2NU9A

C123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
285
Chain Sequence
b'SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNTPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
molecule tags Ligase
source organism Escherichia coli
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
total genus 109
structure length 285
sequence length 286
chains with identical sequence D, F, H
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu9A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu9A01
3MOIA 5L45A 3ABIA 1YB1A 4INAA 4J1NA 1U3TA 3GLQA 2I6TA 4GMGA 4OL9A 4BKQA 3DZBA 1MP0A 4U6QA 1EVJA 4BNYA 4HFMA 3WX0A 2VT2A 1X1EA 4OSPA 2NU9B 2FWMX 5B4VA 5JDIC 1E7QA 3F6YA 3GG9A 4B79A 5F1KA 5IZCC 3LSYA 2JFGA 4B4OA 2C5EA 3AUSA 1CQJB 3RFVA 3PI7A 2X0JA 2Q1WA 3BMNA 1BGVA 1CIVA 5IN4A 1NFQA 4QUKA 3H9JA 4Q3NA 4B8WA 1HETA 3LT2A 1AHIA 2GZ3A 3V1UA 5G4KA 1PGPA 1SAYA 2DAPA 2EJVA 3H4VA 3ORFA 5T67A 3OBBA 4J4HA 4E5PA 3VVCA 1LDEA 3GPIA 3A1NA 1M6WA 3OJEA 5G0SA 3WQRA 2W2KB 3D3WB 2Z5LA 3C24A 3CIFA 3FN4A 5CEJA 1JN0A 1KVUA 1D4FA 4CV1A 1J49A 5A4DA 3JQAD 1JQBA 2HKIA 3F1LA 4PLYA 1ZO8A 3RJ5A 4D43A 4QQRA 4DVJA 1PR3A 2V6GA 5I7SA 2BKAA 3W6ZA 1A4IA 3L4SO 3RUAA 4GI2A 2NVUA 4XIYA 3QIVA 4IXTA 4R41A 4W9NA 1UDBA 3Q0EA 4YJFB 1ISIA 4CMAA 3L07A 4CR6A 2GCGA 3GQVA 4UAGA 3JQ6A 2QG4A 1YL7A 1YO6A 4FOOA 4GPD1 1OC4A 2V65A 5L53A 2FPGA 3OIDA 5T8KC 2FHSA 2BH9A 2D1YA 1UXJA 3I52A 5T8KA 3GHHA 3RU7A 3EVNA 1ENYA 3HN7A 3FNFA 4ND4A 4S3MA 3D5TA 3UOGA 4BMSA 3IQDB 4ZQGA 2V7PA 2IRWA 4HP8A 3BMOB 3EDMA 3GK3A 4AL4A 3UCEA 4S1VA 3F5SA 5KVSA 5ILOA 5A5EA 1DPGA 2J5RA 4L0QA 3QWFA 5TJ9A 4LW8A 5ICMA 1U1IA 2J5KA 2PV7A 1NPTO 4N54A 3A28A 3U4DA 3JQBC 4CLRA 1RYEA 1XDWA 3BHMA 3DHNA 3FTNA 3FWZA 3VZRA 5DBFA 2X22A 3WMXA 1LXCA 3ANLA 4A73A 4N18A 4O59O 5TX7A 3V1TC 1T25A 1EQUA 1SNYA 3F9IA 4HFNA 3UVEA 4TKLA 3ZWXA 1PZHA 4GVLA 1YH3A 3OMLA 2X8LA 2CUKA 4Q3AA 2JD2A 2GN6A 2JD1A 3I23A 5BNFA 3RC2A 3MJSA 3ZDFA 3NKLA 3PYMA 3WYCA 2XOXA 3I6IA 1LSSA 2GDZA 4UVGA 2Z1NA 5H81A 2CD9A 1F8FA 3QE3A 1JKJA 7ADHA 1EDZA 5FI3A 5JO0A 4OXKA 2FZWA 5ITVA 1D8AA 2O48X 1DLJA 2W98A 4L75A 3OJOA 5KJ6A 1WDMA 2JHFA 2I3AA 3C8MA 2IDZA 4IDBA 5AQ1A 1N1GA 4RF3A 1JKJB 4D3FA 1DEHA 5CG2A 1HDCA 4BO1A 6ADHA 1A5ZA 1PGOA 2CNBA 4EJMA 5I7VA 3AJRA 2C7GA 3WGOA 3Q2IA 2C2YA 5CEEA 4KMSA 3RC7A 1UJMA 1DAPA 1GPJA 2GRAA 3WFIA 3WJ7A 1H6CA 1LSOA 4W7IA 5BSFA 2HCTA 1I36A 2X7HA 2NU7B 1GCUA 2VTDA 3ROPA 4BB5A 3BA1A 1BXZA 3UH1A 4IIUA 5DOZA 1HL3A 1T2FA 2RAFA 4FOSA 3AK4A 4IJWA 3SLGA 3AOEA 1LC0A 3T7CA 3GNTA 2JFHA 3G49A 3GZ4A 1M67A 1PS9A 2Q4EA 2GZ2A 3F47A 4QO8A 3TL3A 2PZMA 2VHYA 1DXYA 3N74A 1XYGA 3ZNQA 3SC4A 3H9QA 1LLDA 5JYEA 1K6JA 1YL6A 2O3TA 4R1UA 3ZNNA 4RVHA 4LSWA 1F06A 3WSVA 4CMIB 4GGOA 1HSZA 3V2HA 4WNCA 3FD8A 3L6DA 1E7WA 4CM1A 1ZSVA 1PL8A 3E03A 1ONOA 2VNAA 2HJSA 1P1KA 3CEAA 3MJTA 4CMJA 3TZQA 3UFXB 2BLLA 1N7GA 1IPEA 3ZCXA 4R1TA 4UEOA 1CQJA 1C1XA 1E3WB 2HO5A 1EBFA 4EITA 1F12A 5GZ3A 5JY6A 4HX5A 2ZB7A 1EQ2A 1N5DA 4A2CA 1LNQA 1NQ5A 2PLAA 1IY8A 5K9ZA 1ONPA 5KKAA 5CDTA 3FF4A 2I3GA 4NU6A 5C37A 5C7LO 5IDYA 3TF5A 4MIOA 4PRLA 1HYGA 5DULA 3ZZNA 1QYCA 1U28A 1I3MA 5I9MA 4PFJA 3UFXA 1SEVA 2NU6A 3LDHA 4YJHB 1P45A 1K2WA 1LEHA 4J1SA 3KEQA 1LQTA 3LC1O 4O0LA 4CV3A 4K6FA 1A9ZA 1XCBA 2B69A 4XJSA 4PLTA 5KVCA 5DP1A 3UN1A 5B4TA 1P0CA 2Q50A 2B5VA 3L4BA 3OHSX 4QECA 4XGKA 3AI2A 4ZGWA 1VJ0A 1PX0A 4DPMA 2NQTA 4DC0A 3R3SA 3WFJA 2DT5A 1E3SA 4IGFA 3DXFA 1R4MB 4ONEA 1NPYA 5EINA 1QYDA 5A9SB 5C7OO 3ON5A 1PU2A 1DC3A 4OHUA 4JJFA 4RQUA 3ZHXA 5CDSA 2NTJA 4IMPA 4EUHA 3QVTA 2CF6A 1I5RA 1TT7A 1T2EA 3IOYA 3PQEA 4GX2A 3ONDA 4II3A 4UEJA 1N2SA 4MVJG 4BGEA 4BNNA 4PZDA 4UUMA 5EJ2A 3TPCA 1DBVO 4PVCA 4CPDA 1ZK1A 2GF2A 2BRUA 2IXAA 2CVQA 4NBTA 3GY0A 2EKLA 2AHRA 3QA9A 4E2ZA 4TSKA 1PJSA 2BF7A 4Y6RA 2QW8A 2PH5A 1DFIA 1WW8A 5U4QA 4MO2A 4Q39A 4XB1A 3GN2A 3PJEA 3VZPA 6LDHA 1RM4A 5G2OA 4B7CA 2I9PA 2W90A 2X5JO 4ALNA 1P1FA 4RV9A 1OI7A 3K6JA 3IP3A 1A27A 1K0UA 1XGKA 2NTNA 2Y1FA 3PQDA 4KQWA 5JAQA 3WG9A 4Z0PA 2CVOA 2HDHA 1YOVB 3ICPA 5DCWA 3CTMA 4YVFA 1V6AA 2V6MA 3UXYA 1NNUA 4XIJA 3GEGA 3ONEA 3COSA 2NU9A 2YY7A 3LU1A 4R69A 1VKOA 4CM4B 4CQMD 5A9TA 1UAGA 2I5PO 1XQ1A 1BVUA 3ADPA 4CMBA 1HZZA 4R5HA 3W8DA 3M1LA 2B4QA 4LRSB 1HE2A 4BV9A 1DRUA 2VRCD 3ZV6A 3DAFA 3E5RA 1VC2A 3AFNA 4J2OA 3ZWCA 4BNJA 3IL2A 4JJGA 4LMPA 5L7TA 1YBVA 3M2TA 1CETA 3GZNA 3OEYA 4RZHA 1LRLA 3CE6A 3P2OA 3PVZA 4K9DA 3UGKA 2AA3A 4JXKA 4BQRA 3C7CB 4YJDA 4R4JA 1F14A 1PWXA 3U0BA 3TZKA 3WNQA 1P74A 2WSBA 4WLVA 2AW5A 4M55A 3IC5A 2D59A 4BNLA 1Y8RB 1ISGA 4HNHA 1EBUA 3JD0A 5L51A 4U5QA 1LSJA 4E33A 1N92A 4I5GA 1ZJYA 1H2HA 1V8BA 1XU9A 1D7OA 2PR2A 3H9UA 5DP2A 4FB5A 1HE5A 4FFLA 5I8ZA 4AJ1A 1AUPA 2ZJ0A 4ZQBA 1NVGA 3JQ9C 2VUSA 2FR1A 1N9GA 3OJFA 5L7WA 5JDCA 4CR7A 4NPCA 2Y1EA 4LSMA 2QRKA 1V3TA 4PN3A 1U4SA 4JNKA 3PFWO 1P0FA 2A4KA 3RC1A 3S55A 1R15A 2CZCA 3UHAA 2GO1A 3E9MA 1NHGA 2HMVA 3JYQA 3BZUA 4DTIA 2O3SA 5JCJD 2O7SA 4RF4A 3PIDA 4I5FA 5EIOA 1HE4A 4RVDA 4NK4A 2OBNA 2WWRA 4GX1A 4X54A 3DO5A 2RH4A 3NTQA 3GT0A 2X0NA 5DBIA 3ADOA 1HE3A 2GERA 4DLLA 3U5TA 1B7GO 3KO8A 3MCVA 4I08A 4BO4A 4RQTA 2YV2A 2NU8A 3OQ6A 3CUKA 3DBLA 1C0LA 4MPDA 4ID9A 3UAGA 2VUUA 4Z3DA 4C7KA 3ZHBA 4ZN6A 5IDXA 2O3UA 4L8VA 2W2KA 1EDOA 3IP1A 4IJKA 2TMGA 2CMDA 1SPXA 5JS6A 1PJCA 1XG5A 4CLDA 2J3JA 2JHGA 4RPGA 1GYPA 1MXHA 2HK7A 4FFNA 3I83A 2ZQYA 1T1RA 4PG4A 5KJEA 2QZ9A 2Y0DA 5CAEB 4DIOA 4HFJA 2PD6A 3F1KA 1E1MA 1ISJA 1ENPA 5CDUA 5U1PA 3FR7A 5JDIA 3BMQA 1BWSA 1BRMA 3O26A 5AYVA 3ZU2A 1A4UA 3EZLA 4BNWA 4JP2A 4PG5A 3AUAA 1E77A 1HYHA 4NMHA 3WGHA 1A9YA 3BHIA 2UV8A 1ZUD1 3AUTA 5T6BA 2GD1O 2UAGA 4IXWA 3NTRA 5DN9A 2AXQA 1UXGA 5JXWA 3F4LA 4JBIA 3MJVA 4ALMA 1AE1A 4OO3A 3TOXA 5HTOA 4YRBA 2QQ5A 3QW2A 4E31A 3DHYA 3EY4A 3P2YA 4FC7A 2C29D 4IDAA 3S2EA 5JAZA 2X9VA 1E3WA 2JKVA 4R1NA 5THQA 5TT0A 3MJEA 1Z82A 4GH5A 2NM0A 1K6IA 3UF0A 2C82A 4W82A 1ZFNA 2EP7A 2HMUA 4MVJD 2HQ1A 4CJXA 1SCUA 4PG6A 3RFXA 1HZJA 1O0SA 1I3LA 1QSGA 1XLTA 3KB6A 4YAIA 3GAFA 1ZXLA 3MJCA 4PCVA 3I9LA 3OQ1A 2DLDA 3E6AA 1LA2A 2NTVA 3KM0A 4NFSA 3Q11A 3K2BA 3GUCA 1RKXA 4GKVA 5F3RA 1HLPA 1Q0LA 1CWUA 3VH2A 1VM6A 1PR9A 3TN7A 2FN7A 4OSOA 4IPTA 2C07A 1D1SA 3BMOA 5JMPA 3PRJA 4A7PA 3ST7A 4E13A 1PQUA 1NXQA 4W7HA 1X14A 4KWIA 3HDHA 2YFHA 1ML3A 1E3JA 3A9WA 4XQEA 1W6UA 3VC7A 2PNFA 4M86A 2NNLD 1X7HA 4NI5A 1B2LA 3AY6A 3KHUA 4ZA2A 5F21A 1Z7BA 3TWOA 3X2EA 5ES3A 1T2CA 1ORRA 3GRKA 1UXHA 2EIHA 2QZZA 4N5LA 3IDSA 4UVDA 5I9NA 3U4CA 5BSGA 1C1DA 4DIBA 2XF8A 2YYYA 4GX0A 3QP9A 1HEUA 1ONNA 4UUNA 4RVGA 2DPHA 3DBHB 3QVXA 4Q3BA 3U49A 4EEZA 1DAOA 1MG0A 3H7AA 3INRA 2BD0A 3Q3CA 5A3JA 3HWRA 1NQTA 3WGYA 3ZHYA 2IZ1A 3C3XA 2G76A 3ZU5A 3KYDB 4B3JA 2ZB3A 1P1IA 1EEHA 2IEDA 3H3JA 2W2LA 3LVFO 3R1IA 2I65A 2PY6A 2FPGB 3HFSA 4IZIA 1PSDA 1DDOA 2R00A 2ILTA 1R0SA 4MVJA 1HDRA 2FR8A 3A06A 3D1LA 5KVQA 3P7MA 4CLOA 1GYRA 2AE2A 3LK7A 4M87A 4UVEA 4IDFA 1E7RA 2Y0EA 3WGZA 2EGGA 5IF3A 1ADFA 4YWJA 4CM8B 4E3ZA 2ZB4A 1EFLA 3CKYA 4IS2A 4MVJI 1EUZA 5IZ4A 4CQMB 3OIGA 3CZRA 2EJWA 2W4QA 2W8ZA 3ITDA 5G0WA 4XWYA 1HT0A 2NU8B 4J3FA 4BNHA 1VSVA 3Q9NA 3GOHA 2A94A 2WM3A 2Y1OA 4WEOA 4E32A 2BI8A 4DBZA 1X0VA 1DFHA 1ZCJA 4DQXA 4OQYA 1BXGB 2I66A 5BNIA 4Q3EA 2WTBA 1H5QA 4QEDA 2PWZA 4OXYA 2NVBA 3FWNA 2OP1A 3A4VA 3ZI0A 3JQGA 4XR4A 3STHA 1H0KA 4WLEA 1GADO 3NYWA 2YHIA 3AFMA 3EVTA 3RUIA 5DT9A 1LTHR 2O3RA 4PLPA 4JX8A 2YHUA 3EC7A 3S2GA 1QYXA 2Q2WA 3JQAA 5MDHA 4CMHA 5TQVA 1QKIA 1PL7A 3JCZA 1KBZA 1QYWA 1NBOA 1IOLA 2EGHA 2VYVD 3JD3A 3V1YA 3RWBA 1ZXBA 3HSKA 4BO6A 2SCUA 1DRVA 4O5OA 1P1HA 3M1AA 1BDBA 4WCDA 5T57A 4F3YA 4GWGA 4YQZA 1GEEA 4L4RA 2J3IA 3GEDA 4G65A 1ADBA 3RSHA 4KP7A 4BO5A 1XWFA 2NUAA 1SCUB 3G17A 4WKGA 1L7EA 3PWSA 4R01A 4PLFA 1O89A 4WLNA 1F8GA 1PZFA 4I8XA 1W73A 4NDNE 3RVDA 2DBQA 4WE3A 3QV1A 4HFRA 1EVZA 1T2DA 1EZ4A 4RL6A 1LLUA 3TSCA 4E4YA 2P4HX 2EV9A 3AM3A 8LDHA 5HS4A 4TZTA 5TRTA 4A03A 3WGGA 1SZJG 4BNMA 4QSMA 1GUZA 3B1FA 1KEVA 1I33A 1UP7A 3ZGYA 1IPFA 3AWDA 3HDQA 1DSSG 5AXAA 5IG2A 4ZHSA 2IODA 2RBEA 4LK3A 4DPLA 3D4NA 2Y93A 2F1KA 4A5OA 1LRKA 4KUEA 3O03A 3ZHZA 1IULA 2HUNA 3BMCB 3B70A 1HYEA 3I5MA 3NV9A 5G0TA 2GYYA 3JQFC 4DA9A 5B4UA 2Y67A 4MIEA 1C1DB 3BTSA 4URFA 2Q49A 4I1IA 4PLWA 3PZRA 2ZIZA 1IUKA 1LDGA 4E2WA 3JQ8B 1E3IA 3VPGA 1R12A 2P5YA 3WLFA 4O63O 4NJOA 3ANMA 4XGNA 3LT4A 1VI2A 2DBZA 1N8KA 1PGNA 4XQGA 1OAAA 4EYEA 1GYQA 4F6CA 1BG6A 1ZEMA 2Y68A 3ANNA 4J2HA 3MWEB 1BW9B 1Q0QA 1DC4A 5CAEA 3GVCA 4NU5A 4XQ9A 4B3HA 3HJAA 4YA6A 1CQIB 1I10A 1QLHA 4JIGA 2VWQA 1ZNQO 2AEFA 1NR7A 3HQ4O 1I0ZA 4G5HA 3V2UA 5T5QA 1O94A 2P9EA 4BL5A 2X9NA 1JVBA 4P22A 3M6IA 3Q2KA 3S2FA 1EVYA 1ADCA 1H6AA 2E37A 1S6YA 3AUUA 4CMEA 1MFPA 5HBRA 3G1UA 3DZIA 1B3RA 2HMSA 3ASUA 5F1PA 1B14A 3GGOA 3VDQA 4J16A 1GQ2A 1YOVA 4DGSA 1SEPA 1YDEA 4DIFA 4BNZA 1GD1O 4E2YA 2EP5A 4A0SA 2XXJA 3E9NA 4MJLA 3OJLA 2Q4BA 3PGJA 3EHEA 1Q7CA 2Y0CA 3KUXA 4NBWA 4LISA 4YAEA 1GTMA 4XDYA 5DCUA 3WOHA 1WDKA 5JBIA 3B20A 3JYOA 1H94A 3DTYA 1TXGA 3GVPA 1H93A 1GU7A 4FQ8A 1IHXA 2OP0A 3KYBA 1IZ0A 1X7GA 3GDOA 2J3KA 4ZD6A 4E0BA 4YT4A 2VYNA 4GL4A 4H16A 3IKTA 2C20A 4MVJE 5TT1A 4YAJA 1PL6A 1RPNA 2PTGA 3H5RA 3ZW8A 2O3QA 1EFKA 4RGBA 3RUCA 2DFDA 4R16A 3QVOA 2J8ZA 3GC6A 1PJ3A 2HK8A 4O1MA 5TF4A 1YRLA 1I01A 3OFSA 2C0CA 4OYRA 3LZ6A 1GQYA 3JQ7B 1C0KA 3DL2A 4J49A 5L4SA 4GAEA 2EF1A 4P4LA 3FPLA 4Y8VA 1YL5A 1GDHA 1MFZA 3U09A 1EUDB 1DIAA 4ND2A 1PJLA 3KETA 2UYYA 4LGVA 1O8CA 4NJMA 4EUFA 4WCFB 1WNTA 2BGMA 2YDYA 3RBVA 1VL6A 3GDGA 4FFMA 3JQ9A 1E7SA 3ZW9A 1LQUA 3H5AA 2OUIA 4CMEC 4NFHA 1ADGA 1H6BA 4J90A 3RBXA 1LDBA 3OICA 4ND1A 4NIMA 4JCOA 3DFUA 4W6ZA 1LC3A 2EG9A 2ZTMA 1B8UA 2P68A 4YJFA 4C4OA 4Q3DA 5DCYA 1AXEA 4JK3A 1CRWG 4PG7A 5LDGA 1DB3A 1LDNA 5JC1A 4ZQHA 3LQFA 4AVYA 3SVTA 1FDWA 3WSWA 2FSSA 1C14A 4P4NA 4L76A 4DYDA 4BO8A 3DDNA 4EW6A 1B8VA 5AVOA 4CQMA 1VKNA 5GY7A 2IYOA 1HDYA 2YZ7A 2VOJA 4KQXA 3F3SA 3WR5A 5EESA 3KYCB 3HNPA 2BELA 4FJ0A 1XU7A 4D44A 2P4QA 4XYGA 1SB9A 1YJQA 1JW9B 4LCJA 3ICCA 1MLDA 1ZK3A 2Q99A 3BHJA 5COBA 4BO2A 4EEXA 3AY7A 2BMAA 2O23A 4FIZA 1AGNA 3VH3A 4AJLA 1GEGA 4E5NA 3LT1A 1QV7A 2B4RO 1U5CA 4CQLA 3PEFA 5J23A 2WYUA 2QX7A 3W4IA 2HU2A 4CMCA 1RWBA 4R1SA 2IXBA 4FD3A 4QFCA 2X9GA 3GN1A 1GV1A 1OOEA 2JCVA 3HB5X 1R0LA 4J43A 5IFLA 2OFPA 5IXYA 3WS7A 4FW8A 1Z7EA 1MB4A 4J7XA 3BTVA 1YQXA 3LC7O 2JAPA 1JAXA 1BXKA 4CM9A 4BKUA 4CR8A 2UUOA 1VRWA 1B26A 2H63A 3BMQB 1HKUA 3DBRB 4G2NA 4Z9XA 5L4NA 3KBOA 2Q2QA 3O38A 3VKVA 1CYDA 4F6LA 5CG1A 3AW9A 4RZIA 4IY1A 3NT5A 3WICA 3KXDA 3GHYA 1ARZA 5ENVA 3RASA 5A3VA 1DOHA 1YS4A 2B35A 1WXDA 1YB5A 2R2GA 4CMGA 5FFFA 5JMWA 2Z95A 1OFGA 4E6PA 3OQBA 2FMUA 5F1OA 4DBVO 3Q1LA 4J1QA 5EMHA 4FFRA 2P9CA 1YJ8A 3U3XA 1E3EA 1E5LA 4DPKA 2Y1GA 1D3AA 1FXSA 1JWBB 1YE3A 4XRRA 2BGLA 1LDYA 4KTTE 4YAGA 3W4JA 3WNVA 3F46A 1IL0A 1HTBA 4LRTB 2EW8A 3UICA 3WTBA 4L4SA 5K6AC 2ZK7A 5IDQA 2GN4A 4L73A 1U9JA 3KSDO 4LVUA 1U2GA 4CL3A 4L74A 1MUUA 2B36A 5EPOA 4AJKA 3BYZA 2XAAA 3E8XA 3ROMA 4FN4A 2Q3EA 4FBGA 3OA2A 4U7WA 2SCUB 4W99A 1SOWA 4LCEA 4XJTA 1YQDA 3NUGA 3DOOA 3NDRA 4RPLA 4F46A 1E1LA 2BGKA 1E6UA 2POQX 3NT2A 1PGQA 1GZ3A 3DOCA 5JDCC 2P9GA 3QWIA 1UXIA 3GMDA 3HFGA 3DZHA 3DR3A 2Q1UA 2YQ5A 4BNGA 1R66A 4DC1A 1UZMA 3GMSA 4NK5A 2FPIA 2BI7A 4IQ8A 1Q1NA 3HN2A 4D0RA 2GNAA 3IUPA 1I24A 3CXRA 2VRCA 5A03A 1CJCA 4EBFA 4AG3A 1XSEA 4CLHA 1NWHA 2CSUA 1NX6A 5F5LA 1BXGA 2E6UX 1K3TA 3D0OA 1TT5A 3KSZO 4J4BA 5EN4A 4CQLB 4AJEA 2H5LA 4WECA 2ZATA 1DRWA 5T64A 4DUPA 5HRUA 3EK2A 1Y5MA 1LI4A 4JROA 4NH4A 3KTDA 2X58A 4E30A 3WQQA 5ICSA 4GWKA 1BVRA 3H9GA 1P77A 2X6TA 3E82A 4KWHA 4L9RA 1LU9A 4CLRB 1NFRA 4HWKA 1BSVA 2DUUA 3TL2A 3JYLA 3VOSA 4E5YA 3VKUA 3W6UA 5IN5A 5TLSA 1A71A 1VLLA 3JQ8A 4FDAA 5LCXA 2EKPA 3GNSA 3DWFA 2VWHA 4B3IA 4HUJA 3GVIA 4F45A 3ZWYA 2C54A 1P3DA 3ROQA 1XKQA 3RCBA 1GAEO 3H3FA 1GZ4A 1PS8A 4BGUA 1R4NB 2YUTA 3I3OA 4IDEA 4RO0A 4BGVA 2B37A 2HSDA 4BO7A 5I7EA 4GLLA 2J6IA 4PLCA 1PWZA 3R0IA 4KUHA 3JQCA 1E92A 3X2FA 4DMLA 2FPPB 1KVQA 2DC1A 1EUCB 1KY5A 2VHVA 2ZYGA 1IE3A 4IDDA 4BNXA 4I5DA 3C7DB 3V2GA 4ALJA 4WCFC 4HADA 4K28A 2OO5A 2PGJA 1UDAA 2NACA 2OOSA 1YB4A 3GAZA 3R6DA 2WYWA 4RVUA 1ULUA 4B4WA 4IUYA 3ZWPA 1G6KA 3RI3A 5JW6A 4QXMA 1U8XX 3PDUA 3L6EA 4I5EA 2RH8A 3OF2A 1HDZA 4E21A 2YDXA 4XRGA 1P1RA 1QR6A 4PLVA 2AE1A 1EUCA 3OSUA 3RUHA 3EW7A 3K9QO 4DL9A 1I32A 4E5KA 1T2AA 1V3VA 1Y9EA 3DMYA 5BT9A 4BS9A 3PYLA 1Y6JA 3CH6A 5F5NA 3JYNA 1FDVA 4IMRA 3CSDA 4FJ1A 4YB8A 1V9LA 4B7UA 3KOUA 4NQZA 4KOAA 2WDZA 1V35A 2AQ8A 3CPSA 5CPBA 4AJPA 5IDWA 1B15A 1JKIA 4LVCA 2WEKA 2OORA 1ISHA 2FP4A 1PS0A 4OM8A 1O6ZA 2A9FA 4R3WA 4OKNA 5GZ6A 1LX6A 4OKIA 1E0DA 1UUFA 4IIVA 4DREA 3UUWA 1SMKA 1Z6ZA 4JBHA 3QJ5A 2OL4A 4UVIA 4PG8A 4AJJA 2TMDA 4CM8A 4CM3A 2WD7B 2Q1TA 1AXGA 1ZVMA 4MKZA 5A02A 3ZWWA 3FBGA 1UZNA 1P44A 3V8BA 4W4TA 1BTOA 2X0RA 3O9ZA 3WBBA 3PJDA 4CUJA 1H9AA 2Y99A 4FFPA 3WYBA 1J4AA 3MJ4A 5JNLA 4D3DA 2VZ8A 1ULSA 3E1KA 4QTZA 5BNTA 5MGBA 3SEFA 5A05A 4NNJA 5A06A 1XIVA 5KNLA 2WJPA 2DM6A 4BO3A 2OBYA 4BNKA 5B37A 3Q9UA 2HRBA 4CM7A 4WOJA 2Y66A 1B0AA 4WJZA 1K5HA 1LBEA 1FJHA 2VUTA 1LJ8A 4OIMA 4IDGA 5COQA 4CODB 3RBZA 2Q46A 4CM6A 4A10A 1XELA 7MDHA 4XEHA 5CPFA 4ALIA 3DFZA 2PKQP 3PHGA 3H65A 4R68A 4TZKA 4M54A 4C7JA 1SC6A 3PLRA 4YT5A 2CFCA 3JSAA 4NR0A 3KLPX 4U0KA 5EERA 5FI5A 3RUFA 3ZV4A 3KVOA 4XX0B 2JCXA 2YFQA 4R3NA 4J4TA 4YJGB 3UCFA 3OJ0A 4XYLA 4P8RA 1B16A 1XR3A 3D7LA 4YDRA 4J7CA 3TZ6A 3TFOA 3GNQA 3DZJA 3FRJA 3A14A 2B83A 5FWNA 5AOVA 1Y81A 1MC5A 3WYEA 2F00A 1J6UA 3PHLA 4IM7A 4UULA 5G0VA 5DDIP 4BNFA 4EI2A 2ZTUA 4RF5A 4KZPA 1O95A 1R37A 1K89A 2BHLA 3L9XA 3ROKA 5C3MA 2UVDA 2OMEA 5KJ1A 3QY9A 2FR0A 4YAKA 3RQSA 1MXFA 4FS3A 2DBRA 3DBRA 2NQ8A 1QORA 2EEZA 5BR7A 3BAZA 2DTDA 3E18A 4ZJUA 3UCXA 4PVDA 2X23A 2E48A 3B6ZA 3GDFA 4D3SA 2IZZA 4B4UA 1I2BA 4E5MA 1T1SA 3E48A 5LC1A 1E5QA 2D5CA 1VL8A 2VN8A 4TMFA 3VDRA 5ITWA 4HBGA 4TVBA 4QFDA 4J91A 2NWQA 2HK9A 1U3VA 3JD1A 3GVHA 1QG6A 3AM4A 1NR1A 4ITUA 2J3HA 5DF1A 1JKFA 3NJ8A 3HHPA 4BKOA 1UP6A 4GBJA 5EQDA 1PGJA 4JLWA 2O2SA 2VT3A 3G3EA 1EUDA 1Q0HA 2X4GA 5KVVA 3WGIA 4YJGA 1I8TA 2Y1CA 8ADHA 3K31A 1YDWA 5L7YA 1R4NA 3CINA 5K6AA 3AOEC 2HAEA 4L4XA 3K5PA 4HY3A 4CMIA 3GRPA 1FDSA 3PJFA 5FEUA 3QSGA 1TT5B 3IIEA 2NU7A 1G0NA 5AXDA 2DFVA 3F5QA 4CV0A 1GY8A 4YYZA 1F0YA 2CDCA 5G4LA 2X0IA 4BB6A 1BHSA 1Q7GA 1DIHA 3BTUA 4AJIA 1BW9A 1EVIA 1T4DA 3DTTA 5TS3A 3MTGA 2FPIB 2WD8A 3HZZA 3OM9A 1K6XA 1Y5RA 4JJIA 2G5CA 4DLAA 1ZK4A 4B4VA 3KYDA 2Q1SA 1LUAA 2QHXA 4M1QA 2V6BA 3D4OA 1DO8A 2GASA 3NGXA 3OETA 3DC2A 3TOZA 4ZRNA 3DBHA 3GPDG 1KVSA 3LC2O 4II2A 5CFZA 1VPDA 5TIIA 1KERA 5TJHA 1WAMA 4NBUA 1I3NA 1X1TA 2J5QA 2X5KO 3FI9A 3GUYA 5CDYA 3JQGB 1C0PA 3DOJA 4MP8A 3NX4A 1YVEI 4YQYA 3GA0A 4IGEA 4ZQFA 5ER6A 3I9OA 4DQUA 5JYDA 3O8QA 4A26A 3AI1A 1NQAO 4RJTA 3VZSA 2B4TO 3ZWNA 3PP8A 2AQKA 1XA0A 4EJ0A 1GUYA 1HDXA 1Y8RA 2PZJA 3JD2A 4PLZA 3QLJA 1JAYA 1X7DA 4WNIA 3I9KA 4D46A 3RUEA 2ZB8A 3ASVA 1YONA 4IJUA 3WQSB 2ZYDA 4AFNA 1JVSA 4XA8A 1GFSA 3PHHA 1P31A 3KV3O 3DQPA 3MZ0A 2P5UA 1IZ9A 1WVGA 3GF4A 1VJTA 2WE7A 3AU9A 3PPIA 4QX6A 3S8MA 4DWVA 4AJOA 4KUGA 1WP4A 3PQFA 2ET6A 2GR9A 1E3LA 2VHWA 2NUAB 3ZNPA 1ZSNA 1MA0A 1N9GB 4CMKA 1HSOA 3DMTC 5A5FA 3FSRA 1NYTA 1DHTA 3L9WA 3EGOA 3NJ4A 3W8EA 3F4BA 5AXBA 5JSFA 1CDOA 1TEHA 1WPQA 4D0SA 2O2YA 3D5QA 4DMMA 2HMTA 4CLEA 4WLOA 4GGPA 1U2DA 3MWDA 2E82A 2ZTLA 3GFBA 4BNVA 1IHYA 3ETDA 1RM3A 1KETA 3OEWA 3WWZA 2IYPA 1MG5A 4TRJA 4YRDA 2H6EA 2O4CA 5JCJA 4XDZA 1UR5A 4KTVE 1EE2A 1Q2XA 4MIYA 2WD7A 2NVUB 2GPTA 1KS9A 4QO7A 3FNHA 5IZCA 1G1AA 2G17A 3NRCA 4OQZA 1A7AA 3DAPA 1YXMA 3DHEA 4J6FA 5CHEA 4EGFA 2Q45A 3HDJA 4ZICA 5IAAA 4DXHA 3I4CA 5KKCA 2ZCVA 4D42A 4AICA 3G0OA 3L6OO 2R00C 3EAGA 3FNEA 2PGDA 2VQ3A 4MKXA 3VAZA 1ZMTA 3VHRA 1NWCA 2CDBA 3DZKA 5JAMA 3I4FA 4Z0HO 4R54A 1ZW1A 4CUKA 4CV2A 1LLQA 1ZZEA 2C7VA 1I30A 3H2ZA 3HADA 4FJ2A 4IZHA 4GKBA 3SC6A 1JA9A 4XQCA 4E12A 2YV1A 2DBVO 1ZJZA 3MWEA 2ZKLA 5ER9A 4P4GA 2D5AA 1X15A 3C85A 4DQVA 1TLTA 1O5IA 1PJQA 4OOEA 5EQFA 5I8WA 1T24A 1JLLB 1P1JA 3RKRA 1VJ1A 1W0CA 4Y67A 5K0ZA 4UUPA 2VOEA 1M76A 1HDOA 1UXKA 3FR8A 1WLYA 3JD4A 1Y8QB 5L9AA 3ONFA 4ND3A 3I6QA 4W9NC 2YW9A 2HJRA 3RJ9A 2I67A 4E2XA 2G0TA 3T7EA 3UW3A 3WXBA 4H3VA 3QHAA 2E4AA 4OH1A 1KEUA 2Y1DA 4U0JA 4N5NA 4BKPA 3VPXA 3KZVA 4J9VA 4RDIA 4TQGA 5U9CA 1Y1PA 1QP8A 3GEMA 4HNGA 4RORA 4UEKA 4FGWA 4I9UA 4NHEA 1KVTA 3QQPA 4YT2A 1SBYA 1PJ2A 3NGLA 1M2WA 1I3KA 4AJ2A 4A27A 1GL3A 2OGUA 3JQ7A 2IEBA 1KYQA 1HLDA 4J7UA 3R3JA 2CY0A 3LF2A 4K1LA 4O6VA 1W4ZA 4ALLA 1Z73A 4JP3A 4JN6B 4YCAA 3L77A 5KCZA 1IYZA 2QIOA 2JD0A 3FPCA 3NTOA 3DBLB 9LDBA 2C59A 3HB4X 3K73O 3ZU3A 3GGPA 3B1KA 3ZWVA 5KIAA 3IUSA 1U7HA 2VWPA 1IB6A 1F17A 3BIOA 2QRJA 1Z75A 3C1OA 3DEYX 3IS3A 1XHLA 4XYMA 5A1TA 4WK6A 1NFFA 1V3UA 3IJPA 4DRYA 3K92A 4HV4A 1E1KA 2DKNA 2D8AA 5IXSA 2YQ4A 4WUVA 1DIBA 5GZ1A 1NASA 3CMMA 2DQ4A 3ZWOA 4BNUA 1T4BA 2E49A 2GGSA 4YT8A 5ENDA 5G4KB 2O4UX 4H15A 1NAIA 3ETGA 4WEQA 4Z9FA 1NTOA 3NDIA 3WDSA 4D7AA 2PA3A 3BMNB 3JQDA 3CZMA 3OA0A 5A9RA 4Q9NA 2EW2A 3KEOA 3JQAB 5G0UA 3HDYA 2FOIA 1ZMOA 3MEQA 1N1EA 4OOFA 1U8FO 4M89A 2I76A 1L7DA 3EZYA 4BMNA 2PD4A 2WE8A 4BQPA 4GQAA 2YHIB 4G81A 1NQOA 3S1LA 1ZEJA 4BOYA 1B8PA 2VCYA 3VTFA 1UP4A 1E7MA 1HWYA 3PDJA 4YR9A 3EMKA 4XCVA 4XGIA 4R5MA 1DHRA 3U9LA 5AXCA 1ZIDA 3JQBA 5IJZA 3WIEA 3AOGA 4ZQEA 2D4AA 2H1SA 5L3ZA 1P33A 4PZCA 3W1VA 5JFOA 3NAQA 3LLSA 1OZAA 4ILKA 4R51A 2VYND 4R9SA 3RFTA 1ZBQA 1UAYA 3EYWA 4CM5A 4RCVA 3I9MA 3PLNA 1PTJA 4YXFA 2PFGA 1H6DA 4XB2A 4I9HA 2AQHA 3SJUA 3ZWAA 1SO8A 4PGFA 1OMOA 3OECA 1JTVA 4GMFA 3VPHA 4IBOA 1OC2A 1DIGA 3FHLA 1YGYA 3RU9A 4YRAA 2ZJ1A 2AG8A 2IZ0A 3HE3A 4WLFA 3PHJA 2RIRA 2EERA 5JCXA 1Z45A 4MVJF 2YJZA 4FGSA 1KEPA 2HMWA 3AY3A 1SB8A 4MP6A 3OH8A 2H9IA 4GSKA 4FC6A 1L1FA 5FF9A 3IMFA 1GUFA 3AU8A 4OGWA 3G1TA 1QV6A 2GSDA 1E6EA 4BMVA 4EZBA 3RUDA 4H7PA 4NG5A 4XYBA 2NV6A 3VPFA 4NFYA 1ZK2A 3M2PA 4J0EA 3L0DA 3T4XA 1UDCA 3MWDB 5KTKA 4MVJP 3IJRA 3D64A 4DLBA 4AJHA 3ENKA 3N58A 4WASA 2GZ1A 1EK6A 1HRDA 3WTCA 1HXHA 2XPCA 4FFOA 4NJMB 3VTZA 4Y9DA 3W4KA 1AN9A 3BMCA 1DJQA 3QWAA 1RJWA 1H9BA 4Z6KA 5L4LA 2NADA 1KY4A 1FMCA 1DFGA 4CM9D 1A72A 1QXSA 4JBGA 1Y7TA 1Y9AA 1I2ZA 1RYDA 1QRRA 3I1JA 3NT4A 3ZWBA 1PZEA 1QMGA 4RDHA 4Y6SA 1QYVA 4K6CA 3JTMA 2LDBA 4MKRA 1MC4A 1C0IA 1GCOA 3AM5A 4QT0A 3DAGA 3JV7A 4M49A 3QVSA 4OJNA 4Z3KA 4OXNA 9LDTA 2D0IA 1RM5A 4FCCA 2CF5A 4XX0A 5KJCA 3ITKA 4PRKA 4TRMA 1PEDA 3HG7A 3H5NA 4D79A 4FSHA 1ISFA 1ZSYA 1D1TA 4WGGA 4BV8A 2NLOA 1KOLA 3ZU4A 4IJVA 3VH4A 1WZIA 4GSLA 2GLXA 4YTEA 3WGQA 4CL8A 3TRIA 1VSUA 1TB4A 4N7RA 2PKRA 1WZEA 3KLMX 1ISMA 3KSUA 3S2IA 3ZV5A 1Y8QA 3JQFA 1PJ4A 1NAHA 2PK3A 4HKTA 3JYPA 4J0FA 3PZBA 3RKUA 4RPKA 2C5AA 4UUOA 2YV3A 3I9NA 3QRWA 3GG2A 1W8DA 2BFMA 1EK5A 1PZGA 3ETEA 1DIRA 4XR9A 1GPDG 2R6JA 2UDPA 2VNSA 3PGXA 5TC4A 1NHWA 3NDJA 1Q7BA 1B3BA 4YBZA 4EJ6A 3L4BC 2PZKA 3ZWMA 4YACA 3D3EA 1E6WA 2P2SA 3WWYA 5TNXA 3DZGA 2BFPA 2GN8A 4ZU3A 3SLKA 2EKQA 1R6DA 3PTZA 2PKQO 3LYLA 5BSEA 1WMBA 4IDCA 1JLLA 1RM0A 3H6KA 2VYVA 3KRTA 3RIHA 1J0XO 1LRJA 1KEWA 3RC9A 2GUGA 2UUPA 3K2EA 3ENNA 3QWHA 1YBAA 2BFOA 1Z74A 3PWZA 1M75A 2Z1MA 2P91A 2QYTA 4XZ3A 1YQGA 5GMOA 1M66A 2EXXA 2ZYAA 3FBTA 4CLXA 1YWGO 2DTEA 4KDFA 3E9QA 1FDTA 3P19A 3AI3A 1WMAA 4ALKA 1R4MA 5A9SA 3D3WA 5BQFA 1LDMA 3WIDA 3ZN2A 4RVFA 1UZLA 2EWMA 2ZTVA 2O7QA 4CM4A 2G1UA 1TVEA 5C5IA 4OMUA 1R0KA 3GGGA 4MVJH 3WJAA 1U3UA 3LF1A 1WWKA 1AHHA 4EUEA 1C3VA 2JJYA 2VWGA 3SXPA 4BUCA 1T26A 3DZFA 3RD5A 4BIIA 4NBVA 2FPPA 3SJ7A 3GR6A 4MOWA 1H2BA 4MINA 4YEDA 3PFFA 3MTJA 3K96A 4WOKA 4ZRMA 4WCFA 2NU6B 3OP4A 5LDHA 2FSVA 5JC8A 1VL0A 4UREA 1DLIA 4I9NA 1PQWA 1HF3A 1LLCA 2XXBA 5KWEA 1TI7A 4XD2A 3FTPA 4RPJA 1MV8A 1DC6A 2AEJA 1OBFO 2CDAA 1TA4A 2ZQZA 5B12A 4TWRA 3TZCA 1PJBA 1BMDA 2FZEA 5KOIA 1ID1A 2RHCA 4TKMA 3IAHA 1KIFA 4M8SA 1ZKMA 3MOGA 2JL1A 4N5MA 3VPSA 5JY1A 5L40A 2OZPA 4P38A 3O4RA 4MP3A 5TSDA 3CMCO 1KC3A 1XQ6A 2X5OA 3PWKA 2PZLA 5A04A 3RAJA 2A35A 1PIWA 4MDHA 1A7KA 3FCOA 2OHXA 3INTA 4XYEA 3C1AA 3D4PA 4U8GA 5I7FA 3T4EA 3C1TA 1FDUA 1N7HA 2WYVA 2VTEA 3H9EO 4GLOA 4PIVA 3H8VA 3U4IA 1HDGO 2AEMA 3P5SA 3TQHA 3O8QB 5DOVA 5THKA 2PGLA 1CEQA 1KC1A 4GVXA 5HA5A 5CDGA 2O50A 4BNTA 4ZVVA 4YPOA 4D45A 1NVTA 1YBMA 2GN9A 3TJRA 4BO9A 3KYCA 3ZV3A 1FK8A 2V6FA 2D2IA 1CF2O 2WMDA 4GX5A 5B1YA 4BGIA 4TRRA 3C7AA 3DMTA 4TVOA 4CLOB 5HWSA 3ZH2A 1U5AA 3I9JA 1XEAA 5JAIA 1CERA 3UKOA 2Q2VA 4PLGA 5EL0A 5L95A 2VZ0A 2RHRA 4D41A 1ZK0A 1ENZA 3WMWA 4Q3CA 2BFAA 2CVZA 1P9LA 3V5NA 1KVRA 2DU8A 2QRLA 4JQCA 5JLAA 2O3JA 3VH1A 1MGOA 1NM5A 2AQIA 1I2CA 3VVBA 2EHDA 1E7YA 4U6SA 1VE9A 2G82A 4J1TA 4JGBA 1GV0A 4EDFA 1V0JA 2FRDA 4ND5A 3K30A 3TNLA 3WBFA 3WLEA 4XKJA 4DYVA 3HUDA 3PJGA 3TZHA 4WPGA 3QWBA 4K26A 5JO9A 1R16A 3K8ZA 4IS3A 3RROA 2X1HA 3WGTA 1SOVA 2JCYA 5ADHA 1GQQA 4AJ4A 5I9LA 4J9UE 3GZNB 5DZSA 5JE8A 1MX3A 2VRBA 3PXXA 5TGDA 3PYXA 5HS6A 1JWAB 2RCYA 1EMDA 5CEFA 4BNIA 4B7XA 4HXYA 5H83A 1NVMB 4AJNA 3N7UA 4Y98A 2NSDA 4MVJM 3DBVO 4FPXA 3EUWA 2X86A 1E1NA 2D3TA 2HLPA 4Z0TA 4WLUA 4BO0A 3W8FA 3U62A 1QLJA 1LSUA 3PK0A 4IQGA 1JU9A 1NP3A 1PQPA 1GR0A 2DPGA 2LDXA 1PJTA 3PHIA 5H82A 2DVMA 3Q6IA 1DJNA 1WDLA 3U4HA 3BXXA 3LLVA 2AMFA 4RVSA 4NBRA 2A92A 1O9BA 4RLHA 4YJHA 2IE0A 1M6HA 1FF9A 3WB9A 3VZQA 4R9RA 3BTOA 3DONA 3GVXA 3PIIA 2VZ9A 1UH5A 3H2SA 2OXIA 4BKRA 3G79A 5COAA 1S7CA 5JPIA 4LN1A 2B0JA 5FYDA 2FY8A 4ROSA 4B8ZA 1U7TA 4ESOA 1BDMA 1C1XB 2JFFA 5CP8A 1YKFA 3B1JA 5DNAA 2PH3A 2Y05A 4PLHA 2VHXA 2ZCUA 3NEPX 1GZ6A 4Y6PA 4KDEA 3E5MA 4NZ9A 3LT0A 1X13A 2FP4B 4Z9YA 3OIFA 2W2LD 4RPHA 2JAHA 3ZNOA 1NPDA 4LMRA 2AG5A 3FNGA 1U4OA 3GH3A 2QYSA 4BHTA 1DC5A 3QVWA 1EE9A 2B5WA 4FR5A 3TFQA 3GFGA 4PZEA 2DTXA 3JQEA 3INGA 5HM8A 1ZH8A 1CQIA 4OAQA 4TROA 4IINA 4UVHA 1JDJA 2HRZA 3DB2A 5C7IO 1G0OA 4TRNA 4IQ0A 2DUWA 2C2XA 4RLSA 1ENOA 5KJFA 3SX2A 3SBOA 3TDKA 5DBGA 2NVWA 5BSHA 2I99A 1U3WA 2PD3A 4BVAA 3IKVA 3ULKA 4CUZA 5ILGA 1J5PA 2VHZA 4RF2A 1X0XA
chains in the Genus database with same CATH superfamily
3GLIB 1YULA 1KI6B 1YB1A 1CZNA 3EGWA 1SUWA 4J1NA 3D6MA 1F2VA 1Z0ZA 4GMGA 3RRXA 1V96A 1U65A 4NYMR 4WL0A 3WLKX 4BKQA 3DPIA 1EVJA 4BNYA 4LV5B 1FQJA 2FN9A 4HFMA 3O8OA 3WX0A 3B5IA 1X1EA 1USKA 1X1SA 3PUVA 4PC2A 2NU9B 5GTDA 1QIKA 1JE0A 1OVMA 1B6TA 5F1KA 1OB5A 1W0KD 4NEHB 1NUSA 3THYB 2MDTA 2C5EA 3EXIB 3FB4A 5AD1A 1L6IA 1ELOA 3LKDA 3AUSA 5DHAA 4Z49A 3KJXA 3RFVA 1K8XB 2GAJA 2Z4TA 1MBZA 4IDNA 4M8KA 3N86A 3NRBA 2I8CA 3S0JA 5C1DA 1TRKA 3PC7A 4EHIA 1M74A 4F3KA 1NFQA 3HC7A 1H2FA 4QUKA 5DBHX 2IWHA 4F7DA 4ZEVA 2JJ1A 2YJ4A 1HETA 4OP2A 2XCOA 3TZLA 4CG3A 4FE7A 1C9KA 2OHGA 3KFVA 2BWJA 4EYQA 3G5AA 5HF5A 4XWWA 1VA5A 1LW7A 2MYUA 5H3CA 5T6MA 4BLWA 3O3OB 1AA9A 1P3Y1 3H6HA 2WLTA 3BZWA 3SLRA 5KU7A 2IYQA 3ZXIA 4ANFA 1M6WA 4REQA 4OUDA 1SCDA 3OJEA 4HNSA 5G0SA 2J31A 4DN6A 2W2KB 3SE0A 3D3WB 4ARIA 4YYEA 5BUSA 2O5RA 3C3CA 5AW9A 1CEXA 3G88A 4BUJA 4CV1A 4QDKA 2PM8A 5E6RB 3GLHB 5A4DA 1WUTA 4DLUA 4IF6A 2XHEA 3F1LA 4OUKX 1LVUA 1DG1G 4PLYA 1FBNA 1QG4A 2ERCA 3THXB 3OZ7A 4KAAA 2V6GA 1E4EB 3LECA 1YR9A 3QXGA 3LG2A 1A4IA 1N5JA 3W6ZA 5KTPA 1XNHA 1Y1LA 2W2MA 1ESEA 3E4CA 2NVUA 2V74B 3H4MA 1SIUA 3GU3A 3JWHA 3N8NA 2WJJA 3ETNA 4XIYA 4QYTA 5GOZA 4YCCA 1L6RA 3S5JA 1MJHA 3M5DA 1QCDA 1CULC 1G16A 3OD5A 1Q92A 2WW8A 2Q1XA 1BA3A 2I71A 3KQPA 2IV7A 2YJTD 4FOOA 1YL7A 1YO6A 1OBHA 3ILSA 4HUQA 2WV7A 2HT6A 2V65A 3PXUA 4E5DA 5L53A 4WKCA 3SE7A 3OIDA 1SN7A 5T8KC 3VI3B 4HVLA 4OLBA 4KQJA 5CW1A 3GHHA 1N25A 1MA3A 5CLJA 2O6LA 3LPDA 4DLRA 4ZTZB 1T5LA 4URHA 2OBMA 2PAFA 3LBYA 3UOGA 3MMZA 2NXNA 4BMSA 3IQDB 1UM9B 1Y3BE 2JJQA 4LYGA 1DCTA 4HP8A 2NZJA 2A3RA 3FKQA 3NBYC 4XGQA 5AOCA 1VE5A 3EDMA 5IWCA 4OQNA 3ZZUA 3OPVA 3G2IA 3H3XA 5KVSA 3C6MA 1XLUA 1NDUA 3OIYA 4CCYB 1B1CA 3R8XA 4E15A 5A5EA 2TMYA 2AF3C 2I7CA 3QWFA 3KOZA 5TJ9A 1BFKA 4M1EA 5M29A 2XUKA 3O2NA 3IV9A 5ICMA 1U1IA 1VFPA 2VJYA 3PPYA 2AFHB 3HCAA 1ES9A 5HKBA 3F67A 3LHIA 1CUFA 1X1AA 3JQBC 5ED4A 3BD7A 3BHMA 4MH0R 4QBGB 3ET5A 3FTNA 4Q9HA 4MMYB 3FWZA 5DBFA 5H3HA 1T5OA 2JLAA 5IK2A 2IHNA 2X22A 1ODLA 3DKVA 3LBNA 1LCIA 4PFKA 4C87A 4FYHA 4O59O 3KK0A 1E1QA 2ZB2A 3IVGA 1YIDA 4BCDA 1T25A 1QQ7A 2FEPA 3IMGA 3KKMA 3MILA 1QP0A 4TMVA 1PZHA 4HQLA 3KB2A 1YH3A 2ADMA 5KTRA 2IL1A 3PIRA 1C3OA 5T4FA 4MXDA 4DOMA 3IE0A 2CUKA 5LMCA 3GLFB 1OH7A 1F51E 3BJEA 2NNWB 1SWWA 3L4EA 4AD8A 4NZMA 1NLUA 2G9UA 3EODA 2ZUBA 4YRPA 4P93A 4W1PA 1T5TA 2D3WA 1UMCB 2CW5A 2XOXA 5A7FA 1DAKA 1E20A 3LRTA 2QNIA 1XQXA 1LSSA 1WW3A 2ODAA 4FMCF 5EJFA 1GPH1 5FHQA 4BAUA 1IBMB 2Z1NA 1H65A 1L5RA 4EZEA 5I3ZA 4QUGA 5JO0A 1NSYA 3DH0A 2RARA 4G07A 1W85B 3MGGA 3Q7EA 5JSHA 5KJ6A 1RCFA 1GTG1 5HEKA 3BL8A 1X6VA 1G8FA 2HK6A 3AR4A 2UYQA 3TG2A 2JHFA 3RRYA 2IDZA 3OKAA 3PFNA 3TCXB 5JNSA 4D3FA 1Z35A 1G8MA 2O05A 3H1BA 3HSYA 1IG0A 4KX5A 1F8XA 3G82C 4HYQA 3LZDA 4Q1EA 1DEKA 1WCV1 2CNBA 2P4EA 5I7VA 2FI1A 4QJ3A 2QGZA 2C2YA 2GNOA 2GXSA 2JIMA 3IJEB 4B3CA 1DAPA 1XTTA 2V4ZA 1GPJA 3B2EA 3WJ7A 4TUYF 3WC4A 4TWAA 3AF2A 4W7IA 5KAMA 2NUTB 5LOVF 1GTL1 1GCUA 2X7HA 2VTDA 4BB5A 2HWKA 3BA1A 4UNPA 5DOZA 2XADA 1UKVY 1T2FA 4PBSA 3AK4A 1JG7A 1DWQA 1LC0A 4ZVSA 3GNTA 4RY9A 1FPMA 3CRQA 3UANA 1M67A 1V5IA 3L4JA 1YCHA 2VZEA 3NASA 3P9IA 2D5BA 3I5UA 9GPBA 1BCRB 4NCBA 5H5JA 3F47A 4GYYA 3TL3A 1K2VN 3T3OA 1Y3DE 1I1NA 2PZMA 2DY1A 4S12A 5EVJA 3DUFA 3ZNQA 2I2FA 3QXCA 1XYGA 4U4AA 1NP7A 3V48A 4PPNA 2Q41A 1HKHA 4N6NA 1N57A 3EEOA 3DMFA 3O4VA 1K6EA 4OUDB 1Z0SA 2YJ5A 1L4NA 4RVHA 1QCCA 1XZLA 2HIGA 3FDZB 2IELA 3FVWA 5I4BA 4XASA 4GGOA 2QMEA 3L6DA 4JFRA 5IC4A 1E7WA 4CM1A 3SSOA 4S04A 2NO5A 1PL8A 2I4MA 1ZAKA 1ONOA 2VNAA 2YINC 4ZXFA 2L69A 2OD2A 2ZIFA 2E4VA 3ASZA 3MJTA 4OY3A 4OHZA 5BORA 3HYRA 2H2HA 1V7QA 2MJLA 5AJWA 1N7GA 4LX8A 3UFXB 1Y7LA 2FX2A 4RK1A 3ZCXA 3VDNB 2A5DA 4R1TA 4ASUA 1KORA 1JHRA 1POWA 3MT7A 1P9NA 2GM5A 5GZ3A 4HB3A 2VJLA 1N5DA 2ZB7A 3CCFA 2G40A 1NQ5A 2H31A 3IERA 3IPRA 3JWJA 4JITA 1GLGA 1IY8A 4CT4B 1CHNA 2GAOA 2QSYA 3CN9A 3SMVA 3ZWQA 3T1VA 3ZC3A 3PDIB 1KSGA 1VCMA 3H16A 2GBFA 2CFOA 1O6BA 3RK1A 3O3NB 2PH7A 1V4BA 2C97A 5IDYA 1OILA 5C7LO 5C3UA 2Q9UA 2W6MA 1HYGA 5DULA 1SOAA 4R98A 2LGJA 1QYCA 1I3MA 1XZQA 1M0TA 4G25A 4PFJA 2VPZA 1QBKC 4X0EA 1SEVA 2NU6A 2QB5A 5I9MA 3RTEA 4BDSA 4BIMA 1L1QA 1WXGA 4J1SA 4WY2A 1KQ3A 1LQTA 2HTFA 4HN2A 4XVCA 4ZMBA 5AKEA 3W2HA 2PKEA 4NBNA 1QE5A 4F3CA 3CX8A 4K6FA 1A9ZA 3PE6A 1RHJA 1ZD8A 4ZO8A 5KCMA 3VNAA 4URZR 2FK8A 4DF3A 2Q50A 3OHSX 4QECA 3EZNA 5GV7A 4XGKA 1KL7A 1UBLS 2XGGA 3LKVA 3OM8A 3SIWA 4U3JB 2GJ4A 3BJIC 3LRPA 3QFRA 2DHEA 2FQ1A 1II9A 1PFVA 4Q1AA 2VC2B 1R4MB 4ONEA 1VE3A 1KYZA 1SIWA 2RHTA 3ON5A 1WY5A 3SIRA 2HA6A 3AJ8A 1VBFA 3EXHC 3MXTA 3CGWA 4X6XA 2OWDA 2CXQA 2OC9A 1I5RA 1AJEA 3EFHA 2H1IA 3G85A 2H4XA 3GGSA 3QUTA 4Y6GB 4H4EA 3AVWA 4INJA 4X71A 2V0GA 2J0UB 4M8NE 1F0NA 3TJMA 3PQEA 4V03A 5JWRA 3NHBA 3ONDA 4UEJA 3A1SA 4I19A 2R1ZA 2F1HA 2QJOA 3FZGA 4WW0A 4MV7A 1J9ZA 1RPJA 4ARZB 4F71A 5D87A 3NDBB 2G5PA 2YY6A 4DG9A 1ZK1A 1G38A 2FKNA 2Z6AA 1C4XA 1FPQA 5HIJA 2OK8A 3QLEA 3UMBA 5KVAA 3GY0A 1CHDA 3M83A 5K0NA 2H29A 1ABEA 2HJWA 2P3OA 3R20A 4E2ZA 4GXRA 3NEJA 2QW8A 1JI0A 2WF8A 2KBFA 5I9SA 4Q39A 5U4QA 1KARA 1P8JA 1U1DA 3OTIA 3HL4A 4ZYXA 1TYZA 3DEJA 4B2IA 1OZHA 3VZPA 1R27A 1OYVA 3HBAA 5DM70 2XOEA 3IMCA 3KPWA 2D8MA 1W7AA 4QRIA 1DX6A 5H7XA 1IDN1 5JAQA 1J2EA 4Z0PA 2WYOA 3TAXA 4I50B 1XWIA 4YCMA 5DCWA 2BMJA 1F2DA 4AMUA 1UEJA 4N9WA 2V6MA 2BJVA 5LXTB 2RMKA 2FSVC 5HE8A 2FMFA 4PPQA 4XIJA 4JI3B 3ZJ4A 3F71A 3ONEA 4NU8X 1QOZA 3M89A 3LU1A 1TX4B 1WF6A 2FDCA 4CQMD 1W44A 1RRGA 2Z8YA 3IIKA 5J2UA 1F4VA 1CIJA 2Q9BA 4GXTA 2WT9A 3EEBA 2IOFA 1P9OA 1IOWA 3L7CA 4CMBA 2Q3MA 1FJXA 4N7JA 2HJHA 3IRUA 2WUVA 5JJCA 4CEIB 2B4QA 5FR1A 1BKYA 2MOKA 4BV9A 1R3DA 4PYIA 3RT1A 1YRYE 2ZRLA 4N40A 5TGTA 2VRCD 2J9GA 2P78A 3DWGA 3E5RA 1N0WA 3KHTA 4DV4B 4BNJA 4IH9A 2J46A 1XXHA 3SM9A 3AF6A 1VPWA 1YBVA 2ISSD 1CETA 4RZHA 3FYUB 3PVZA 1CY0A 2LXNA 3P2OA 3UGKA 4BQRA 5K7SA 2XQJA 4MVXA 3EUEA 3WYNA 2FDRA 2REQA 4PO9A 5ES4B 1FRFS 4FYIA 4EATA 2QXTA 3WNQA 2PS0A 2R62A 4D5EA 2I4NA 3HY4A 3NYIA 5F23A 4L8LA 2AW5A 2BIFA 2P69A 2NV2B 3GD7A 4F5EA 1B8OA 3FWKA 4DV5B 4XOUA 4BNLA 2HCFA 1NNI1 2VNHA 4U5QA 2IYXA 4E33A 1CZHA 3DE4X 1U0BB 1N92A 1ZCFA 4NARA 1NXXA 4LQLA 1ZJYA 1H2HA 3HDTA 1XU9A 4RM2A 1J1UA 1D7OA 3DFKA 2V5AA 3B38A 4DLWA 5KYYB 2PH1A 1CDZA 3FHOA 3H9UA 2XNHA 2EU8A 4FFLA 5I8ZA 4D8WA 3HXLA 1NQXA 3JQ9C 3LX5A 4I4TB 2YZKA 1CNEA 1DXHA 4TM8A 5EZYA 3PC4A 2AC7A 5JBNA 3FJ1A 3I30X 2J48A 3W8RA 1V3TA 4PAOA 1U4SA 2A4KA 3PTLA 1QX3A 2PL1A 1COWA 2GO1A 3DBIA 4HQRA 2HMVA 1ESDA 4WSOA 3UHAA 1Q0PA 2O3SA 1G3RA 4PN7A 1S3FA 5HOEA 1I4WA 3UC9A 4MITA 3RU3A 3OZDA 3ZTTA 4IYRA 4EFDA 1HE4A 4PZZA 4E46A 4NK4A 4KO3S 5C4GB 4FBLA 1Q0SA 2G3YA 3GCGA 3HLTA 4GX1A 4X54A 2IV2X 3RVMA 1QDLB 4BP9A 4EAQA 4ZHQB 1RU3A 4MUFA 1DBRA 3QEAZ 1JDTA 2IPNA 2P2LA 3GT0A 3OZWA 4D56A 2SHKA 2AYYA 1C2TA 1N3LA 4EO4A 1S1MA 1XJ0A 2BGJA 2H2FA 2MSDB 4BYMA 5GOTA 5GWXA 4NL4H 2YV2A 1BE0A 1BROA 1E3TA 1JYEA 1UT8A 3O90A 3OLCX 3DVLA 2NU8A 1FSSA 2CMGA 5CUQA 2F8LA 1YFJA 4EFKA 1BYUA 2QRZA 1EDOA 1IB0A 4X7BA 2GZAA 3IP1A 4HLCA 3UB4A 5EIAA 1S4MA 5AKLA 4ZVQA 4OQEA 3H84A 5J2UB 1EX7A 4RPGA 2XKBA 2RGAA 3DG9A 4N8EA 1HC7A 3N39C 1T1RA 2XUFA 3L1VA 1M1NA 2PD6A 3F1KA 4YXWA 5C5DA 3STXA 5IHXA 5ADUS 1YE5A 1JR3D 2YJGA 5JDIA 1SCJA 1U1FA 2D7JA 3GJRA 3TM4A 3AFHA 1FDRA 3BMQA 1BRMA 4XPIA 1KH1A 4LDNA 3M4NA 5IUJC 3RFFA 2XVAA 3HKEB 2VDJA 1JA0A 3IALA 3IPLA 5E6SB 4ESHA 4JP2A 1M6VA 5FORA 1PEYA 2CJFA 3Q88A 4TXLA 3WGHA 3BHIA 3CLTC 4GU5A 2Y27A 1P2DA 1ZUD1 3AUTA 3DE3X 1XQYA 3TGPA 3CW8X 3NTRA 3BIWA 3CTPA 1MR3F 3PE3A 1UXGA 2R96A 5ECWA 2NX2A 2IGTA 3RS3A 5JXWA 5KQPA 1R10A 2J9YB 5IKXA 2ACWA 1AE1A 4OO3A 2EBHX 4QJ4A 2QQ5A 2G4CA 3V1NA 1VBKA 2AF4C 4DAEA 2HU5A 3M6UA 1VXRA 3CF4A 4GQBA 2X9VA 2OFWA 5EMLA 4B6RA 3C8HA 3MMPA 2XZDA 4M0FA 2AJTA 3QOXA 4DKXA 5K8CA 4YC7A 1E2HA 1DKQA 2O7VA 5THQA 3B12A 1G55A 1Z82A 4MCAA 4ZPXA 3IPXA 1O5TA 1YQTA 4BLUA 2HSZA 4EA7A 2BFDA 3NKFA 3BL6A 4A92A 2JHPA 1OW3B 3ZXXA 5AUPB 5A5GA 1D9ZA 3IH5A 2V5VA 3H1FA 2Y9MB 2B61A 5JCOC 1O0SA 1OLUB 2C2OA 1CUJA 1P7VA 2EYQA 2DT8A 4YAIA 1P5JA 2AOTA 3MJCA 3AV0B 4PCVA 2BFNA 4WOBA 3ZHSA 3EXAA 2C84A 1SXJC 2JIZA 5AJXA 3UWOA 2DH6A 3P5BA 3Q11A 3GUCA 3THWB 2WA2A 3MLAA 4GKVA 4IW3B 5F3RA 2WP0A 4DR6B 3C8DA 2FN7A 4J29A 4WK2B 4EPTA 4YBRA 4DR3B 2JIBA 1E9DA 5HM8A 5FBLB 5I47A 5JMPA 5ALDA 1QGAA 3CLUC 3EIXA 1Q0UA 1DXQA 3H0KA 4I50A 1PQUA 5J4LA 3PXGA 2F64A 2QN6A 3CGGA 1HYBA 5J5CA 1T9GR 1A2KC 2PMCA 3HDHA 4TTPA 4XUEA 1DV1A 3BWMA 2VF5X 3EA4A 1I5EA 3VC7A 2PNFA 1ZVKA 3FVTA 3NOOA 2PQ2A 1B2LA 3AY6A 3K9GA 5BYBA 1T1GA 2QW0X 5CVTA 3BFXA 1NBMA 4UVDA 1EG7A 2EIHA 2QZZA 3T7TA 4OJTA 4MEJA 2YWDA 4C78A 4JASB 4QQ8A 2HXSA 5BSGA 1DQRA 4K03A 2YYYA 5DEOA 4TQ9A 2EBWA 3GCWA 2BI4A 3HLKA 3QBDA 1ZNZA 2DPHA 3L7OA 1VCNA 2YXEA 3U49A 1VI6A 2XRZA 3WRVA 5BWBA 2YUIA 1F1JA 3T35A 1B73A 3Q3CA 1XD2B 3HWRA 3OZCA 1NQTA 4D9IA 4GYJA 2GJ8A 2O7NA 3C3XA 3JAMA 1R6AA 2VAMA 2HNKA 2ZB3A 1P1IA 2C61A 1U8ZA 3FYUA 3Q3HA 1J70A 1GN9A 5E0KB 1X7XB 2W2LA 3NWJA 4MRPA 3W2EA 2NPFA 4B44A 3ZX4A 1II0A 1M2FA 2MSEB 2FPGB 3GWGA 1G9XA 3HFSA 4IZIA 4YAOA 4TT3D 5AJHA 5ECYA 1BCSA 3STYA 4D9BA 3BL5A 1HDRA 4DSUA 4C2AA 1O96B 2P30A 4HRXA 2MMCA 1TPZA 4NKRA 4K8OA 4RANA 4Y9UA 3UGQA 1E96A 4EEKA 3Q3JB 1ADFA 1AQLA 1V8DA 4YWJA 5IAJA 4CM8B 4F5WA 1KYYA 4HNVA 5C8YF 1HA3A 3DSRA 1JHOA 2GK4A 1OYWA 1Y80A 2AGVA 3OIGA 3H4IA 3O82A 1XEXB 3ITDA 1PTJC 1HZZC 3GJSA 3HUUA 2H92A 4ZDWA 4J3FA 3ZKWA 4BNHA 5JH7F 5KOJB 3KQNA 3QTBA 1AUVA 4BDTA 2Y1OA 1FNBA 4K0RA 1PLLA 5IBCA 1DL5A 4YR7A 1DFHA 4V0MA 4OQYA 4PZAA 4NICA 1TZ2A 3K6RA 2C0QA 3OZIA 4Q3EA 5FUWA 3URKA 2PWZA 4FFBA 4PANA 4OXYA 3RS5A 2JFQA 4CGYA 1YJBA 2QP3A 2G67A 2OQIA 3PFHA 4YP1A 1BS2A 3GW8A 3IV7A 4KXLA 4XR4A 2FLKA 4M88A 4WLEA 2BISA 5ES3A 4JJ4A 4ARSA 3OZAA 2YHIA 4MS3A 3C6ZA 4KK3A 2J41A 1G64A 1ZH6A 3C3AA 1RACA 3L0ZA 5F7JA 4WVLA 1Y8AA 2Q2WA 1XRNA 1OXUA 1KK0A 1QKIA 3HH8A 5JAOA 3GNLA 2ORVA 3C3MA 2F9MA 3K09A 4HAVA 2CK3D 3LTNC 3NJRA 3ZHTA 1SHJA 4NNPA 2OGSA 3NHPA 3B5EA 4KO8A 2B21A 5IM5A 1ZXBA 1K92A 4BO6A 3ZJTA 2A78A 2HYDA 2W6QA 2DHRA 3F6BX 5JATA 2C7OA 1P1HA 4DQKA 1ZVQA 2JBAB 3CNOA 1P7CA 5JXHA 4EABA 4Z7OB 4P7GA 1BDBA 3PEUA 4DV1B 1LKZA 2B20A 3MSXA 3NWPA 2I4TA 4OL0A 5T57A 1YHYA 3NBMA 4F3YA 1WHSB 2ERYA 4EB6A 1JAIA 5B3JA 3T1OA 3VTKA 3VISA 2C4KA 1EX1A 1IPHA 4GOND 7REQA 1M1UA 3SQNA 2C1XA 4BO5A 1DOZA 4IKEA 3B51X 2FZCA 4IHKA 3L4KA 4XH9B 4WKGA 4GGMX 4BZWA 1T5SA 5E1OA 4R01A 2J0SA 2PRJA 4G6ZA 1O89A 1T0BA 3HNOA 1QHNA 5B2ZA 3DVRX 2PUAA 3GJQA 1XC7A 2YZGA 3DT9A 3P0IA 4GOKA 4QNMA 3RVDA 4HFRA 1XAIA 2IH2A 4IO1A 3WKAA 4BN5A 1EZ4A 3TSCA 2PUEA 1F4PA 1JLKA 2LPMA 3K0AA 4PE5B 4WK0B 3SXUB 1EUYA 1YK1A 4US1R 4I9FA 3RF6A 3GDWA 1R5JA 2BMVA 3HGMA 1IIBA 4N0QA 4NOMA 4YO7A 2KQUA 3PG5A 2GJKA 5AKZA 5TRTA 4A03A 1SZJG 4BX0A 2GCEA 3DUFB 4LI3X 4MGHA 2HX1A 1UP7A 4KE8A 5K0TA 4QE3A 3SYRA 5AXAA 1AGRA 3WGLA 3FJYA 2E55A 4M2LA 1R8QA 4FUTA 4Z9BA 1NG9A 2F90A 4J7AA 4DPLA 2CWWA 3D4NA 3E53A 2Y93A 2H1RA 4LXIA 3VU8A 2I2WA 1LRKA 1MJGM 1K8QA 4HGOA 3SQOA 3QFCA 4OHKA 3TW4A 3ZBPA 3BMCB 1NVFA 3B70A 4KLRA 1WEKA 3I5MA 1KZ7B 3NWBA 1LPBB 1YZ3A 2GYYA 3P45A 3JQFC 2ZJBA 1CNMA 3CRMA 3IURA 4CEHB 2IVZA 2ODPA 1NIJA 2Y1WA 1NQWA 4F12A 1QGUB 3T9FA 4MIEA 2NXJA 2Q6IA 4NBLA 3BTSA 3TPFA 1PSZA 4RS4A 1KAOA 3B1XA 1EWRA 3OM1A 3WL3A 4YHHB 3CZCA 1MB0A 1QIDA 1X1BA 4L57A 4N1AA 2OESA 1XDBA 3E22B 3F5DA 1ZRNA 2IYSA 4M0CA 4QPDA 4BVKA 4ES6A 1CS0A 1LVGA 2EBFX 2O2JA 2VH1A 1OLSA 2XBUA 2ZIZA 5D7BA 3U40A 4DCUA 1IUKA 2ZZNA 5CX1B 3QU5A 3OU7A 2D1SA 1W47A 1TNDA 4RSGA 3WZMA 2PBLA 1N6IA 1ZY2A 2UXBB 2XGSA 3ANMA 2CL0X 1U9IA 2XBLA 3LT4A 1PGNA 4G0NA 3ME5A 1DKNA 1JBKA 1ZEMA 2X3YA 4D97A 4P0QB 5LQDA 1JPNA 3PC2A 3PPWA 4RA6A 5CFLA 3GFRA 3H04A 4JJ6A 4EY3A 5CAEA 1KQPA 2VLBA 3Q10A 3HJAA 1C7QA 2F43A 4YA6A 3ETLA 3IR5A 3OURA 3TBHA 3H99A 3R6LA 5AKYA 2G0AA 4N5DA 2ECQA 4PYQA 4H3HB 5J47A 5DTEA 3VOBA 4CDRA 5T5QA 1Y5IA 2PQ0A 1O94A 2P9EA 1EA5A 1QRAA 4BL5A 3L0OA 3UWPA 3C5WP 2PX4A 1X3LA 2G0NA 4NTZA 4A4DA 2B4KA 4U3JA 2J09A 3M6VA 3S2FA 1EVYA 1ADCA 1OF1A 4NLLA 3V7FA 5AFSA 1Z18A 2E37A 4FVTA 1YC2A 5ALWA 1XXLA 4KWEA 4LZLA 2UZ1B 4IHJA 3JZIA 4DNFA 5BR4A 2BUAA 1E2EA 3ASUA 4XM1A 2RI0A 1CUEA 3GGOA 3R5FA 2ZUTA 2ZLBA 3HO6A 3VV2A 2R1TA 4BFSA 2Z43A 2GA9A 3R2JA 4E7PA 2JGIA 5IULC 1VCIA 3CJRA 4B43A 2RGGA 1YDEA 5J59A 3L8EA 1P5ZB 1GD1O 2QV0A 4X65B 1WZUA 3CVXA 1K66A 4YJ2B 2XXJA 4M1KA 5B3AA 3OJLA 1XMSA 5H59A 3VOAA 3PGJA 3JX9A 3KOXA 1R2QA 1DBSA 1JPJA 1NVBA 3CSSA 3OZTA 4LPSA 4Q19A 5AI6A 1I1QB 5CHYA 1GTMA 3EAQA 4MB0A 1H2AS 2QNBA 2FWBA 1TD1A 2C95A 1OY1A 2O9JA 2CDRA 4BQEA 4PO3X 4BQQA 2VQFB 4LNAA 3FIJA 1IHXA 3KYBA 1JHYA 2CEAA 2WV9A 1J2YA 1XROA 2J3KA 1BFUA 2IF2A 3X1WA 2MWMA 4C4RA 1D5CA 3DHVA 5TT1A 5EIEA 4YAJA 3SQXA 4EKYA 2PTGA 5BSVA 4QOGA 3ZW8A 1M9NA 1MOZA 2ETVA 3IOCA 4AMYA 5J9FA 4ZI7B 1EFKA 3L04A 4OG2A 1ZN8A 3LGSA 2VTBB 3B8EA 2DFDA 4YJ3F 4YMWA 4R0NA 4RV4A 4G5XA 1Q20A 4HAXA 4OYYA 2QRVA 2J8ZA 4UNQA 1I6MA 4F92B 1RJGA 3GGJA 2J3QA 3M49A 3GCZA 1AMNA 4L50A 3EFOA 1C0KA 3AEZA 2D4HA 2A3NA 2EX0A 4RMIA 4GAEA 4YRJA 1ZOOA 5BQ3A 1ECGA 4TXMA 1OSNA 3BK1A 1JFVA 2JDIA 4JYPA 3KQOA 3U09A 1EYZA 4EBBA 1DIAA 1EM8A 1AIPA 2PIDA 3W8NA 1ZN7A 1YR6A 3U3KA 2Y92A 1WHTA 1O8CA 4NJEB 4EUFA 4G1UC 4BAZA 4JNCA 3H17A 4NCIA 1GG2A 1YVUA 1UPBA 5K1ZA 3IMKA 4NABA 1VL6A 2BVNA 1TMYA 5EJAA 1K8YB 1LQUA 2H1HA 2OPBA 3EIWA 3H5AA 3EGEA 1KJJA 2OV8A 3OLXA 1SBCA 1NBWB 3G9ZA 4GI3A 4L22A 4UJ3A 5G3ZA 4J3NA 3WAKA 3UMJA 4L8YA 5KOYA 3JW8A 4ZAZA 3PNOA 4ND1A 3U16A 4JCOA 4MUIA 2D0OB 1G7TA 2EG9A 5JXJA 1GGKA 5K8TA 2W6OA 2CKDA 4IDQA 4M0KA 4YJFA 5FJJA 1NN0A 1CKEA 1DEXA 4B33A 1X8KA 3BSYA 3NQ41 1D07A 3QVVA 1FLVA 2QZSA 4X91A 1SXJE 4OSEA 4HDNB 3H2BA 4ZQHA 1T0JB 3C3YA 3L93A 3PC6A 4AVYA 1FDWA 1LNZA 2FQYA 3PSHA 5DRYA 4FWBA 3IBSA 5F64A 1C14A 1TJNA 2ZBDA 5H68A 3DCIA 4L76A 3GJZA 3F74A 3D3NA 1Y0BA 4BXOA 1HYQA 5JCPA 5B1SA 1JGTA 4CQMA 4UM9D 1KMIY 2A0WA 1U11A 3OWHA 4QDXA 2AB0A 3F3SA 4WFKA 4ZO6A 2BN4A 3UQZA 2GEVA 4FJ0A 5E0OA 1FTQA 2OVBA 3QBEA 3CO5A 3V4VB 2JG3A 5ECDA 1MX5A 4BJ5A 3P2MA 4CEJA 3FFXA 2DLCX 3SNHA 1JW9B 2GEKA 2ONCA 2QL9A 4LCJA 3ZLBA 3B2NA 3IQIX 1JMYA 1ZK3A 4XSHA 5COBA 2VLIA 2O8VA 4Q02A 4EEXA 3AY7A 3DFMA 3L0IB 3JZMA 4FIZA 1RR6A 4GYKA 4IKOA 4LWOA 5E1MA 1GEGA 3W5VA 1D6JA 3EIQA 5CRIA 3VNBA 1EJBA 4D8TA 1VIYA 2D0DA 4F86A 3GYGA 1HTWA 2E85A 2VSNA 4QELA 5CM8B 5J23A 3OZSA 2XGMA 3W4IA 4EG0A 2HQBA 4F1WA 4C2TA 1WHSA 4ZJZA 5DX8A 3M6LA 5JSYA 3V9PA 4FIDA 5FPYA 4WIAA 2HSJA 4E14A 4RDXA 4YCBA 1K88A 2XODA 1OOEA 2JCVA 4YJ3B 1RZRD 3MTBA 3P0FA 1YJCA 3FOBA 3MSCA 5B7GA 4HLUA 3R41A 3WS7A 5JD3A 2IHYA 4M6WA 5EKUA 4ZYLA 3K94A 1E66A 1GT91 3IB6A 3UUFA 4DCCA 3Q4GA 1IMJA 1QONA 2VQSA 2XDQB 3DTNA 2XTZA 3LC7O 4LHYA 1P5RA 1JAXA 2RAVA 3OPYA 4OQQA 1XTKA 3STVA 1XD2A 4B8YA 4MV1A 1XKTA 1W85A 5JUWA 3BMQB 4XPIB 5E95A 3TECE 3UAXA 1HKUA 5L4NA 1N2CE 2OQVA 4DMRA 3QFHA 4LSGA 1TM5E 1YQ9A 1HH4A 2E5FA 3A25A 4RZQA 3LUAA 3TEJA 3R8FA 1T0UA 2G9ZA 5HRCA 2XWPA 5J2TB 4LAFA 2ODEA 4RZIA 2XUDA 4XTCS 2ZUEA 3NT5A 3WICA 2P3SA 1DUIA 1ARZA 3GHYA 5BN4B 1XZEA 5HZGA 4DEXA 2I4OA 4EW3A 1MW9X 4ZIRB 1JQ5A 1RQ2A 2BMWA 1GRQA 3QE9Y 2WHYA 4NE9A 5JMWA 1QP4A 2D1FA 1OFGA 1SY7A 4E6PA 3UO8B 4DBVO 2GEBA 2DECA 1AUOA 1OBVA 1DAIA 3A9SA 2QJRA 4MI1A 1YJ8A 2VK4A 3CZ9A 1D3AA 1OXSC 1SH7A 1JHUA 4KTTE 4BN0A 4YAGA 2UU9B 2PRKA 4LRTB 2Z2XA 2YKGA 4RTNA 3B53X 4DM7A 1ZVVA 2DWUA 3TW8B 1G20E 1GAJA 2GPJA 1VBNA 1U9JA 2JDID 4WD3A 1SHKA 2QJWA 4EUNA 4QZVA 1W46A 4D25A 2ZYRA 4OFZA 3WISA 3WLRA 3IIMA 4DMCA 1W5EA 4JI5B 1NYQA 3ESQA 3UXMA 4QG3A 9ABPA 1XD9A 1XA4A 3E8XA 3CJTA 4FN4A 2ZBVA 2ZIUB 4FFVA 3Q7QA 4PQEA 4A5SA 5CH5A 1Z6PA 2RGXA 2SCUB 3N2KA 3TNJA 5JAUA 3ECCA 1HX7A 3RS9A 2QS9A 1E9VA 4RPLA 4GI7A 4J0QA 4CKBB 1E1LA 2QWXA 1E6UA 2POQX 2JLZA 1NXOA 5B1EA 5KEIA 1GZ3A 2E4WA 5EUMA 2XE8A 4ENSA 1TYDE 1UXIA 1YI1A 1Z8NA 2CFSA 4JL5A 2YNMA 2Q1UA 2JAOA 2ZRGA 4KI7A 3QU4A 3W5CA 1BC5A 3L6BA 1MJFA 2CBXA 1NW9B 5ITZB 2Z83A 4IQ8A 1N5RA 1P4SA 2HQOA 2W0MA 3LCJA 4DA8A 1C7IA 4LGMA 5FTJA 1G4AE 3CB2A 3LGAA 4O2AA 4PHFA 3KCQA 4KLZA 2O1WA 2H2GA 1P5HA 2C7RA 1J20A 1E9FA 1XSEA 5DPMA 2X2PA 3KKLA 4U9UA 3P0EA 3QVMA 5DX0A 1NX6A 2JS7A 3LUPA 2O7RA 2XD4A 4HDOB 4JVOA 5D1HA 4BC0A 4MUYA 4IIJB 4KITB 3KSZO 1T9AA 4CQLB 4QPCA 3SICE 2H5LA 2ZBRA 4LE1A 5HRUA 4PSVA 3GRUA 4UAJA 4X20B 1MAHA 1SJ9A 1MIOB 3HCDA 2P9ZA 3KT6A 3JZAA 4JA0A 3GRZA 4GWKA 1BVRA 3H9GA 1P77A 3E82A 4ZQIA 5LIRA 1LU9A 3ZPXA 1RXEA 1KNQA 1NFRA 4HWKA 4PYLA 3WHPA 4F1KA 2GH1A 2J1LA 2LWIA 5CBPA 1R64A 2C4VA 4E5YA 3VKUA 4C4XA 3ZH9B 3F73A 3WLLA 3JQ8A 1VA4A 1BE6A 4I3GA 3SXUA 2EKPA 3CZ4A 2FWIA 4B3IA 4BVHA 3KQTA 3ZHVA 2VDRB 4B2PA 4X1IA 1Z12A 3KQSA 4K87A 1VKRA 2C54A 4F45A 1P3DA 3PITA 4LGCA 3ROQA 1CUIA 3PGMA 4YJKA 1GZ4A 4ZI7A 5B3KA 5EZSA 5KNBA 3I3OA 3KUDA 3UMCA 4BUZA 4RO0A 3HJTA 3KJNA 4ISCA 1FNCA 4P86A 3C3PA 2R5WA 5IT0A 1QH1A 3O4FA 3T94A 1Y1QA 4K9RA 3B6IA 4NCAA 3DTVA 3NAMA 4HH1A 4LYAA 3FMVA 4O1HA 3UMGA 1JSCA 2XOKD 3X2FA 2DC1A 2VNJA 3Q98A 2QN9A 2CLSA 4QUEA 3T5CA 2ZYGA 1IE3A 1YZNA 2BFEA 4BNXA 5F7XA 3ZVMA 1W59A 4ALJA 1MPXA 2VHEA 1IZYA 1L7XA 2IP2A 1ESZA 3N0RA 2XX3A 5J58A 1G7SA 2OOSA 1YB4A 3K16A 4RVUA 3GMTA 3ZWPA 1G6KA 2EHJA 1O3YA 4P33A 3KJGA 4P3XA 1AHNA 5C1IA 2VF8A 1KTVA 4XRGA 2R8XA 1DJOA 5J43A 1QR6A 4MV0A 3IESA 2XD9A 1VHQA 2XVMA 2IHBA 3FUUA 3ISVA 4NJEA 1R0WA 1H0HA 3S1AB 5KYTA 4O4LB 3T52A 2XNSA 2OMKA 1SBNE 4ZOLB 3BSFA 2Q6TA 2ZIGA 2AD5A 3DMYA 5BT9A 2QLTA 3BX1A 3HRKA 3TDNA 1TK3A 1XDSA 2EBUA 2GCOB 4FXPA 4TV8B 4F2HA 2HQRA 2C31A 1VE6A 1V9LA 3QUAA 3KOUA 4JLAA 5NLLA 3EYAA 3T5BA 3EGVA 2JKYA 2WDZA 3PI6A 3PNYA 4QXRA 4DDMA 1V35A 5CPBA 1OB2A 5EVCA 5FOXA 2BE7A 4LVCA 5EJ9A 2NVOA 2WEKA 3NHJA 4B2YA 1VLJA 1R00A 5HDQA 2ILVA 2M6SA 4D3XA 4B34A 3I2GA 1QGDA 3G8BA 3GJ5A 5CDFE 4OKNA 3REOA 4AECA 1PEKE 4OKIA 5A2GA 3K4HA 1E0DA 4LIPD 4C0QC 3FPAA 1Z6ZA 2FZGA 4P53A 2XUIA 4B85A 3OU6A 5E4TA 3GJ3A 3T7DA 1CBUA 4AJJA 4KR7A 3BFKA 4E1AA 4RFSB 4CM3A 5LL6P 1T5IA 1W5AA 2PTHA 4MKZA 1U2RA 2OM6A 1IN6A 2ZIEA 2ZZKA 3N2ZB 2CJWB 3FPJA 1Z4IA 2R2AA 3ADDA 3A1CA 1NUUA 3WO0A 2X0RA 3WBBA 2F4VB 3RVJA 1JJFA 1P3JA 2CDNA 2Y99A 3ZXYA 4FFPA 3LPMA 1X9IA 2OQRA 1U90A 2PBZA 4LZNA 4WESB 2WWXA 1WXWA 8LDHA 3E1KA 3I2FA 2RK3A 2GVNA 1F20A 4PPGA 4CI9A 4KKXB 1XMQB 2RJNA 4NNJA 2YZ2A 1XIVA 1Z36A 3AF0A 5LD2C 1Y3FE 4WBXC 2WJPA 2DM6A 3B9PA 3BUSA 3FUWA 3IAM1 5B37A 4FLMA 4BNKA 4Y2PA 1SBTA 4EYGA 3N8GA 3LUKA 1JYFA 1O4WA 1KEKA 4RETA 1SCQA 3HR8A 3RHFA 2IYNA 4LHZA 4WOJA 3L7NA 1B0AA 2Z08A 3QU2A 1TRHA 1K5HA 3GIDA 4WJZA 2VSYA 4QXOA 4W1QA 1FJHA 1WPGA 1M5RA 1RI3A 2XUHA 3QPCA 1B74A 1LPNA 1Q1GA 1J39A 3KZCA 1WULS 3PNSA 4IDGA 4C9BA 2I29A 3SAJA 3RIXA 4ME6A 3CS3A 1JXOA 1Z4JA 4XEHA 1DDIA 1UWKA 4CT5A 5EA2A 3WK9A 4OK6A 3PHGA 5TQ0A 3PENA 4C7JA 2O8EB 1R6BX 4JUAA 3DXXA 1XP5A 2BHNA 4MYDA 4NR0A 1IUNA 5EQTA 5FI5A 1T0IA 4OI1A 3RUFA 2Z3VA 4A0RA 5GINE 1E0KA 3E7FA 4YJGB 1O08A 3OJ0A 1B16A 1EVKA 3D7LA 3TZ6A 2I3DA 3B6MA 3O73A 3GNQA 5F33A 1VI5A 1V5GA 3HRIA 4CTNA 2QTGA 4X7MA 4DJTA 1NIPA 3LUGA 3O5AA 3WYEA 2EG5A 2XB4A 5I7RA 2F00A 1YCDA 3LOUA 1J6UA 1NBAA 5G0VA 2NO7A 2BZGA 5DDIP 5IVDA 5TY0A 1QZ3A 3HKBA 4UTZA 1R37A 3NALA 4FU0A 1K89A 2W6IA 2WF9A 4KR6A 2OR3A 4KPUA 2X8JB 3AF3A 3OCCA 1G1MA 3GJ7A 1FFHA 2OBXA 5EPEA 1ZJ5A 3DT8A 3MLEA 4F21A 2DQYA 4C4AA 3DBRA 2HC9A 2ZBPA 4JEMA 4UARA 1BQEA 4NQRA 2QAIA 1WZNA 2DTDA 5P21A 1BHQ1 1AV7A 4MS4A 3GT7A 4UHBA 4BQIA 4EJSA 4PVDA 1QH1B 3B6ZA 4D3SA 3S40A 4UTOA 1SXJD 1GZSA 3D7KA 1T1SA 2YVLA 3L6UA