWBA 1K2WA 1J5PA 3GGGA 2Q1TA 1KVUA 4WJZA 5L95A 4XKJA 1FDWA 1GPDG 1I10A 1R37A 1E92A 2OL4A 2ILTA 3WBBA 3H2SA 1XDWA 1YWGO 1ADFA 3C7AA 2QRKA 5TJ9A 3RASA 2DBZA 1SC6A 3A4VA 4JBIA 4C4OA 1P74A 3I1JA 1WAMA 3PLNA 4MVJH 2X86A 4NU6A 2NLOA 4AJNA 2E4AA 3I6IA 4N5LA 1H6CA 2PY6A 5T64A 4HP8A 1B15A 2GN4A 3O8QA 5DDIP 4FC7A 3HG7A 1N9GB 1HTBA 4A2CA 1ADCA 4KWHA 3T4EA 4M49A 1E5QA 1XG5A 1H6AA 1EFLA 4LMPA 4Z3DA 4TZTA 1Z82A 2CF5A 3K9QO 3X2EA 4QT0A 2AEFA 1UH5A 2I65A 1MP0A 2FRDA 4J1NA 5AXBA 2NV6A 4ZQFA 1PS8A 2VUTA 4XCVA 4IJUA 5KVQA 2QW8A 4D3SA 4HXYA 3AM5A 1EQUA 4K6CA 1DIGA 4HNGA 3R0IA 1VL8A 2VQ3A 5F1OA 1BSVA 4XYLA 2O3SA 4R3NA 4HNHA 1CRWG 2HU2A 4I08A 5CPBA 5IDQA 2HDHA 4PG6A 4MP3A 3K6JA 4XDYA 4CL3A 3MWDA 2QYTA 3Q1LA 4OXNA 1SAYA 4R54A 3V8BA 1XSEA 1HXHA 3D64A 4CMKA 3TWOA 3ITKA 3L4BC 1RPNA 1HYHA 1K3TA 2YYYA 3OIGA 3KV3O 1X7DA 3ROQA 1HLDA 4DPKA 6LDHA 1N7GA 2I99A 3B1FA 4LSMA 4OOFA 3KSDO 5U1PA 3KLPX 2W2LD 3C7CB 1EQ2A 3PHJA 3BMQB 4TVBA 3RSHA 1GCOA 3VVCA 4CQLA 2R00C 2XOXA 4K9DA 4YJHA 4BO5A 2JFFA 3JQ8A 2Q1WA 3BHJA 2I6TA 2HMUA 1VPDA 3A9WA 4J2HA 3ZWXA 1H5QA 1JVSA 3E9QA 1O95A 4HY3A 4YA6A 2GPTA 1VJTA 4KTVE 3TZCA 3Q0EA 3GLQA 1CDOA 2HSDA 2PR2A 3KB6A 2B4QA 5EESA 2EHDA 4ZGWA 2ZYGA 5LDGA 1CQIA 1FF9A 1HT0A 3F6YA 3L6EA 4GKBA 4ND1A 4DLAA 4CMGA 4NBVA 4MP8A 4OAQA 5IN4A 5AYVA 2VT3A 2FHSA 3LC1O 1H93A 4BUCA 4IGEA 1U5AA 1NAIA 3GHHA 3S2FA 1NYTA 1MLDA 4UUNA 2VYVA 1E3EA 2CF6A 3SX2A 3VPGA 4WPGA 4EJ6A 4B3JA 4R51A 4RORA 4FOOA 3ZU2A 5LCXA 4XQEA 1F17A 1KEPA 4YPOA 1PQWA 4ALKA 1PZHA 4PLWA 4RVFA 1BVUA 2EKQA 3ZU3A 1LRLA 3ONDA 5JDIC 1G0NA 3IC5A 1JLLB 2Y66A 3GN1A 2Y0DA 2W2KA 2NUAA 5I7SA 5TJHA 1E3JA 4DIOA 2C59A 2EW8A 4BGEA 1QYVA 3TZKA 4CQMA 4H16A 3QIVA 3F4LA 4UVGA 4YRAA 3JQAB 4FGWA 1V9LA 3BAZA 4RDIA 3JYQA 4J9UE 5HTOA 2FPIA 1WMAA 1L7DA 1B26A 1JKJA 4MIOA 9LDTA 2R2GA 2D1YA 4D41A 2V6GA 1SNYA 2D5AA 3OIDA 3H9UA 2H1SA 2Q45A 1Z7EA 2RIRA 1HZZA 4WLEA 2ZK7A 4H3VA 3R3SA 1H6DA 3QA9A 1M75A 3PI7A 5ES3A 3INTA 1PZFA 3TOZA 4LW8A 3W4KA 1E3WA 3PP8A 3KUXA 1NVMB 5I9MA 5GZ3A 2PH3A 3VTFA 2DBVO 3ZGYA 4A10A 4EUFA 4DWVA 1BMDA 5CHEA 1WLYA 3BMOB 3OH8A 4DIBA 1W4ZA 4PLYA 5I7FA 5JYDA 2AW5A 2GR9A 4GH5A 2VYNA 3VH3A 3S1LA 1HDZA 3D4OA 3SLGA 3IS3A 1EZ4A 3CE6A 2DTEA 3V1TC 1DFGA 2EP5A 2XAAA 3A28A 3PWZA 2QIOA 4IPTA 2CDBA 2NTNA 3U62A 2V6BA 4CM5A 2X8LA 4ID9A 4NK5A 1YL5A 3BMNA 1F0YA 4Q3BA 3JQDA 5G4KB 1N5DA 1X7HA 3VHRA 1T4DA 1P1FA 5F3RA 4YAKA 1V35A 5DCWA 2ZYAA 4W4TA 4EBFA 4BNGA 1HSZA 4A7PA 3F5QA 1GZ4A 4QXMA 1A9YA 4BNNA 3HWRA 1ZCJA 1NPDA 2UVDA 5G0SA 3M6IA 1C1XB 3H9JA 4I8XA 4IDBA 3OA2A 3JYOA 3WGZA 3P2YA 5F21A 3JQGB 2BKAA 4BO2A 3ANMA 3VVBA 1R15A 4I5DA 2PGJA 1GQYA 1U7HA 2VOJA 3KTDA 4NBUA 1ZK2A 5JCJA 4B79A 4CUKA 1YBAA 1LUAA 1SOWA 2E49A 3L77A 1OAAA 5AXCA 4ALMA 4Q9NA 4WLVA 3RFVA 4M89A 2SCUB 3E5RA 2VZ8A 4L0QA 5KKAA 2JJYA 2R00A 5FI5A 4B7XA 2WSBA 5IDYA 1IY8A 3I83A 2JAHA 1ZIDA 4WK6A 2WE7A 3UCEA 3GY0A 3ZZNA 2B69A 2FR8A 3QVOA 4Q3DA 4IJKA 1YVEI 4L8VA 2YJZA 2AQHA 4KQXA 1P0CA 1I3KA 3DWFA 2BGLA 4XYMA 4OGWA 1GTMA 1LLDA
chains in the Genus database with same CATH superfamily
3H2ZA 4JP8A 2WM9B 2ZJ4A 2DMRA 3HB5X 1LS1A 1GAJA 4F45A 1GFSA 3THXA 4YVFA 2V3WA 4RF5A 3H8WA 3RVRA 3PUKA 5LP6F 1U11A 4LHXA 4WTOA 1CF2O 1SHUX 3KTAA 2C4KA 4UDNA 1M5TA 3NVDA 2W4IA 4TUYB 3W1EA 1J00A 2X7XA 4JNKA 3F3MA 1V43A 1EDEA 3HU5A 2AFHA 2ES4A 4YCSA 3BWYA 3DM9B 1GADO 1SU6A 1RAEA 3DKKA 2QN3A 5KNCD 2BFNA 4YMHA 3VYTB 1W9HA 2HI0A 1D03A 2HQBA 1JMVA 2WWRA 4II3A 4L9RA 4Q12A 4ZVSA 4KCGA 5HJ5A 4B2IA 3B1XA 3H13A 3WB1A 2CL0X 1RZRD 3SQXA 2ASEA 3OHMA 1EXVA 2HNKA 3IPYA 3QI7A 1L5YA 4A23A 2WKRA 2A67A 4OGFA 4A6DA 4Y9DA 2H5JA 3KU4A 4KO1S 4H7KA 2K87A 2ZRDA 4U2CA 1Z6YA 3U3MA 5JAIA 4C76A 1AB6A 1ZOOA 3DHYA 2Z4SA 3CGWA 1SUAA 4XWTA 1HTTA 2NU9B 4YK7A 5TY0A 2Z30A 3Q9UA 3EC2A 1PU2A 3I52A 1DEAA 4EY6A 4R9NA 4X65B 1YB2A 1IN8A 1R6DA 2QD5A 3OFND 4QOSA 2C9BA 2KHZA 4DIEA 1QZZA 2NVOA 4J0EA 3COSA 2FQ1A 4ER5A 3AR4A 1J0EA 1P73A 2UYYA 4QBFA 4UNNA 3UJ7A 2RGRA 3BYZA 3N2NA 1E94E 3OEEA 1FK8A 3ZD7A 4QLOA 3GFSA 4MYSA 3D31A 3LKBA 4EB0A 5A3JA 1RQNA 4G3XA 4KDRA 1HI9A 4KXWA 5EMLA 3HGTA 2M6SA 4IRMA 4NE9A 1PEYA 5AXAA 3VSDA 1WIWA 1X1SA 5FL3A 4M86A 3GZNB 1SJ9A 1C3EA 3EEYA 1FQOA 4EJMA 2IE0A 3K32A 5B3LA 2PJZA 1ODFA 2HHAA 5E6UA 2UUCB 1H6BA 3OA0A 3NGLA 4P4SA 2XDQB 5EN4A 4Z4IA 1NZDA 5DT2A 4CYMA 1LVUA 3AP2A 4MA4A 1ABFA 3A3OA 2G70A 4EL0A 4YX9A 4Y2TA 1FYDA 5KC9A 1HOXA 2PRIA 1QDUA 1F3LA 1XDGA 1TVKA 2VOEA 4ZMRA 2XCLA 3FVWA 2ZRLA 3LLUA 4HI0E 5D3ZA 3JQAA 4UU1A 4D74A 4Z54A 1ISHA 3F71A 3PL1A 1Y80A 2ZE5A 3OECA 3AEYA 3EZNA 3I37X 2X0KA 3AFNA 3R6WA 4UQOA 4PQEA 1B3BA 5H7XA 3G23A 3HBNA 4E2XA 1GFIA 2J32A 4DV5B 2XMGA 1KZGB 3NIBA 1WXEA 1V45E 2FMUA 3N5CA 4G9GA 3VX3A 3D6FA 3ONVA 3U1BA 2I4OA 1W96A 5L45A 3OEHA 3EQ2A 1OWPA 2ATCA 5DHSA 2NOAA 3SGLA 3UFXB 4YRFA 2BL4A 5CDFA 4XCQA 4YMSA 1BXKA 1BWRA 3DAYA 3HYNA 2BM1A 2V58A 2G07A 5JD3A 1O97D 2H9IA 3FCAA 4TRJA 4NBNA 4EUSA 5KJFA 2JVKA 1D4AA 1R1DA 1R2QA 3QMVA 3AM1A 1KO4A 3NP7A 5ALFA 3BMOA 1PDOA 4R7ZA 2AOWA 3NMUF 4NU8X 2VQSA 3N87A 4EPYA 1T5OA 1UK7A 4JJ4A 4AP9A 4FS8A 1XALA 1JLHA 2ZRIA 3QVSA 1E6UA 2DFNA 1MO2A 1GT91 4BNFA 3D81A 2DQSA 2OD7A 3C3EA 2OOKA 3N8KA 2PZEA 4Q1AA 3KVRA 3MW8A 1FNCA 2WDZA 3CW8X 3A1DA 4I1OA 4FR2A 4FXPA 3REGA 4EVIA 1BE0A 2EC5A 2FK8A 3R4VA 1JG6A 4PHGA 1GPWB 4KIJA 4MUHA 2O0JA 4NI5A 4A0SA 4OJNA 1G3RA 2AEJA 2GHIA 1P5HA 2OO7A 2WPDA 3DVLA 4BNDB 3ROMA 3ZU4A 4D56A 2I1QA 2JH3A 3HN2A 4POAA 1TLLA 4IIUA 5CLFA 1OBHA 3Q8LA 3H1AA 4G1EB 3TQQA 3DVSX 4IWNA 5A4JA 3NS7A 1QVRA 5I7WA 1B14A 1R88A 3FAZA 4GBED 2G1PA 1LWOA 3B9RA 2I2XB 3BAFA 3PJGA 1ADJA 5IM4F 3DGFC 1DCMA 2YL2A 4FCCA 5LWHA 1RPZA 1XZLA 1HH4A 4WY2A 3DONA 1N32B 3WDSA 1DX6A 2B21A 5BRJA 3DJYA 5KYUA 4KN5A 1G19A 4BMVA 1NWCA 2HCRA 1IDN1 3LF1A 2Y1FA 4F6RB 1YONA 1TM7E 2WWTA 2A59A 3AOEC 2JJ2D 2XYRA 1BC5A 2WMYA 1ZL2A 2F62A 4P93A 4AKTA 3VDRA 4E7PA 4H2DA 3P4YA 4PZUA 4QOIA 1A9ZA 3ESYA 1DL5A 3GUVA 1W8DA 2FPKA 4ZHSA 5F5LA 3W77A 3RG2A 2GBLA 3HCOA 3RUIA 1H2FA 4OHVA 4LC0A 3UATA 2PCJA 4YAUA 5JBIA 2VQDA 4I3HA 5IZCC 4ZI5A 5TX7A 4XSVA 3MMXA 2J9YB 1HDGO 1YS1X 1E0SA 1DXQA 3Q7QA 2A30A 2PZAA 2XCUA 2YXPX 1KAEA 3MJTA 1E6MA 3CX8A 4H1UA 5ALXA 3RHSA 4CCYA 1G20A 1X0XA 2BRUC 2O3JA 4LDPA 1IXSB 3KKZA 4DTCA 3V7YA 1L1EA 1R9GA 5LFAA 4B2LA 3H5AA 1J99A 2IF0A 2R0QC 1T3TA 4Y6SA 3PTZA 4TLCA 1T10A 1N8KA 1Y89A 4QE3A 4YMWA 2BHNA 5FUVA 1YKFA 2VI5A 3PR3A 5CA1B 3RU9A 2WG0A 4N6GA 5IUKC 5KNBA 5EXXA 3K0HA 5CEJA 4ZJYA 3P9XA 2GYUA 4C5AA 3JXEA 3FM9A 1GTSA 1B8PA 1E2UA 2JGKA 3LKVA 3V2GA 4UTNA 2ZGVA 4JBGA 3AI3A 2OCAA 3EAQA 4YN3A 5EMMA 1UXKA 1XZMA 1DEHA 1JB9A 4KBYA 1OREA 1TJ3A 2HDOA 1YUMA 4A8JB 4OK5A 1YRQA 3P27A 2VRCA 3N3BC 3U4GA 3P0FA 1G42A 1KY5A 1U2DA 4BX2A 2BY4A 4ZU1X 5J47A 3P0RA 2QR3A 1U2GC 1FLNA 5TS3A 4M0EA 2H2WA 4Z1OA 1A7KA 4ZDKA 2XRFA 1M1ZA 4DT1B 1E9FA 2GTIA 2G80A 4UUMA 4J16C 2J0VA 3WBJA 4KJZA 1RRVA 4RSRA 1J1UA 4TQ9A 4KSCA 1QCDA 4XD7A 4DRXA 2Z8XA 1ZH0A 4ZP1A 2C94A 3FCYA 3GJ7A 2RGBA 2RHGB 1WW3A 2Y2UA 1NXPA 3BXXA 4BFXA 1M6WA 3GP3A 1UZMA 3RR2A 1V47A 4G0YA 2V0NA 3NZEA 3BQMB 3AIMA 4NFHA 3VTKA 1GQSA 2NU9A 5DMXA 4CW7A 4HHEA 1TM2A 1KJYA 2PS3A 1FJ2A 4JJ6A 3RIHA 5LXTA 2APJA 5ABPA 3GK3A 4D2IA 2GCGA 1N0UA 3V5NA 4C5CA 4E0BA 1G60A 1B3RA 2YV5A 4FGSA 4JLJA 1N2OA 4GI7A 3VC2A 3TVDA 5I51A 2ZCJA 2GTHA 1JMYA 3OZRA 2EX1A 1ESDA 1Y1QA 3DZIA 3I2KA 3K2EA 3Q11A 1D09A 3G0GA 1T8SA 3H0CA 3NEJA 1J0DA 1QFSA 2QRGA 1DUSA 5EZ6B 3S99A 3TZBA 4NBLA 3RU7A 2EERA 3VAAA 4F11A 4ZDIA 3AVTA 3LXUX 1CIPA 4B35A 1LDGA 3HZRA 4EG6A 1CETA 1RU3A 3H5RA 4CL0A 4FYKA 3TSCA 4FR0A 3A1NA 1R8JA 2C9MA 4M7PA 4NEHB 3DZBA 4LAFA 1H2HA 4E31A 4K0KB 2BMDA 2QRHA 3H5VA 4MPPA 4DSOA 4O4LA 1UPFA 3GNQA 3IYLW 4IDAA 1DBIA 1P9RA 2XOKA 4L8FA 5EJ8A 4TSFA 3ZX4A 1QK3A 3MSCA 4Q7KA 2XKBA 2IYTA 2DWPA 1DARA 4BFCA 3WNVA 5KTKA 3HRIA 4MQUA 1WUJS 1GLGA 4RPKA 1M2HA 2J9FA 3LCRA 3LUJA 3PNYA 4ZQCB 5LOVF 4JAVC 5DOZA 1YRAA 5EKXA 2CSUA 5TEVA 4BN4A 1WP4A 2ZJFA 3CZ5A 3NC1C 1XRPA 1LI4A 1Y5LA 2JC3A 3SE7A 5BSUA 4XOIA 5K3AA 1LPNA 2WTBA 2PTGA 4ENRA 4EYQA 1DX9A 3ETDA 1O94A 4HDSB 5C7YA 2XT0A 4X1YB 1AJEA 3BDIA 1M7HA 3G7NA 2PWYA 1W2WB 1SG6A 3G3EA 3CO0S 1YACA 3BGOS 4KR6A 5HS4A 3VHQA 2Z83A 4LRSB 4N03A 2ZREA 4WCFA 3DL7A 4R71A 2BFCB 2RJOA 4C6TB 5KTPA 1CTQA 3UFXA 4OAPA 5EJ4A 1XZDA 3CUKA 1IM2A 4KMSA 5H59A 4HWKA 5FLYA 3E9CA 3EHEA 4XX1A 1E3LA 1P3DA 4TYMA 2XTZA 1CYDA 3UVEA 3TUZC 2J3QA 1Q5PA 2HK7A 4ZT5A 2WTMA 4AWXA 3OM9A 4S12A 1E2GA 5BWLA 5E3JA 1BOFA 2VHCA 1QZ3A 1H4QA 3MCUA 4Z8XA 4G1CA 2J7KA 3NKVA 4YJKA 1ORWA 1QFJA 1II0A 1WCXA 4F8EA 4HNTA 2PQ6A 2GVNA 3PSHA 1Z13A 1ZC4A 1QG6A 4W7HA 2G72A 3B9QA 5CFPA 3QX9A 1C41A 1XL0A 4AW9A 4CMEC 5LIPA 2H2DA 2RK4A 1AMOA 5A9RA 3ZE2B 4WDQA 1M66A 4YQEA 1QRAA 1U5CA 1VL2A 5EP3A 4BNDA 1N1MA 2BSAA 1H22A 4EZIA 2MYUA 3ID6C 2E82A 1T5TA 4FZJA 4Q1VA 5DH9A 3A1WA 5D5QA 1U0EA 4LN1A 1IWOA 4XGQA 1WWKA 3THRA 1E1QD 2UVPA 2VKTA 3ZWKA 4XWWA 1DP4A 1W9MA 3IEIA 5DYGA 3TW8B 4CRWB 5LQKA 3GEBA 3G7SA 1YUNA 2GK7A 4DPLA 4CMBA 4A6PA 4LCEA 1MX5A 4BHTA 4CMCA 2I4MA 3FRJA 1JDSA 5BWOA 2EZ8A 3HA5A 1T25A 2J5QA 4KLNA 3REQA 3N70A 3KPJA 3OJFA 4LBZA 1EJ6A 1Z2AA 2AMLA 3P2JA 4FGUA 4XASA 3ZEAA 8GPBA 4BEWA 3BXZA 3MJEA 4QNNA 4ZCQA 5EWJB 4DC9A 1NBHA 2R1VB 1OU4A 1AZTA 3O1HB 4XB2A 2QSYA 3RFUA 3OE7D 3ZQ6A 1Q1BA 1GEEA 4H17A 5JASA 1RC8A 3T7JA 3BILA 2E9SA 3K6RA 2VC2B 3H1PA 3ZZMA 1JMKC 3TH5A 4Q1DA 1G9SA 3HDJA 4IXTA 3HL4A 1X19A 4IH1A 4ZQGA 1W59A 1O9GA 2JFXA 3QVVA 1SU8A 1YR8A 4U4AA 1UF9A 5IT5A 2HBRA 3KSBC 1BA2A 4E3WA 2ORED 2R7MA 3P52A 3VU8A 4EKDA 4RGBA 4ZCSA 1DRKA 3H2GA 4P2BA 2IU6A 4OSPA 2C88A 3C16C 4RPCA 2RHBA 2OMEA 2QVCA 2O23A 4W9NC 1Z4LA 4Z4CA 2V98A 4TSKA 3V1YA 1VP3A 1EVZA 1NDQA 1TGYA 4TTAA 1V7QA 2J3JA 3JVIA 2EJVA 5FV7A 2HQ1A 3N7AA 4H15A 4IG4A 2CL6X 1A8SA 2WJ3A 4JXJA 1TGVA 2V9PA 3BGIA 3KBOA 4LGMA 4RGQA 5B6IA 3UOGA 5LQRA 3I09A 3R6GA 4WVFA 2Q4EA 1P5FA 3W5UA 1IONA 2CMKA 2P35A 5JYBA 4DQDA 3NT5A 3QA3E 3RAPR 4RMNA 1NM5C 4B40A 1XCPA 2VNKA 3DTNA 4KXYA 4KI0A 1UODA 1YQ9A 1D1TA 4JLMA 4ESVA 4Y2VA 2VWGA 1ATZA 4J0GA 4QDJA 1M83A 1AUQA 2NZ8A 4FFLA 3O7WA 1J1IA 3UUWA 2PRJA 5TPWB 3ZHRA 4H1WA 3DB1A 3PWSA 4OJKA 3MRSA 4F4CA 2ADFA 1RI4A 4UTOA 3ROPA 3G8BA 5TVKA 1BA3A 1CQPA 3L01A 3EAFA 3HN7A 5FNVB 2VF7A 2DVMA 1G7TA 1U3UA 1W35A 5EXDA 3T7IA 2QD3A 1TFUA 2OSBA 2BFDA 3N8NA 4ZVMA 3EULA 3WKEA 3H4TA 4BJ1A 1ORHA 1T34A 2ST1A 4W5JA 4QUEA 4YXWA 3HBMA 2FJ0A 4XSGA 1ESNA 3HV2A 4HZGA 2Q7DA 2PN1A 3KOUA 2FWAA 3LY5A 3R5FA 4R16A 3WICA 3WRVA 2FN8A 2VZLA 1T4GA 3UMBA 1EP1B 1DC4A 3AKCA 1P0QA 3B3AA 2QMUA 4L4YA 3CH7A 1RXUA 4KNWA 5KX5F 5T8KA 4Z3OA 4MW1A 1AH2A 3LT1A 1DAHA 4HDNA 3KQTA 3Q98A 3D8SA 2MU1A 1QV7A 3MB5A 2Q1YA 2C7GA 2EL7A 4ZV9A 1DT3A 2X8JB 1GZ5A 3VZPA 1NMEA 2D1QA 3VZQA 1NRWA 2EBUA 5IMSA 2QTWB 5DBFA 4LHZA 1I24A 1S3SA 5JT1A 1V16B 3WG9A 2VHEA 1E79A 3ESDA 1FSSA 3V80A 2DHCA 4GP9A 1LV7A 4I4NA 5HDQA 3NTRA 3UPDA 4LNHA 5FAKA 1W4RA 2KW5A 1UP4A 3ECSA 3SJZA 5KWVA 3IBTA 3TLGB 2NMVA 3KJIA 4DJJA 2DPLA 2A1IA 3TQCA 1V95A 3DEAA 3V7UA 3ICQB 2EXXA 1FNBA 2DPHA 2I1WA 5JPIA 1JEJA 1FBNA 3TGLA 2RMKA 4X3PA 2IZ7A 5CLLA 1BCSA 1X1RA 3OTIA 4QZVA 5JJ5A 1VZ3A 4DMFA 5HP4A 4H4DA 4Q5IA 4NMWA 3FOFC 1YQGA 2IP1A 3CRVA 4C7VA 5G4KB 3G2MA 3U4CA 5KB3A 2PZMA 1ANKA 4YAEA 1QDEA 1YXMA 4S2EA 3V1NA 4C7OB 1PJLA 3GVCA 3FWKA 5EMHA 1SBCA 2H92A 2Q5IA 3BDVA 1M6HA 2I4IA 1CULC 3MIZA 4IWXA 4EB8A 5EZYF 3JARB 1DBRA 2ZAIA 3TINA 1IWPB 1I14A 1R12A 3HC7A 5HNKA 2DUWA 2FPOA 3FZEA 4L75A 4QVIA 1KS2A 3MN1A 3RKRA 3JX9A 1EUDA 2CLDX 1RM0A 2RI6A 3TR6A 4KGVA 4ZQBA 3BFXA 2ZDQA 2BFCA 4C6TA 5A5EA 5JPDA 3OJCA 1BS1A 4PNPA 1QHYA 1JHYA 4ZRMA 4EQ6A 3JD4A 4I4TA 5DASA 3L5OA 4BO0A 1UXIA 4D0RA 4PZ0A 2DJIA 2AEMA 3FKQA 4ZFNA 1VJ1A 1ZKDA 5BSTA 4MV6A 5I5GA 5CBPB 1SPBS 4WRRA 1LXCA 4YRSA 1SIWA 3GBSA 1TT5B 1IL0A 3IDAA 3PPIA 1M8JA 4WVLA 4X24A 4EFLA 4RD1A 5C4IA 1KOJA 2Q3DA 2YWHA 1U9CA 3W79A 4I99A 5DLPA 1DRWA 4MUXA 5B2ZA 5AW8A 3RYCA 1OPRA 3K09A 3W5JA 4XVHA 1RQ2A 1KYIA 3RYCB 1IJFA 1XJ0A 4Y6QA 2G6TA 2ZT7A 3D6UA 1CJMA 3F96A 4OJQA 5CFOA 1ENPA 1FNSA 1PVVA 3PYLA 1C14A 4GMDA 3ZK9A 1BXRA 3MFQA 5ALPA 1CUSA 3AZPA 3BHIA 2A2ZA 3CBQA 3I2JA 1NW5A 3S7TA 3TR5A 2W8BB 4LS3A 3IR5A 5DM60 4AVYA 1VIDA 3JATB 1LVHA 2RH4A 1GUZA 2BEKA 3EXHC 4JLWA 4CCSA 4F46A 3WGJA 5CEEA 1XCGB 2I71A 1A5TA 1T0HB 5EZ5A 2H08A 5ENVA 3TW8A 3ANLA 3JSXA 5DX0A 4R8RA 4UEQA 5DNAA 4DM7A 5KVCA 4Z4QA 4W1SA 1EFUA 3FI9A 5TRTA 3I4FA 2QTRA 5JCOC 1KK1A 2CXPA 2Q8NA 3A0RB 3EQ9A 3KKLA 1E2JA 1C7FA 1GTZA 3IPRA 3NW9A 4KIUA 5JO9A 4H77A 2CNWA 3RVBA 2QZJA 3T1TA 3UMSA 1CVLA 3EY4A 1KXZA 1AXRA 5ICEA 4YDRA 1NQVA 5EWJA 2DFKB 1FFXB 4CGZA 5B7PA 4IOLA 2QAJA 2JHAA 3CPSA 2W4QA 3LIPA 2PD6A 3ZZ1A 4DBVO 3R20A 4B4VA 2N1BA 3BZWA 3KQWA 3PGMA 4C4TA 1WB6A 3L46A 2AUNA 2D2FA 4YTEA 4KGZA 3I8XA 1MV8A 3LOQA 4B74A 3HJGA 3WKBA 3IO5A 1IEXA 1SG0A 4MDHA 1MHTA 1EG2A 2IELA 1SCQA 1K66A 2OBMA 1A9XB 3N2GB 4OLJA 3O47A 3T06B 2RGGA 4B6JA 5CFLA 3DZJA 5CDHA 1L7NA 1U02A 4KQKA 2VP5A 1NVDA 2J8ZA 1FFWA 3RO7A 1NJ1A 3PVSA 4ESOA 1T5SA 3IA2A 1X1CA 5EL0A 1NHWA 1GDTA 1Y8AA 3BXGA 3WOVA 3FOBA 1YH3A 3CSDA 1I9GA 3PX7A 1U28A 1ZD8A 5IJZA 1TIKA 2GCOB 3CH6A 1VDMA 4TN5A 3A4YA 1WCWA 5ALSA 2CCJA 2G04A 3NIDB 1P6XA 4LWQA 5B55A 3DDHA 3SR0A 3FCSB 2E37A 2FZ5A 2F3RA 3B2EA 3H1TA 1WV0A 2UUPA 3OQJA 1QHIA 4HQKA 4WFIA 5CMLA 3U39A 4TXHA 4UNIA 4OI2A 3ZW9A 3H6HA 1Z5WA 3L1HA 3DNMA 3PC8C 3MGBA 2XNDD 2V59A 3EGXB 3P9KA 4M8KA 4OMDA 2CEAA 5DMHA 3ZGOA 1NC1A 3LQQA 3FJYA 1QH8B 5IEJA 2WJVA 1DXYA 5IDVA 1U0LA 2I5PO 3AIKA 3DBLB 3ISVA 4EB6A 1HETA 1X7ZB 2K7FA 2E48A 4UTRA 2L19A 4HEA1 4O5OA 2FWRA 3OHSX 1D0IA 4IAOA 5G0TA 3U3DA 4ALIA 2XGJA 4QYMA 4BNVA 2AN3A 1QXSA 3CX3A 3SBXA 1F38A 4XWAA 3AR8A 5HZGA 5IS2A 2DU8A 4F5DA 1YA6A 1KVSA 1RQXA 3AGQA 1E4VA 5KWEA 1E1YA 1T2UA 3BMQA 4CKCB 3GD7A 1GUDA 4ZZIA 3DWGA 3LO8A 3H18A 4RH3A 4YP6A 2GRJA 3DEZA 4RPLA 3THSA 3WAKA 1AKQA 2UXDB 2ZUTA 5K6AC 1KO7A 1Z26A 4XGIA 1R50A 1XEXB 2JARA 1FMCA 1OXMA 1IOLA 3SSAA 4D42A 1YHYA 3P2OA 4NULA 3ZYCA 1Q0RA 2WD7B 2GPNA 5LPNA 3WQSB 3CH4B 1XDSA 1CQJB 1XAJA 3JRNA 4IMPA 3UV7A 2V7QD 3ZGNA 2UYGA 4FC6A 4GPAA 5DZSA 3RRMA 1OF1A 3ZWOA 5K8UA 1NE7A 4LC1A 5KTNA 3A6GA 2X8JA 2B36A 2QRPA 2XUAA 1BGVA 2WWVD 2EBWA 2LDBA 4YS6A 4EJ0A 4DG8A 5HGJA 1GYPA 3QKRB 4I1VA 2QX7A 3C7DB 5EEHA 1PJ3A 1V16A 2PXAA 3MG9A 2Q29A 3CISA 5FTNA 4EQZA 5A4AA 2FFHA 2PRYA 2CUNA 3ESAA 3T0IA 5KDDA 4CGYA 1IRIA 3SJUA 3TLGA 1EBBA 4HMPA 2YV3A 3S6JA 4YASA 3QJ5A 4FHFA 5U4QA 2IYNA 3A3YA 4KK3A 1O6GA 1ZW1A 3R9WA 4KIGA 1R3DA 4WD3A 3FOWA 4BAUA 2RHRA 3IMFA 1ZJ6A 4BC0A 1H8HA 1PJSA 1Z6ZA 3C1TA 3C5CA 3LQFA 1HM5A 5EYPB 1AQJA 3LY9A 1GAQA 3TLKA 4QHYA 4W5RA 4PRYA 3ONNA 5G4KA 3U9SA 2XE6A 4IV0A 1UBLS 2VWQA 2HWYA 3PC4A 1HE3A 4KFSA 2OAQ1 5DNVA 3NETA 2ZJBA 3I5UA 4LDAA 2XUGA 4ZVPA 3QV2A 4C7OA 4OQQA 3CUVA 2YZGA 3EVDA 5AJTA 1ULSA 5IXYA 2JCXA 4AJIA 2GLXA 4W7SA 4XTRA 3F1LA 5DYIA 1G21B 2I6GA 4D5GA 4DHWA 3THYB 4JP5A 2B0JA 3ES9A 5JNTA 4LF8B 3TIFA 3RTBA 1HYEA 3LT2A 5KCZA 5K6RA 2F67A 2H2FA 3BWEA 1GWNA 3HA3A 4RGVA 1EVKA 3T5BA 2OC9A 1NJ2A 4MVJA 3NPMA 5CU7A 2JFWA 2OORC 4CFSA 4OX9B 4A2PA 1ICIA 2XUDA 1ZSNA 4C0QC 5H1YA 2VPXA 1V6AA 3B48A 4LOHA 5AO9A 3VO1A 4E2FA 1AHIA 2CZCA 3QSYA 3VR4D 1S2DA 4H08A 3OOSA 3K70D 1D1QA 3O38A 1WULS 2KBFA 3PJFA 4XIJA 4DREA 2I8AA 3IQZA 3WWCA 2GDZA 4DV0B 2W98A 3AV0B 2AN1A 2XUIA 3CLTC 1DHTA 3QVJA 3WO1A 2CL5A 3QEKA 4WFQA 3QXGA 4DCJA 3LT5A 4DUGA 2A4MA 4E70A 1T5DX 1L8OA 2NTYC 2SICE 1B6TA 4FWBA 5FP0A 5TMDA 1QYXA 1NATA 2VJQA 2Y4NA 4IXDA 2YXLA 4OFZA 1FMJA 1XMXA 1D8TA 4LNAA 1I4OA 2VEDA 4XIIA 5DP1A 4BLTA 1NUSA 1PTJC 2K6GA 3OZWA 4F5EA 1YZTA 1AQLA 4AF7A 2ZSFA 4BRUA 2SKDA 1T0BA 1TKCA 2XR1A 4GRIA 4FDUA 4Z49A 6REQB 5K8IA 4GZ5A 3HCAA 1JKXA 1GN8A 1RNLA 1XQWA 4H7JA 3JATA 2XMDA 5CCBA 1F7UA 4PEVA 1P1IA 5HM6A 5HW0A 2WSMA 1GTRA 1C29B 3E7XA 3L7BA 5DFAA 2C2KA 3OWHA 4HYYA 5AT1A 3ER9A 4AKHA 4UTZA 1I8TA 5A4MS 2QRQA 2C5AA 5BY2A 3R7SA 5AVWA 1IBKB 1PSWA 4D4HA 1H2BA 1PEAA 2F4NA 3AJRA 3I64A 1HT1E 4IS2A 1KMMA 2VH1A 3KCQA 4G5HA 2CZGA 2ZB4A 1H1LA 1Y42X 2XCQA 3INGA 1C81A 2YFHA 3FN4A 3JALA 3JQGA 4HDKB 4MVJI 3VGPA 4JITA 4BFSA 1KRXA 4FCTA 4BTEA 5D2CA 3WWYA 3AVUA 4K9QA 3HDYA 5FAXA 4PSDA 4OJYA 3QYFA 4EW1A 1FFXA 1ZXLA 2F1RA 3OWXA 1MEEA 3G2HA 1EB9A 4Y2RA 3VKUA 4FYYA 4ER6A 3RV4A 4L6CA 1SN7A 5ESXA 4J1TA 3E6AA 2XMZA 3OCXA 2I67A 1XQYA 3FCOA 4KX3A 1TJ5A 4OXXA 3MQ2A 1BOOA 5JSKA 3VPFA 4TXNA 3FBWA 5IF9A 3KKKA 3N2GA 3NXSA 1A9XA 2FDXA 3EG9A 1KDVA 1NQWA 1PK8A 1R0RE 1SOMA 2J45A 3H0EA 2BMFA 5JG7A 2PNFA 2OO5C 1BMFD 1V11A 2YOGA 4H7PA 4ZGBA 5KJ6A 1PL6A 1E4EB 4TUYF 1UBJS 4KN6A 5CJ2A 1P33A 2I4NA 3DO8A 4EYEA 3UICA 1MB4A 1JG2A 2WJAA 1KVRA 3I04M 3QV1A 1UDWA 2GCOA 4NJEB 1CUZA 2CWWA 3UK6A 2AMVA 3PXCX 1MRSA 2BFBB 2QP4A 2OQIA 4XR9A 4YIHA 4CFYA 2ZUWA 2OUIA 1I30A 4FMCB 4J0CA 1L4NA 1RC1A 1TK9A 3BCSA 3OJWA 4Y3UA 3UGTA 4KPFC 4BVEA 5KDLA 2PWBA 1WX1A 3T3IA 1TC2A 1YI0A 4MLDA 3ZH9B 5C0OE 1WP9A 1YZ3A 4FQ8A 1QE3A 2X5XA 1YU6A 5A03A 2VG8A 5MDHA 4G07A 2HJSA 5EXSA 4FB4A 3EGXA 3R7AA 3F8WA 2M2IA 1QIMA 3CLUC 4ZJUA 2Z5LA 1JF8A 2B99A 2IEZA 2OZVA 1HWYA 3GEEA 2VJBA 4NOLA 5EPOA 5JXWA 4N65A 2P68A 4RS4A 1KO8A 4FHCA 2QUAA 1XI2A 2MSEB 1D2GA 4YRCA 3KUKA 1RWXA 3ZE7A 4GIBA 4PYJA 1B2RA 2ZBQA 2O6LA 1UT5A 4K9OA 4LE2A 4GXQA 3L6BA 1NMYA 3ZLTA 3ZLUA 4I1SA 4YRBA 4GR9A 5D3MB 1J4AA 4AAYA 4PWYA 3DBRA 1UBCA 5EFZA 2VH2A 3WISA 5A05A 4FJ2A 1W0KA 5THKA 1XZCA 2PTHA 4Q3EA 3ZHSA 4WBSA 1TQ6A 3ZY4A 2BYTA 4DJ5X 2P2YA 2O1WA 1NG9A 2HRRA 4ID3A 1X3LA 4F4HA 1XEXA 5ALOA 2HF8A 4UEWA 2Y0CA 4Q3AA 2CXRA 3ZWDA 3G9XA 1VYHA 2WIDA 2ZPUA 4D43A 4BXOA 2WD7A 4KV9A 3DQQA 4MCJA 4U1RA 3VOTA 2GJKA 2PH5A 4P81A 1CQJA 1NZJA 1YAJA 5H68A 1N2EA 1CZUA 4FXOA 2QRMA 3WSWA 2F55A 1A72A 4AI6A 3I2GA 3OFVA 4BS9A 4D81A 5MGBA 1A8QA 1WHTB 2PSHA 3D3WA 5KTYA 4AS2A 3HR7A 1GSHA 3I53A 3DE6X 5IKEA 2OBLA 2FN7A 4E5KA 5EKUA 3G2NA 1QJCA 2VJOA 2ZRQA 3SJ7A 1MB9A 4FKZA 4MTLA 4N0QA 5FBRB 4DMKA 1P4HA 4R2KA 1DADA 1EVIA 2JLQA 3QEMA 2BBWA 1SA0B 4CL2A 5IK2D 1A98A 2IYZA 4GICA 4B34A 3Q3EA 1DO2A 4R0NA 1E9BA 4CV3A 1PUJA 1L7VC 4PHTA 3HEMA 4YUAA 2IYSA 4LV8B 3O5AA 3A4NA 5EHNA 1M67A 1XVUA 2AVDA 4NH0A 5LD2B 2NUPA 3TQHA 4KC0A 1OC4A 4C1NA 4WLOA 5EYPA 4QLBA 5A0VA 2B1GA 4RD6A 1WZIA 5FCDA 2ISSD 4MUNA 5MN5A 3ZDFA 4C7JA 4UAGA 4KFCA 5BSEA 2GPSA 1Z6XA 4OI4A 1YDFA 3U4AA 3G82C 3EQ8A 4ZMSA 2NU7A 3OU2A 3TX6A 1U81A 1F6BA 1VLLA 3IT2A 2H11A 1CLUA 1RHUA 3MWFA 1Q95A 1ODIA 2G9VA 5JDCA 2FLWA 5JJCA 4AY6A 3SDZA 5HRAA 2OAEA 3TF5A 1GARA 4YAFA 3RTGA 2C8LA 3HLKA 1C5KA 3HXTA 1G0OA 2D0DA 1TT7A 2QNBA 5CB4B 1COZA 4TTRA 1O6BA 4ARSA 3T5MA 2YQ5A 4EF4A 1TQ4A 1DRUA 3WIVA 1RMQA 4PAWA 2H7XA 2VHYA 2X40A 1PVDA 4A03A 3R2JA 4RPIA 4IYJA 1S2OA 2Q2VA 2LCFA 3QTBA 3R44A 2EIHA 4CIBA 5LZ5A 1ZRMA 3NYIA 3OPNA 1US8B 2VDLB 1NXXA 3QE4A 3ZHBA 3CLRD 2F8TA 4NDNE 2PZKA 3ECCA 2WWYA 1S8FA 4OMFG 1U94A 2Y2VA 4ZOQI 1UBTS 2HXSA 2I3ZA 2GD0A 4CIWA 3FPCA 1VGQA 2QX4A 4RE5A 1G6HA 4V02A 1FDOA 3ULKA 2P27A 1HUQA 3PDWA 3DXYA 3D5TA 1KSFX 4J2OA 3UWPA 2DKNA 4D4IA 3IUBA 1TEVA 2PX2A 3C8UA 4MP6A 1UP6A 4RVGA 4E03A 1JALA 5BYJA 3SHTA 3ZE0B 2QBYB 1NIPA 1FQJA 3ZKWA 2J30A 4KE9A 1M2WA 4ICIA 3G2QA 2QGZA 3GGSA 3NXKA 3R0VA 4BNZA 3A6FA 3VHXB 1VLVA 3M1IA 1XPRA 4LJ9A 1E4YA 4H3KB 4X63A 3C24A 4QECA 2IE8A 3UA3A 3GU3A 3GJ3A 1WABA 4LOLA 1PFVA 3BULA 3B12A 4HNRA 1W19A 3DT8A 2VPTA 1PRYA 3K0KA 1E58A 1T5HX 1USKA 3OZDA 4Q4AB 1OI7A 1JIKA 1EJBA 1KI1A 4FNGA 2AA3A 4WERA 5K3FB 3VZCA 4M9ZA 3WGQA 1ZC3A 4TMXA 4MYRA 4TV9A 1CUVA 1NW9B 1KI9A 4B2PA 3HTXA 3O2SB 1DG1G 5GJVC 2G25A 1S9HA 1CUAA 1OQAA 1T8TA 2HIHA 2JDID 1XAHA 5C5IA 5G3ZA 2ZTSA 3IALA 3EEOA 2EFHB 3U0BA 2D3WA 2V4MA 4ML3A 3WTCA 1LKZA 4EY5A 4MRPA 4GSYA 2TS1A 2VJPA 5BWMA 1N8TA 4YRKA 2C4MA 4XUDA 3PIRA 3HDQA 4QYIB 4EDHA 1RWWA 1G2IA 2NAFA 3DMGA 4NZNA 2EZUA 4AY2A 3KUUA 3C8DA 1BHQ1 4L9SA 4ZVTA 5LMCA 3IV7A 1HE2A 2GEVA 2PGNA 1AKVA 1E4EA 3PEEA 3D8UA 3HMKA 4MARA 4MAAA 4DR3B 4HAUA 1DO0A 3DTTA 4M0FA 1NLUA 3GZJA 1UKVY 1U0GA 3AMVA 4UE3S 1QIIA 4LXUA 4CG1A 2PBRA 1U6IA 4NE2A 1EX7A 2GPWA 3WQBA 2BFBA 2AN4A 1P4GA 4NIMA 3O74A 5HRCA 1G5PA 4TTVA 1JA9A 3GA5A 2PJRA 3PQDA 2PKQO 4XM1A 2H1CA 3B6KA 1YIDA 4N82A 1NQ5A 2E18A 2PFSA 2PDAA 3KOMA 1I2DA 1O58A 4UHKA 1F4LA 3FROA 3NT4A 1B4DA 4K9NA 3UAGA 2PXCA 4KKVA 3WB0A 3FHLA 3TRDA 3AL0C 2P9YA 4TYQA 1O1YA 1JIUA 3KSMA 3V1UA 3ETGA 3G9UA 1WNTA 1KMQA 2KSQA 4KOAA 5JWOA 1A8PA 3KYDB 1BS9A 1XTJA 4ZALA 1NYRA 1QKIA 5JZOA 2REQA 3BCRA 4HZUB 3M2PA 4B3HA 4WNIA 4CT5A 3LOUA 1T0IA 1U9IA 1QRTA 1I5OA 3FYSA 1B6RA 5SYAA 4QXAA 1N6NA 1N0HA 1WEKA 3L8EA 4MWCA 3L82B 1MIHA 5HKOA 4LZPA 3OCVA 3GZTB 2YNMD 1ZKMA 4H6WA 1Q3HA 1RJFA 1OTHA 3I30X 4ZA2A 3FRHA 1IXRC 4DA7A 1AU9A 1MHPA 2G40A 2P0YA 2ZE8A 3E8XA 4ZT3A 5C7OO 4CF7A 3ZJUA 4PRKA 3PTAA 3FPEA 2YOFA 4CCWA 3BX1A 3GZ4A 4LYAA 1DC6A 2UYCA 2HYIC 3TM4A 1Y1SA 2QX8A 1NXWA 2QTMA 3IILA 2XCTB 1UZUA 1SY7A 3A3KA 5CXXA 2BFMA 2HF7A 1XNJA 4RD2A 1NUAA 4Q7JB 1TUIA 4Q4JB 4TT8A 4DLRA 2QRVA 3NBYC 3GWZA 4U2BA 4P4TA 2ZUCA 2C7VA 5FO0A 1W36C 1BXGB 4BAGA 4B82A 1LX6A 4MX8A 2X9NA 3KT3A 5DCYA 4YRJA 2B7BA 4BLSA 4YCMA 4IJVA 1WHTA 3NDRA 5E9JA 4LYYA 3V7FA 1I7LA 2QMYA 1WBBA 2Y6VA 2C5BA 3UH1A 2FR8C 3HB9A 5FOQA 4YRGA 3U1TA 4DWJA 1AX9A 4Y2YA 3AC0A 4M6WA 2B1IA 3KU1A 1U98A 3SNKA 5AVYA 1QYWA 1JI0A 2BM9A 4FCVA 3EGEA 3M4YA 3DE2X 4MZDA 5JE8A 2WJ6A 2PPVA 2EQBA 2PZFA 3PHIA 4TXLA 1SA0A 2OXFA 2VNHA 4I6EA 2VDUE 1J20A 5COBA 3WLJA 4ASUA 4DVGA 4G5XA 4KQ2A 1MC4A 1C3LA 3QXHA 3MJFA 2ZS9A 4BVKA 4CM9A 5B7QA 4E5YA 1K5PA 1T5BA 4F3NA 1WNFA 1MJ5A 3FUWA 3ZWMA 2QTZA 5JQWA 1T8PA 1MG5A 1COWA 4CQNA 3A10A 4KDEA 1KS9A 4URFA 1NF8A 1POXA 4URVR 1SBIA 5T5QA 4DCPA 2G3YA 4HWTA 4J7AA 1J8DA 3MHPA 1DC5A 1TM1E 3WI7A 2FMHA 3F4KA 1MEOA 1ULHA 3CFYA 5TQ0B 2X2FA 5ALJA 4B87A 1J97A 1LQTA 4DCUA 1EXMA 2QTHA 5KYVA 4Q7EA 2V8BA 4PS1A 1CEYA 2WAOA 3IXQA 1BWPA 3DYBA 1RXYA 3WJ1A 3KFLA 2BF4A 3OP4A 3TMAA 1HLFA 3O1JC 3UT0A 4QBKA 3W1WA 4TL6A 4B3FX 3RABA 2YVQA 1XWWA 4RM2A 4LKRA 1NFFA 2CSXA 1ZI9A 1P0FA 1YO6A 2V5VA 3CZRA 2AR7A 2DPXA 2R5WA 4EZEA 2C9OA 4PLHA 1S89A 4HTAA 1LK0A 1XP5A 2IYQA 5AH0A 3LTEA 2VP3A 2GCIA 5DHFA 3KV1A 4WJKB 2GXAA 2O8CA 1Y4DE 4KPUB 1A69A 2Y1XA 1PYGA 2EFCB 2XD4A 3GLTA 4MB2A 4MRSA 4WOCA 4BZXA 1SKMA 4U63A 2ZQZA 2CLSA 2R62A 4TLAA 3ILVA 3W34A 4A4DA 3EQ6A 1GCIA 1US8A 2HHJA 1WSAA 3CE9A 3L6DA 4INZA 4JKIA 2ET6A 1SUWA 5JJKA 2GZ3A 3LPAA 5A71A 5B58C 1PQYA 4MHOA 2JD2A 3BK7A 5ALMA 1NR7A 2YXEA 3U40A 3BJEA 1SFRA 1TJYA 2IUYA 1CPYA 2VYVD 3AINA 3NNNA 5CIWA 4Z9AA 3T94A 1LPBB 4RVDA 1FXWF 1NW4A 1Z33A 2I6FA 2ZYRA 4UJ3A 4X84A 3DE3X 4YWHA 3ZWQA 4C03A 4DCOA 3G2KA 4K9MA 5SZKB 4RZUA 4RNDB 1KQOA 4XI9A 4OK6A