2NU9A

C123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
285
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNTPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 109
structure length 285
sequence length 286
chains with identical sequence D, F, H
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu9A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu9A01
2J5RA 1GYPA 1NPYA 3F9IA 2FPIB 3WGZA 1M6HA 1XSEA 4WE3A 2GO1A 5GY7A 2FOIA 4FOOA 3KHUA 3PYMA 4LSMA 1BWSA 2HAEA 4XWYA 2OXIA 4E32A 2Q99A 3QVTA 3ZU3A 4XKJA 5A5FA 1Y9AA 2GN6A 5IXSA 4IJWA 3B1JA 1YL7A 4IINA 5FEUA 1EDZA 3AWDA 1VLLA 3M1LA 4JP2A 3WSVA 4GAEA 2DQ4A 3VAZA 4R1SA 4ESOA 1ADBA 1U3VA 5TC4A 4J4BA 5B1YA 2C2YA 2YW9A 4KDFA 1VL8A 3ULKA 4CM8A 5JSFA 4BOYA 2CF6A 5T6BA 3RCBA 5JNLA 3VDQA 1SOVA 4JP3A 1RM0A 4NZ9A 1WPQA 4OL9A 5ES3A 4R1TA 3QHAA 2X0NA 2NU9A 5IZCC 3S1LA 5F1OA 2V6BA 4IBOA 2C07A 2NACA 4LVUA 3U4CA 4Y8VA 3AM3A 3C3XA 3IP1A 3HN7A 4Z3KA 4O1MA 4K6CA 4C4OA 3L4BA 5GMOA 4UUNA 5L7YA 3HB4X 4B3IA 3LU1A 2HQ1A 3NDIA 4D3DA 3L9XA 4WCFB 3Q11A 3ENKA 3MWDA 1BXKA 4YRAA 4WPGA 4QECA 5L51A 4IMPA 3QLJA 1PJSA 2YV3A 2G1UA 1ORRA 1KVRA 1SOWA 1KVQA 3G0OA 2DTEA 4JJGA 2P91A 4P4NA 2Q2VA 2OZPA 5HM8A 4BNNA 2JCVA 4RLHA 3Q3CA 2I6TA 4RVUA 1AXGA 1YBMA 5EQFA 1TB4A 1KY4A 4B8ZA 1NTOA 3TSCA 3UCEA 2PKQO 1UDCA 1TXGA 3H7AA 1B15A 4GQAA 3FBTA 3G17A 3WGYA 4AJ4A 4Y6SA 1P31A 3UW3A 1GU7A 1CF2O 4CR8A 4BKPA 2I67A 3M1AA 5KKAA 1T26A 1NWHA 2NADA 4I5GA 4I9NA 4CLXA 4MO2A 1O95A 4UVGA 3OSUA 2W98A 6ADHA 2XOXA 1HE5A 4DBZA 4TRRA 5CAEA 4XGKA 5G0WA 1JVSA 2EKPA 3FF4A 3OMLA 5C7IO 4MVJM 1KBZA 5IN5A 4HP8A 4OXKA 5DCUA 5EPOA 2P2SA 3GVCA 3WG9A 5DNAA 1X14A 2Y66A 1CQIB 1EE9A 3C7AA 2F00A 1MC5A 2VHWA 3IKTA 4IIVA 2VYND 3WLFA 4FD3A 1R4NB 3PWSA 1JQBA 4YAEA 1LUAA 3ZU5A 1DIBA 4PLFA 5AXBA 4DREA 1EBUA 3C24A 3PHJA 4KUEA 3V1UA 3GUCA 4YWJA 1JWBB 1TT5A 1X7HA 4BNLA 1EK5A 1AHIA 3FPCA 3DB2A 1DIAA 5KTKA 1HZJA 3ROPA 4II3A 4MVJA 4WOJA 3FD8A 1E3LA 1PJ2A 2EGHA 5DCYA 4E0BA 2EXXA 2V6GA 3IQDB 5TQVA 1B8PA 3LSYA 3E03A 1E7QA 3NJ8A 4I1IA 3PJGA 5CFZA 1GR0A 3D1LA 4X54A 1ZMOA 5JFOA 1HZZA 4NBTA 5GZ3A 2O3TA 3WTBA 3LT4A 4JROA 4MVJE 3IMFA 3WWYA 1A71A 3TOZA 3ENNA 2AQKA 3VPSA 3DHYA 2VHZA 5MGBA 2HSDA 1E6WA 2CUKA 1T1RA 1NQTA 1KEWA 1ZXBA 2AXQA 4NNJA 1H2BA 4EYEA 1UXHA 5A1TA 3GAFA 4NBUA 4WLFA 1PS8A 3T7EA 4CR6A 2HMVA 4YEDA 4CMGA 3JD1A 5JMPA 4WLEA 1XEAA 1ADCA 2JCYA 4EW6A 2NVUA 3PEFA 3QVOA 4G2NA 1OFGA 4PLVA 4XQCA 1I2CA 1UAGA 2Q2QA 3H2SA 3JQ8B 4GX1A 4S1VA 3RU7A 3DBVO 1U8XX 4FDAA 4IIUA 4CMKA 4DQVA 1XDWA 2O2SA 2C20A 4P22A 1UUFA 1VC2A 4KTVE 3C8MA 3GHHA 2IZ0A 1T4DA 1IY8A 3GK3A 3GOHA 1XCBA 2XXBA 1O5IA 2WE8A 3DC2A 1OBFO 3KRTA 2PFGA 4D7AA 4F46A 5F21A 4BMSA 2ZCVA 2O2YA 3CTMA 4J0EA 1F17A 3V1TC 1VKOA 5CPFA 3MTJA 1IPFA 2LDBA 4JN6B 1L1FA 5IZ4A 1A9ZA 1M66A 4KOAA 1L7DA 1XIVA 1VL0A 4AJIA 1HDZA 1EUCB 3TZCA 4MDHA 1Q0HA 2W4QA 2C0CA 3F1KA 3FPLA 1U5CA 3V8BA 2H6EA 4OKNA 3H9UA 1Z45A 5KJFA 4H15A 4AJHA 1YVEI 2Q46A 3GGGA 5FWNA 1LNQA 4XRGA 4IDEA 4PLPA 1KY5A 3RSHA 4JK3A 4UUPA 5ILGA 3EYWA 1MX3A 3ZH2A 2POQX 3ZNOA 4HX5A 1SEVA 1NBOA 4U0KA 2J5KA 4LN1A 2Y0DA 4MPDA 5EJ2A 4K9DA 4DL9A 3Q2IA 4TQGA 3A1NA 2X22A 3PFWO 1KVUA 3HE3A 1U3TA 4BV8A 1H0KA 1WZIA 3RUIA 2B4RO 5F5LA 4RJTA 5KWEA 3FRJA 1BVRA 3WMXA 1P3DA 2D5CA 3W8DA 1MB4A 3ICPA 3DZBA 3K96A 3C1AA 3OM9A 4J2HA 4BNZA 3LF2A 4M87A 3VTZA 1PWXA 4YJGA 2DC1A 1DRVA 4U6SA 1D1SA 3HG7A 4J6FA 4CMIA 1E7SA 1UR5A 4JLWA 3K2EA 2WE7A 3ITKA 4YRBA 2NU7B 9LDTA 1LU9A 1WMBA 1C1DB 1UZNA 3K2BA 3WFIA 4BGUA 2GCGA 3ABIA 4WECA 4FBGA 1BTOA 1BGVA 4Q3EA 4B79A 4XQ9A 7ADHA 1ISMA 5BR7A 2IYPA 4BO9A 4FJ0A 1HT0A 3ETGA 4CLRB 5JAIA 2ZIZA 1PL8A 2EW2A 2GZ3A 5DF1A 3GZNB 4QSMA 4TVOA 4HUJA 2VZ8A 4NG5A 2HUNA 3KB6A 3LYLA 2OHXA 1ZSYA 4CR7A 3AU8A 5KNLA 4BO4A 4UVDA 3EAGA 2Q1UA 2B36A 3GEGA 3KYDB 4E2XA 2ZYAA 3HZZA 4ZVVA 3PQFA 1ZK2A 4MVJD 4DUPA 3AUAA 3LDHA 1UP6A 3RD5A 1EUCA 4MVJF 1DFGA 2FSSA 3CUKA 4I9HA 3I9MA 3MEQA 3WNQA 1ZEJA 2VUTA 5EL0A 4PLZA 3I9KA 5TGDA 2FN7A 3E48A 1QKIA 4E3ZA 2X5KO 4M89A 1TLTA 1XELA 3KYCA 4MP8A 3WGGA 5JAQA 5A05A 2JD1A 4FR5A 3GNTA 1QP8A 4I8XA 5G2OA 5FF9A 4LCJA 4R5HA 3RFTA 1C0KA 4R4JA 1P1HA 2YQ4A 5T64A 5KJ6A 2LDXA 3IIEA 4ONEA 5F5NA 3IAHA 4ZA2A 1B26A 2CF5A 4OQYA 3S8MA 1PR9A 1NAHA 2AG5A 3ZV5A 3OICA 4XJSA 2NTNA 3AOEC 4BNGA 1E1KA 3ICCA 3M6IA 3RUFA 4B3HA 3E9MA 4LMPA 4PLTA 4P4LA 3H9EO 4NFSA 1RYEA 3QVXA 1PSDA 2ZB8A 1U8FO 3ANNA 5CP8A 3GPDG 2FPGA 4ZD6A 4XR4A 3JQBC 3KYBA 2GNAA 3OIDA 4JBGA 1MP0A 4B7UA 4NI5A 2ZB4A 3I6IA 1GAEO 1QV7A 1JU9A 1SZJG 5A03A 3BHMA 5HA5A 1HETA 3QSGA 3PQDA 4B4VA 3RJ5A 5EERA 3E82A 3I52A 3JCZA 2JD0A 4IXTA 4YT5A 2AHRA 2DU8A 2QRLA 1EFKA 2B5WA 3KYDA 3ZWAA 4YAGA 3BMOA 2HMUA 1HDXA 3QA9A 4ROSA 3D5TA 3GN2A 5I9NA 3BMOB 1E7YA 3UFXB 3HDYA 2NNLD 1XYGA 4IGFA 1B8UA 3NDRA 1GCUA 3ASUA 2GSDA 2TMGA 4Z0HO 2OBYA 1KOLA 1YOVB 3JQAA 2O50A 4FSHA 2O7SA 5JS6A 3KZVA 2UAGA 3GMDA 4EUEA 4ALLA 1VSVA 5ENVA 1N9GA 1LDYA 2AQHA 3WQQA 3H9QA 3PVZA 4PG4A 4A10A 2VZ0A 3BMNB 3W4IA 5IG2A 3BA1A 4QFDA 4DYDA 2I65A 2PY6A 4GBJA 4BO0A 4LSWA 1W6UA 3KO8A 4XGNA 2PZJA 3UAGA 3NUGA 5DOVA 2WEKA 4YJHB 5JO9A 4F6CA 3QP9A 1NX6A 2BMAA 5AQ1A 3EUWA 2VRBA 2Y0CA 3SJ7A 5G4KB 2JFHA 1DB3A 4AJPA 1DFIA 4FQ8A 5A9TA 1U4OA 1FMCA 4DC0A 4RCVA 1DC3A 3AK4A 4WCFC 8ADHA 3RUAA 3E9NA 3GVXA 1BRMA 4B8WA 1ISGA 1A7AA 1N1GA 4Y67A 2YFHA 2VUSA 4YBZA 3G1UA 2OP1A 1HDYA 3IJRA 3QWFA 4JBHA 3CSDA 3LLVA 3JYNA 1I3LA 3QV1A 5U9CA 4DLBA 4JCOA 1XU7A 2BFOA 1CQJA 5CDGA 1YXMA 1ML3A 5KVCA 3VPGA 3ZGYA 1B3BA 1AGNA 2VWGA 4PVDA 5AYVA 4KQWA 5BSHA 5COAA 1K2WA 4NU6A 1B3RA 3MJ4A 1NHGA 5CG2A 3KM0A 4BO2A 2GD1O 3GAZA 4QO8A 4DLLA 1EE2A 2YDYA 1UXGA 3VH2A 2YV1A 5AXCA 1VJ1A 2HKIA 3OA2A 4IDDA 5COBA 3DTYA 4GSLA 4E6PA 3U3XA 4BB6A 3FN4A 3K92A 3DZGA 4ZGWA 3KEQA 1ENYA 1B2LA 3OF2A 3KLPX 1YQDA 4XDYA 3I83A 2FZEA 3JQGA 3DZKA 2VWQA 2Y93A 2ZQYA 5A5EA 3UCFA 4OOFA 2G82A 2AW5A 1N2SA 4CMEA 3NGLA 1P1FA 5TX7A 3ST7A 2Y67A 1PGJA 3FR8A 3UCXA 2Q1TA 1O9BA 1ISHA 3JQFA 1QV6A 2VHVA 4CM3A 4ZJUA 1X13A 3SVTA 4YYZA 1JLLB 2IODA 3CEAA 3L6OO 3V2GA 3N74A 3QVSA 4BNMA 2D2IA 3AU9A 4MP6A 3WIDA 4YDRA 3O8QB 4NMHA 4J90A 2PGJA 2VWHA 3HHPA 4CMIB 1LA2A 2D5AA 2UVDA 1N7HA 3A06A 5KVVA 3PJDA 3QJ5A 4J9UE 3LT0A 2GN8A 4Q3AA 3RUDA 3TL3A 3D4PA 3VVCA 3PYXA 4XX0B 3GY0A 5T8KA 4YR9A 5C7OO 4RL6A 5IXYA 4BQPA 4K1LA 3ZW9A 4FN4A 1Y8QB 2NWQA 1HLPA 4G81A 3SEFA 2HK7A 4AFNA 1GFSA 2Q49A 4ZQEA 1B7GO 1K6XA 1ZIDA 2J6IA 1NFQA 1MGOA 2Z95A 3F1LA 3NJ4A 4PGFA 4W7HA 4E12A 4EEXA 3JYOA 2C59A 1GYRA 2V6FA 3WIEA 2GR9A 1IHYA 2CY0A 2Y05A 2GERA 3BXXA 1M2WA 2BHLA 4EJ0A 2CDBA 2PZLA 4B7XA 5CDUA 5COQA 3ZWPA 3LQFA 2O23A 4O0LA 4OAQA 1NFFA 4BKUA 4LK3A 1QG6A 3AFNA 3ZNQA 4OSPA 5JAZA 2WYUA 5FI5A 4D44A 2HDHA 4UULA 1M6WA 1DIGA 3OJEA 3I1JA 2IEDA 5H81A 2Y1EA 5KJCA 2HMSA 1XWFA 3ON5A 1EBFA 3JQAD 2E6UX 1NXQA 5BNFA 1B16A 2NU6B 4AJNA 5AOVA 1HL3A 1NVTA 4NK5A 2FMUA 1IHXA 2FSVA 3BTUA 1Z7EA 4UEKA 5ER9A 1NPTO 3K5PA 4MIOA 3PYLA 4FJ1A 3ZU2A 2UUOA 4D0SA 5L7WA 4QEDA 4P8RA 1PX0A 4BKRA 4PZDA 3KTDA 5AXAA 1F06A 1I3NA 4OGWA 1K5HA 4R54A 2YZ7A 5ICSA 3WFJA 3IJPA 5JCJD 5BNTA 2BFPA 1WWKA 4FGWA 2BGKA 1H5QA 1IB6A 3FTNA 3DZHA 3GVIA 4UVHA 4CMBA 1CWUA 4YPOA 1F12A 1EMDA 3HFGA 5A9RA 1J6UA 2EG9A 1ADFA 5A02A 5EESA 1M75A 2JFFA 3ORFA 3ETEA 1PQUA 2GGSA 3VZPA 4CQLA 3OETA 5I7EA 4GX5A 3C1OA 2QW8A 4BNYA 2PD6A 4CMEC 3EMKA 2GN4A 1UZLA 3JD0A 4ND5A 2ZK7A 2RBEA 2NUAB 1VJ0A 3DEYX 1ZK4A 2GZ1A 4ZRMA 3ONDA 3AUSA 3MJSA 3TN7A 1PL6A 2RHCA 5JDIC 2GYYA 3UXYA 3WQSB 3D7LA 2HMWA 1E77A 4CJXA 1ZK3A 3BAZA 2Y99A 4IS2A 1WAMA 4BO1A 3DQPA 3HJAA 1LRLA 4Y98A 3QWHA 4CLEA 1TVEA 4D42A 1RM3A 3BIOA 1O6ZA 3I4FA 3A4VA 2P4QA 1IL0A 4L8VA 3RUHA 4FJ2A 4UUMA 1QLJA 4BMVA 4BGEA 3MJTA 4ZU3A 1BVUA 1YS4A 5IDYA 3GLQA 2DBQA 4G5HA 2PK3A 1Z73A 4FB5A 1MG0A 4ALKA 2W2LA 3K6JA 5EIOA 4R16A 4YACA 1MFZA 1T24A 1QR6A 5BSEA 3RWBA 2FR8A 4U5QA 3L07A 2O4CA 5ENDA 4AICA 2EP5A 4XYGA 3W4KA 4R9SA 1TEHA 4KDEA 2JAHA 4N54A 1R4NA 1GZ3A 2DTXA 2DBVO 3BTSA 3STHA 2C54A 1E7MA 1JDJA 2HJSA 1X7GA 5EINA 1IULA 1FF9A 2NVBA 1FJHA 1NQAO 4ND2A 1SO8A 2DTDA 2QQ5A 3VC7A 3DMYA 1PL7A 4JX8A 3WMWA 4DMMA 4J1NA 2EJVA 1ZEMA 3NAQA 1JW9B 1ZUD1 1K89A 4NU5A 1ZO8A 3PIDA 4AJ1A 1U4SA 4FGSA 1GQQA 1KEPA 3JYPA 1E92A 3PP8A 4BL5A 4BNKA 4XX0A 1I01A 3RC1A 2ZCUA 4J4HA 4CV2A 4MINA 3T4XA 2NV6A 2OUIA 3LVFO 1E3JA 1ZSNA 3K31A 4HNGA 2UUPA 3D3WB 3DBHA 3DO5A 4TMFA 3E1KA 3EZYA 3UN1A 3X2EA 3N58A 4I5EA 4YA6A 2IXBA 3W1VA 2FHSA 2E82A 1R15A 5TSDA 3AY7A 3LLSA 3GPIA 1CETA 4DBVO 3ONFA 3PHHA 3HWRA 4K26A 3S2EA 4C7KA 5JDIA 5L9AA 5IZCA 4NK4A 1A4UA 1R66A 4MVJH 4YT4A 3F6YA 3ZWVA 3WTCA 5EN4A 3TZQA 5K0ZA 3SBOA 3GH3A 1N5DA 2Q1WA 3TWOA 1BMDA 4YXFA 5H83A 3RKRA 2CMDA 1V8BA 3P2YA 3ZWXA 3O03A 1CERA 1LLCA 1I24A 3EY4A 1NYTA 1DSSG 8LDHA 3UFXA 2JCXA 2QZ9A 3H5NA 1EQ2A 1BDMA 2A4KA 5TJHA 1C0PA 3WQRA 4L4XA 4MOWA 1UDAA 3RU9A 2DAPA 3TL2A 1PJ4A 3OQ6A 4R1NA 3GR6A 1CQJB 2VQ3A 2IE0A 4R41A 2UYYA 1T25A 3AW9A 4PG8A 1NWCA 3RVDA 1E0DA 5JCJA 4XB2A 1C0LA 3FR7A 4ALIA 3DAFA 1XKQA 3AOEA 4KWIA 1FDTA 3PHIA 2J3JA 2EKLA 1KIFA 2GPTA 1E5QA 4EJMA 3GRKA 3DBLA 1J5PA 4XCVA 1DO8A 1T2DA 3CMMA 3RBVA 4PZCA 2H63A 3FI9A 3PWZA 3U9LA 4BNIA 4RQTA 1W73A 2DUUA 3VH4A 1NFRA 4YAIA 4W6ZA 2ZTMA 1BG6A 5TT1A 3AFMA 3H3JA 1Y5RA 4LCEA 4FFRA 1PZEA 3PPIA 4RVDA 1W4ZA 1CRWG 4GKBA 1GUYA 1PGOA 1BSVA 2WDZA 4M8SA 5L4NA 2CVOA 2WWRA 4HFNA 3WGOA 4CM4B 2YHIB 1PGNA 4JIGA 3H5RA 3RC9A 1WDLA 2O3JA 1W8DA 1ONPA 1QSGA 3CMCO 4RPHA 3GG9A 1EUDA 1LC3A 4IS3A 4BV9A 3MJCA 2DM6A 2Q2WA 3OA0A 1JTVA 4TZKA 3ADPA 4PG7A 1KYQA 2GRAA 2YUTA 2XXJA 1ZJZA 1H94A 1ARZA 1I36A 4YQYA 4CM4A 3AI3A 3BMNA 3MJEA 3VH1A 3TRIA 4ND3A 1GD1O 4DYVA 4Y6RA 5G0TA 3GN1A 1F0YA 4DIFA 4GKVA 1U2GA 1V3UA 4RPGA 4R3NA 3OQBA 3PLRA 1ONNA 1Q0LA 4ZQBA 4WK6A 4IXWA 4E5NA 1IOLA 4RVSA 1HXHA 4RPJA 2AA3A 4DC1A 4BGIA 2W2LD 3EDMA 4DWVA 3DFZA 4IDGA 3EC7A 3W8EA 3VZQA 4HADA 5L45A 3MWEB 1JKFA 3RFVA 1NHWA 3LZ6A 1SNYA 2AQ8A 3WJ7A 2HO5A 1E7RA 4H7PA 3WGTA 1ZBQA 2BFAA 1PJCA 3F47A 3OHSX 2D59A 4ND1A 4W99A 4M86A 1U7TA 1MXFA 2AEMA 2BKAA 1CIVA 4J16A 4E2WA 4D3FA 4CQMD 2X0RA 1MUUA 2PA3A 3HADA 2X4GA 2EV9A 2OO5A 2P68A 5G0SA 1Z7BA 4UEJA 2CDCA 1E3SA 3JQ6A 5MDHA 3INRA 4R51A 4FW8A 5JY1A 4BMNA 2ZTLA 3IL2A 4YJFB 3OJ0A 2SCUA 1MG5A 5J23A 1Y8RA 4JGBA 2W90A 4R5MA 1OMOA 1WW8A 2IXAA 4N18A 4TZTA 4WJZA 1B14A 1ZZEA 3FCOA 1ZNQO 4BNVA 1LI4A 2C2XA 2V7PA 1HE3A 4L75A 3TPCA 5JXWA 3OQ1A 4DQUA 5FI3A 2ZYGA 3H5AA 2VHYA 4WASA 4BO8A 2HCTA 1BHSA 3Q1LA 4XQGA 4EJ6A 2ZYDA 5GZ6A 2OBNA 1N92A 1UXJA 4FIZA 4U6QA 4EI2A 2HMTA 2VCYA 4IDFA 5CPBA 4BO5A 5KIAA 2WSBA 4IJUA 6LDHA 4HXYA 4RLSA 2E4AA 3EVTA 3JQDA 4IJKA 1YL6A 4GI2A 4EITA 2VTEA 4R01A 3ROKA 5BSGA 3JTMA 3H9GA 3Q9NA 3QRWA 1W0CA 2JKVA 4QXMA 5DULA 1QMGA 3FHLA 5IJZA 3FNFA 1EVJA 1DJNA 3V2HA 2WYWA 2WD7B 3WWZA 3TNLA 5HS4A 1SB9A 3RIHA 4BNHA 3BTVA 5JPIA 3INGA 4YJFA 1VI2A 4YJDA 1KC3A 2PD3A 4IQ0A 1SCUA 2I3AA 1LJ8A 4TSKA 3ZNPA 3M2PA 4D0RA 1HDRA 5K6AA 3NV9A 3NRCA 4NDNE 4UEOA 3G79A 4BNFA 4W82A 5BNIA 4DLAA 3AJRA 3QW2A 1GQYA 2I76A 4CM8B 1EZ4A 1FXSA 1ZSVA 4EEZA 2ZB3A 3WYBA 4P4GA 1YDWA 3TDKA 1DRUA 4CQLB 5JW6A 3EZLA 4PIVA 1DC5A 2AE2A 4NHEA 4RV9A 3S2IA 4NH4A 1LDGA 1A7KA 2WTBA 4KTTE 2PV7A 1DPGA 1R16A 1H6AA 3PWKA 3RASA 1I32A 3GA0A 4BUCA 2DLDA 3WB9A 1BW9B 4XZ3A 4FCCA 1HRDA 1Y8RB 2NUAA 1N9GB 1H2HA 5TF4A 1DAOA 1YWGO 4D43A 4RPLA 4KQXA 1NNUA 4UREA 1PJLA 1Q0QA 2R2GA 3MWDB 4KP7A 3WOHA 4AJEA 1DC6A 3RJ9A 4YTEA 4A03A 3NYWA 5A4DA 1HE2A 4IPTA 4TRJA 1PIWA 3PFFA 2YHUA 3VTFA 1GADO 1SAYA 2X0IA 2ZTVA 3ZDFA 3ASVA 1XGKA 3GFGA 3R3JA 4KZPA 3GG2A 1VJTA 2D8AA 4IQGA 4Q3DA 4RF4A 3VKUA 2XPCA 1M67A 3EW7A 3O9ZA 5JC1A 4XYEA 3SX2A 1JVBA 2Y1GA 3AI1A 3HN2A 4CV3A 1HEUA 5B4TA 4TKLA 4RPKA 1C3VA 1PZFA 1PQPA 5C37A 1O89A 4U7WA 2QYSA 3GF4A 1E3IA 3AUTA 4WEOA 3C7DB 1HWYA 4QT0A 3G49A 3SLKA 2O3SA 2I66A 4K28A 5CEEA 4NQZA 5HS6A 1JKJA 4DMLA 3GGOA 5FYDA 4MVJP 2NQTA 2NLOA 3DXFA 4KWHA 3F5SA 2Y1OA 1FK8A 2P9EA 5F3RA 4CLOA 2YDXA 3UH1A 1MLDA 1LQUA 1X15A 2H9IA 4TRMA 5A9SA 1I0ZA 2BH9A 4CLOB 3TFOA 4R3WA 3IUPA 3IP3A 3VHRA 4EGFA 4H16A 3S2FA 1R37A 1YE3A 1PS9A 4GX2A 5H82A 2D0IA 1OZAA 4O59O 1CDOA 1EVIA 3LF1A 3TOXA 4Z0TA 4PZEA 3ZV3A 2FPPA 2C5EA 4CQMA 1EVYA 3D5QA 1KS9A 4XYLA 3H2ZA 2O4UX 2HK8A 4RF2A 3ZN2A 3HDHA 1QXSA 4H3VA 1GV1A 1JA9A 1GZ4A 4F6LA 3R1IA 1U7HA 5L40A 1DBVO 1P1KA 2BFMA 4BO6A 2NM0A 3I9LA 4E33A 4CLRA 1LDBA 2FPPB 4CQMB 5CDSA 3AI2A 2WJPA 3B70A 1YL5A 3JQBA 3HB5X 3GT0A 2ZTUA 1WVGA 4QTZA 4TKMA 3F4BA 5B37A 1T2CA 4OM8A 2CDAA 4AJJA 4B4UA 2JHFA 5BQFA 5KCZA 2QX7A 3NEPX 4Z3DA 2J3IA 4E2YA 1PZHA 4TROA 3NDJA 1P9LA 1YDEA 1C1DA 3L6EA 4DIOA 3PK0A 1G6KA 3CKYA 1FDUA 1DRWA 3KVOA 1RPNA 4L76A 4IUYA 2O3UA 4A0SA 1UZMA 4OO3A 4QX6A 2GF2A 2CVZA 3GVHA 4IQ8A 4ZQFA 4Z9FA 2P5UA 3OJLA 2FR1A 4EBFA 4J9VA 1DEHA 2Q3EA 2D4AA 3OBBA 1N1EA 1FDWA 3U09A 3KYCB 3CIFA 4INAA 1Z75A 4CM5A 4D3SA 2ZKLA 4ND4A 4Z6KA 3NKLA 1K3TA 2H5LA 5CHEA 5L53A 3SC4A 3ROMA 4DPKA 1VPDA 1B0AA 2X5JO 3PJFA 3IC5A 2ZQZA 3QQPA 5HTOA 1GY8A 1X0XA 4YRDA 1SB8A 2R00C 2W8ZA 4PRLA 1J0XO 1M76A 1WZEA 4IY1A 3PRJA 2Y1DA 4URFA 3JQ9C 3N7UA 3MTGA 3KETA 3RAJA 4Y6PA 1GCOA 1LSOA 2P4HX 4XRRA 5A3VA 3ETDA 3VDRA 3GNQA 1A72A 3GDOA 1LDMA 3RQSA 4CMAA 3DZIA 4CM7A 3PZRA 3KSDO 4HFJA 5KOIA 3GRPA 3WJAA 3F46A 3R6DA 4NJMB 4OIMA 1E1NA 1PWZA 4YJGB 4LVCA 4CM9A 1O8CA 3I4CA 4J91A 4AJKA 1RM5A 4IDBA 3JQGB 2G0TA 4GX0A 1HYHA 4ZHSA 4A7PA 3ITDA 3WNVA 4M55A 3D64A 3GHYA 2WMDA 1TI7A 1XA0A 4I08A 1VL6A 3FWNA 2OORA 3L4BC 4ITUA 1XR3A 4DVJA 3U4HA 4MKXA 4YT8A 1DIHA 1BW9A 1SBYA 1X1EA 1LTHR 4JQCA 1IZ0A 2NVWA 3K8ZA 4U0JA 4EUFA 5U4QA 3VPHA 1LC0A 2A35A 4IMRA 2VUUA 1N8KA 3FSRA 1NAIA 1JLLA 3VH3A 4W9NA 2W2KA 2TMDA 3JQ7A 4DTIA 3P19A 3UVEA 4N7RA 2XAAA 3KLMX 2W2KB 2CVQA 1QYWA 3D3EA 3DHEA 1NVGA 4OJNA 3DBRA 3ZHXA 1F8GA 3COSA 2C7GA 3PLNA 2CNBA 2JHGA 1R4MB 4KUGA 3A28A 4XYBA 4ALNA 3PDUA 1KVSA 2P5YA 4HV4A 1WDKA 4GH5A 1R4MA 4YT2A 1E5LA 1Y8QA 1D7OA 5B12A 4DIBA 1ZKMA 4O6VA 2FR0A 2YYYA 3QVWA 2G76A 3F4LA 1ENZA 3H65A 1DIRA 1U3WA 2O7QA 1H9AA 2NTJA 2EWMA 2YY7A 4DQXA 1P33A 4A5OA 5DOZA 2EERA 2E37A 1PJQA 2EP7A 1YB5A 3ROQA 3ZV4A 4R69A 1R0LA 4BVAA 1XHLA 1IYZA 2BELA 4O5OA 4GMGA 1T2EA 4TRNA 5TJ9A 1EK6A 3DOOA 3EGOA 2VRCA 4CV0A 3TZHA 2FP4A 3OH8A 3H8VA 3GEDA 3OP4A 2Y0EA 2JFGA 4W4TA 1GUZA 1NR1A 1R6DA 3INTA 1PZGA 2VTDA 3MZ0A 3CINA 5THKA 2BF7A 3AM5A 2YFQA 1N7GA 3WGQA 4DA9A 1V9LA 3L77A 3NT2A 1GEGA 4DPMA 5G0UA 4DXHA 4CODB 4M54A 4N5NA 3PI7A 3UUWA 5DCWA 5A04A 2I99A 4E4YA 4GLLA 4PLHA 4WNIA 3RUEA 4BNTA 1CEQA 2AMFA 4D46A 5ADHA 1I10A 2VOJA 2NU8B 3A9WA 1T4BA 1PJ3A 2A92A 4YQZA 3U4DA 5I8ZA 4J2OA 1R0SA 1WP4A 4NPCA 3RBXA 1NQOA 3D0OA 1E1LA 5L95A 1MV8A 3GUYA 4YJHA 3SC6A 2BGMA 2Y68A 4LW8A 3I23A 5JLAA 3RFXA 4XD2A 5A9SB 4BS9A 5L4LA 3WS7A 1WNTA 1JN0A 5HBRA 4BKOA 2B4QA 4HNHA 4OOEA 5DBFA 3CPSA 3E5MA 1XLTA 4W9NC 2J3KA 1MXHA 3ADOA 3PTZA 4RO0A 1GEEA 7MDHA 1H6BA 5U1PA 3L0DA 5GZ1A 2YJZA 1HLDA 1QYDA 5JBIA 1U2DA 4BB5A 4Q3NA 1ULSA 1FDVA 2EEZA 3JQ8A 1HSZA 2H1SA 3JV7A 3NTRA 3I9OA 4ZQGA 4XIYA 5BT9A 4CMJA 3WICA 1E6UA 1Y5MA 3WX0A 5LDHA 2Y1CA 4QFCA 2JL1A 3NTOA 4A2CA 2CSUA 3ZHYA 3BYZA 1ID1A 3QIVA 3SXPA 1U5AA 4MKRA 4C7JA 4CUJA 4D41A 1T1SA 3T4EA 2DBRA 4AJOA 4ID9A 5T5QA 2O3RA 1FDSA 3P7MA 3DOCA 3FTPA 4RORA 4YVFA 5TT0A 1YBAA 2B69A 2DT5A 4J7XA 4II2A 4L73A 3RC7A 2B5VA 3V1YA 2X8LA 1T2AA 3DR3A 1YO6A 1GV0A 5I9LA 2FZWA 5G4LA 1EUZA 3DTTA 1DFHA 4HFMA 4GVXA 1WMAA 3BMQB 4CUZA 2NU6A 3I3OA 4RDHA 2SCUB 4M49A 1G1AA 1Q1NA 3D4NA 1ONOA 1K6IA 2DPGA 4FOSA 3AY3A 2X6TA 3AM4A 3ZWCA 3U62A 4CM9D 1HDCA 3S55A 4WLVA 3DAGA 5TNXA 3D3WA 1YOVA 3JQAB 1J4AA 2JAPA 4PLYA 2HRZA 3L4SO 2OP0A 2B37A 2Q4EA 5FFFA 3RUCA 5I7VA 4YAJA 4CUKA 1LSSA 2Q4BA 2P9CA 3WBFA 3UGKA 2GN9A 1GDHA 2NQ8A 2WD7A 2FWMX 3JD4A 4IM7A 5HWSA 2PZKA 2X23A 2ZATA 3M2TA 4LISA 5EQDA 2XF8A 5CEJA 3UHAA 4J7CA 3ZZNA 3ZU4A 2OOSA 2I3GA 5DZSA 1G0NA 4QUKA 3IDSA 3JYQA 4ZN6A 1E7WA 1Y6JA 2IZZA 3ANLA 2V65A 1NASA 3RI3A 1I2BA 2EIHA 2J5QA 2X86A 2NTVA 3NX4A 3E5RA 4ZQHA 5KJEA 4RVGA 4JJIA 1AHHA 3FNEA 5ILOA 1QYVA 2AG8A 1C14A 3JQ9A 4AG3A 4L9RA 5T57A 2CZCA 4FPXA 4WGGA 5L3ZA 1YB1A 2OGUA 2PGDA 1U3UA 2DUWA 1A5ZA 1GTMA 1P1IA 2WYVA 1RKXA 4E5MA 5TLSA 4IJVA 3H9JA 4FFMA 5CG1A 1NQ5A 5I9MA 1Q7CA 1I3KA 3PHLA 4FS3A 2PR2A 4UUOA 3KUXA 3VOSA 4NFYA 3ZWOA 2VRCD 1UDBA 2X0JA 2B83A 1ZVMA 4BGVA 1BXGA 4PG6A 3PHGA 1KETA 3JQEA 1DAPA 1HYEA 1WLYA 3GEMA 3O4RA 4GVLA 4I5DA 3TFQA 2EW8A 2I5PO 2JD2A 5I7FA 1HTBA 4BNJA 4WKGA 4J4TA 1P74A 2NU9B 4OYRA 3H4VA 2X9NA 2BGLA 1S6YA 4IGEA 4LGVA 4CL8A 1PJTA 1C1XB 5K9ZA 1LX6A 4G65A 3KBOA 5TRTA 2PH3A 1SCUB 1P44A 4L74A 2RH4A 3NGXA 4MVJG 4XB1A 5F1KA 2VHXA 1UXIA 3UF0A 1YJ8A 4Y9DA 1ZW1A 4IZIA 1UJMA 4J0FA 2BI7A 3H6KA 4DPLA 1ISFA 1PU2A 4RVHA 1DLIA 4OXYA 1C1XA 3T7CA 1AUPA 3X2FA 2QHXA 4AVYA 3V2UA 2X9GA 3JSAA 2HK9A 1LRJA 2ZB7A 5LDGA 1QRRA 4PG5A 3GVPA 5IDWA 3B20A 3A14A 5A3JA 5TS3A 2VYVD 5KKCA 3LT2A 4CMHA 1CJCA 1V3TA 5IAAA 5THQA 3HDQA 4NR0A 3ZWNA 1G0OA 3DZJA 1EDOA 1S7CA 2EKQA 3QWAA 1UP7A 2FPGB 1MFPA 1EUDB 4LMRA 1NM5A 3VPFA 3EHEA 1K0UA 1A4IA 1PGQA 3LC2O 3QWBA 4RF5A 3U49A 4E5PA 4OMUA 5ITVA 5L7TA 3U0BA 2FY8A 1DOHA 2X9VA 4E5KA 1EEHA 1U9JA 1LEHA 1I8TA 2PNFA 5TIIA 3KEOA 4NJMA 2QYTA 5AVOA 4BO7A 3L9WA 2BD0A 1RWBA 4J43A 3TJRA 2C7VA 1GL3A 3AY6A 1Z6ZA 2RAFA 3PGXA 1C0IA 4XJTA 2RHRA 1T2FA 1SPXA 1V35A 1IZ9A 1OOEA 1NP3A 2ILTA 3IS3A 4XA8A 4CLHA 4M1QA 3I6QA 1OI7A 1NVMB 1Q2XA 2UDPA 2D1YA 1Y1PA 4NBVA 3VZSA 3VZRA 2EF1A 3DWFA 2DVMA 3ZHBA 1O94A 2HRBA 4NBRA 4CM6A 1AXEA 2AQIA 4S3MA 1LLDA 4CL3A 4J1TA 3IOYA 3OEWA 4WEQA 4O63O 1ZJYA 1ENPA 2PLAA 4DGSA 3JQ7B 3MWEA 1E1MA 2Q1SA 2F1KA 4E5YA 5K6AC 1PGPA 1NPDA 3DHNA 3UICA 1Q7BA 3PGJA 3WYCA 4I9UA 4CM1A 1QYCA 2AEJA 5CAEB 4GGPA 3KV3O 5B4UA 2C82A 4TWRA 4MKZA 4FC6A 3BZUA 3RROA 3NT5A 4RZIA 4FC7A 3E6AA 1SC6A 4BO3A 1XQ1A 2PGLA 3CXRA 2IDZA 4XDZA 1TA4A 2O3QA 2X7HA 1YH3A 1NR7A 2A9FA 1DHRA 2GLXA 3BHIA 1D1TA 2WM3A 2PKQP 1YRLA 4HBGA 3AOGA 4BNXA 4N5LA 2HLPA 2RCYA 3BTOA 3NTQA 4WLNA 5HRUA 4P38A 2QRKA 3RKUA 3HSKA 1VE9A 2EHDA 2DBZA 2PD4A 4XIJA 3W4JA 4LRSB 5JDCC 4HFRA 5JY6A 1JKJB 2YV2A 2QG4A 4Q3BA 1E3WA 2P9GA 4ZICA 4OQZA 1HYGA 5JO0A 2AE1A 2QRJA 1HSOA 3H3FA 3MOIA 1R0KA 5KVQA 3DOJA 4RZHA 4QQRA 1YJQA 3JD2A 2NVUB 3RBZA 1UAYA 1D8AA 3GQVA 2PH5A 1DHTA 4OH1A 4XR9A 3ZCXA 4PFJA 4K6FA 4WCDA 4CLDA 4WCFA 1ZH8A 2JJYA 4PVCA 3WGHA 4AL4A 3GZ4A 3Q9UA 1ADGA 3WSWA 3UOGA 2PTGA 5IFLA 5EMHA 3P5SA 3F5QA 5JMWA 1V3VA 5IN4A 5F1PA 4MIEA 2IEBA 4BKQA 4L4SA 2D3TA 1LDNA 4FFNA 3VPXA 1JKIA 4GLOA 4AJLA 1DXYA 4PLCA 3MOGA 5JC8A 3BHJA 4KMSA 3K9QO 2B0JA 2Z1NA 5IDQA 2CFCA 1GQ2A 4E13A 3GFBA 3U4IA 3R0IA 4N5MA 4DRYA 3HUDA 1YBVA 1E6EA 1D4FA 3R3SA 2G17A 3GGPA 4OKIA 1OAAA 4BHTA 1E3WB 4L4RA 2BRUA 1HDGO 3P2OA 4IDCA 2C29D 4Q9NA 3LC7O 1PR3A 4GPD1 1GUFA 3ONEA 4ALMA 1UXKA 4UAGA 1B8VA 3QY9A 1IE3A 3EVNA 2X5OA 3I5MA 3WBBA 3DZFA 1QLHA 4ALJA 4B7CA 2R00A 3DBRB 3I9NA 1BXZA 4MVJI 3I9JA 3OJOA 3U5TA 1XU9A 5I8WA 2UV8A 3O8QA 2GUGA 3LC1O 3GDFA 4E2ZA 4R1UA 4A26A 1CQIA 1PTJA 3KOUA 3WXBA 4MIYA 2EGGA 2IRWA 3CH6A 3ZW8A 5C5IA 2Z1MA 5IDXA 5ITWA 2VYVA 5IF3A 3ZHZA 4IZHA 3JYLA 1I5RA 3B1FA 1PS0A 3G3EA 5T67A 1KVTA 4NBWA 4OHUA 4Z9YA 1F8FA 3JQFC 5LC1A 4ILKA 4NJOA 2DKNA 1RYDA 1ZXLA 4U8GA 3DBHB 1CYDA 1WXDA 3G1TA 1VSUA 4R9RA 3ZI0A 1ENOA 1V0JA 2G5CA 1PJBA 2GZ2A 2RIRA 3OECA 3TZ6A 4PN3A 1GZ6A 1I2ZA 2HJRA 1I30A 1F14A 2J8ZA 1ZCJA 1Z82A 4GWKA 4LRTB 3DMTC 4OSOA 5JYDA 2BI8A 1HKUA 2E49A 1EQUA 2NU8A 4PLWA 4D45A 3SJUA 5CDYA 2NSDA 2Q50A 3BMQA 4J1SA 4CV1A 3FNHA 1LQTA 2B4TO 2FP4B 3O26A 4RDIA 1YONA 1BDBA 5JYEA 1PQWA 4FFOA 3NT4A 1VRWA 4GSKA 1DDOA 1P0CA 1Y9EA 3SLGA 2PWZA 3IUSA 1H6DA 1YKFA 3VKVA 3GDGA 4GMFA 3CE6A 2FPIA 3UKOA 1DLJA 2A94A 1Y81A 3DFUA 3O38A 4YB8A 4HWKA 5DP2A 5KJ1A 3F3SA 3ZWYA 1DJQA 4D79A 1GPDG 4B3JA 5C7LO 2X1HA 4XQEA 3GNSA 5DBGA 4RGBA 5G4KA 2DPHA 5DP1A 4PRKA 1XQ6A 2VN8A 2I9PA 4BNWA 1RM4A 1ZK0A 2FRDA 3BMCB 4UVIA 3RC2A 1SMKA 3WYEA 1OC2A 2HU2A 3B6ZA 4B4WA 4WNCA 4PCVA 9LDBA 1HE4A 1R12A 3DMTA 1IUKA 4NFHA 4JBIA 3EK2A 1P1JA 1O0SA 4ZRNA 3ZWMA 3OJFA 5BSFA 1PEDA 2YHIA 3GMSA 2O48X 2QZZA 2Y1FA 4RF3A 3WDSA 3HDJA 4GL4A 1ISJA 2DFDA 4R68A 1MA0A 1X1TA 2ZJ0A 2CD9A 3TF5A 5CDTA 4CPDA 4RQUA 1P45A 5G0VA 3QWIA 4GWGA 2EJWA 5ICMA 3CZMA 1EFLA 2NU7A 1A9YA 3V5NA 1U28A 1TT7A 3WGIA 2IYOA 4Z0PA 1YB4A 2VT3A 3PDJA 2J3HA 1UH5A 2IZ1A 1LXCA 2ZJ1A 3FNGA 1J49A 4QO7A 2GASA 4TVBA 3ZWBA 3MCVA 2R6JA 4E30A 1DC4A 1KEVA 3D4OA 3KSUA 1D3AA 5DBIA 1V6AA 1GYQA 3LT1A 3E8XA 4WLOA 1EVZA 1LLQA 4JXKA 1Y7TA 5DDIP 1YQXA 4J49A 5C3MA 2V6MA 1Z74A 1JWAB 4IDAA 1H9BA 4XYMA 4Z9XA 4Q39A 3C85A 3W6UA 2YQ5A 4XGIA 1RJWA 4UVEA 1MC4A 1AE1A 4JNKA 3DL2A 5ER6A 3W6ZA 5CEFA 5JAMA 1IPEA 1ZFNA 1VM6A 1P0FA 3HNPA 4WLUA 4KUHA 4XEHA 1LRKA 2VT2A 4AJ2A 4OXNA 3TQHA 1LSUA 3CZRA 3PXXA 2BLLA 3Q2KA 3PZBA 4JJFA 4PLGA 2VNSA 3WLEA 4YCAA 3LK7A 3AUUA 5T8KC 5AXDA 2OL4A 2VNAA 2OMEA 2PZMA 4I5FA 1JAYA 3C1TA 3OIGA 3E9QA 3DAPA 2AEFA 4Q3CA 5B4VA 4YAKA 2OFPA 3W8FA 3GC6A 3IKVA 3PQEA 4GGOA 1LLUA 1ISIA 4J1QA 3ZNNA 1E3EA 1XG5A 3BMCA 3MJVA 2X58A 2C5AA 4MP3A 1LDEA 4W7IA 1P77A 1HDOA 1KEUA 1Q7GA 3DDNA 4HY3A 4NIMA 3JQCA 1QORA 4EZBA 2PKRA 3KSZO 3Q0EA 2B35A 3FWZA 1QYXA 3TZKA 3JD3A 4BIIA 2DFVA 5I7SA 2VZ9A 1TT5B 1HF3A 3KXDA 1KC1A 4E31A 3K73O 4F45A 3E18A 5JCXA 1LBEA 3Q6IA 4EUHA 3HFSA 2VYNA 4WOKA 4L0QA 5DN9A 3ANMA 3VVBA 2VOEA 3OIFA 4A27A 5JE8A 1YQGA 4E21A 4FFLA 1ZMTA 4WUVA 2Z5LA 3ZV6A 1OC4A 2GDZA 3HQ4O 1K6JA 1H93A 1VKNA 4MJLA 3OFSA 2QIOA 4HKTA 4FFPA 1I33A 5JDCA 5DT9A 1SEPA 3PJEA 4BNUA 4BQRA 3S2GA 1ZK1A 1U1IA 2ET6A 1JAXA 3B1KA 4J3FA 3L6DA 3FBGA 2Q45A 3GZNA 1GPJA 2E48A 1L7EA 1ULUA 3K30A 4J7UA 1A27A 4CMCA 3DBLB 1X0VA 3QE3A 1KERA 2RH8A 3PIIA 1X7DA 5LCXA 1AN9A 1I3MA 3ZWWA 3WR5A 4A73A 4F3YA 5A06A 1YGYA 4RVFA 2VWPA 1BXGB 1P1RA 1LSJA 4B4OA 5KVSA 1UP4A 4EDFA 2WD8A 3DONA 1H6CA 3OEYA 5L4SA 3C7CB 1WDMA
chains in the Genus database with same CATH superfamily
1P9OA 4OB7A 4AS1A 3BE5A 3CT6A 3P2JA 3VSAA 3E3OA 3WGZA 3ELYA 1RWXA 5GY7A 4WE3A 1QFMA 1WZ2A 2WWWA 5DN6D 2Q6LA 2P75A 4LJLA 4RKRA 4HEQA 5EXDA 2HQOA 2CLCX 4XWYA 2NUPA 4E32A 1C3LA 4E5VA 1IQUA 4M38A 4R40A 2Q99A 4MI9A 4XKJA 1Y9AA 3FCEA 3CB2A 3HYCA 3QFTA 4L57A 4XVHA 4IINA 5JNWA 2C7OA 3NV7A 3AWDA 4UHDA 3PEYA 4L28A 1SXPA 2YZGA 5ERXA 1D2NA 4UM9B 4XCQA 2RCNA 3R5SA 4W5QA 4R1SA 2PVSA 3ZKWA 4ESOA 4Z7OB 1U3VA 5F35A 3JAWA 4CKXA 2IH2A 4J4BA 1GPKA 4I7EA 2H85A 4I1UA 1QOZA 4XTCS 4W5TA 2JA1A 4B31A 2ZYRA 4O08A 3WZLA 1G3MA 1I4LD 1KI2A 2GPWA 4W5JA 2IXDA 2F9FA 1TFRA 3D0KA 4G0XA 1ZU5A 1ZC4A 4WNAB 4Y9RA 3VZDA 1J0CA 5HZMA 5JNLA 3VDQA 1F9AA 1RM0A 2Y6UA 4NZ9A 1WBDA 2BR4A 5ES3A 4XB6B 1PYGA 2B25A 4IOMA 2Z98A 5TE9A 5MN4A 1RPTA 1TCCA 4YUXA 1JQJC 3RODA 1F5SA 1TF2A 1RI2A 3BL6A 3MWJA 2C07A 4IBOA 4MWDA 1O96B 3U4CA 3HN7A 3DXYA 1NZJA 3JVUA 1WM1A 3N2GB 3R5JA 4I8IA 3SSAA 3WV5A 3QBDA 3JZDA 3R0QA 2P3OA 4H7KA 4DSNA 4UUNA 1UQRA 3HB4X 3QKSA 3HJHA 4CF6A 3NDIA 4BU0A 2WBLC 3AJAA 2ZZMA 3O1LA 2YJ6A 3Q11A 5KAPA 3CCCA 5FA8A 1JLRA 2ISQA 1SRRA 4KLAA 1PBNA 3TRHA 4EF4A 1SKUA 3QXHA 1G18A 1PJSA 3V46A 5KKNB 2G1UA 4I1YA 4MB0A 4QPPA 4W8HA 3AGQA 3HY6A 2J9FA 5J47A 1OY1A 2C9CA 2DTEA 2GNPA 2NZXA 4QYWA 3CPHA 4P4NA 2Q2VA 3LPDA 2BKEA 3HRIA 3DWIA 1JT2A 4BNNA 1GZSA 3AHEA 1ORDA 3UAYA 1PDOA 3H2KA 1A5SB 1GL7A 4DA4A 1T0HB 2P11A 4F9GA 1D2GA 2PKQO 2A1TR 2X2FA 1HQKA 2D62A 3R3HA 3G17A 4I9GA 3LZDA 4K2AA 3I34X 3LKDA 4AJ4A 4Y6SA 1GDDA 3VYSB 1GU7A 2JLCA 2YYZA 4C03A 3FXAA 4C6SA 3RSCA 3CKLA 2Z2KA 4FMDF 4BKPA 4UAJA 3DSRA 4ZDJA 3LIPA 4MYUA 3DMHA 3JATB 1T26A 1NWHA 2RGYA 2F43B 3PL5A 4ZVUA 1J9EA 1O87A 2NT4A 5HK8A 4D9GA 2JGFA 3KQHA 221PA 3WYFA 3OSUA 4PHGA 3W2IA 4CEHA 5KYVA 4FS8A 2GHIA 2GZAA 1HE5A 3BK1A 4DBZA 4D57A 1KOFA 2OD7A 4RD3A 4BIMA 4LNUB 5CAEA 1QQBA 1DTWB 2EKPA 3A2NA 4YALA 1TAQA 2M6SA 1NY6A 4GT1A 4H7EA 4OXKA 2PNJA 4BLOA 1YASA 5G1OA 3G9TA 4NYJQ 1AA9A 1X14A 2C3UA 2QLMA 4MQ5A 3A1TA 3WG9A 4DWJA 3EX7C 3SR0A 1J20A 2B78A 2VHWA 4G1CA 4KQMA 3RVMA 3SQNA 1M3SA 1VI5A 2PX6A 2W2OA 5JANA 3IKTA 4GOMD 4H6XA 4IV5A 5KZMB 1L5FA 4YAEA 1SCAA 3ZU5A 1DIBA 4OI1A 3EDYA 5JJBA 2BHRA 1L4MA 4H0NA 2A4MA 2P9TA 4H35A 3GLVA 3B3AA 1T5LA 2OB1A 2P6UA 4MPPA 1XMSA 5D7BA 2CFRA 5HG0A 4CDMA 3GJ0A 5DIZA 1CIPA 2ATIA 1USKA 3HS3A 3MPUA 2H0AA 5KTKA 3CIOA 4II3A 5G41A 2XW6A 4WOJA 3DLIA 2QT0A 1IN5A 1WS6A 2I6SA 4FYJA 5HF6A 3IPRA 2EGHA 3NDPA 4C7VA 5DCYA 3PFIA 4NCIA 3P0FA 4MZXA 3USZA 4DNPA 4YRTA 4I19A 1YNOA 1B8PA 1JE1A 1EWRA 2ZVDA 1R7RA 3LHKA 1E7QA 4M22A 4Q02A 2PUWA 1WX1A 4GOND 3ZXYA 5CFZA 1Z4JA 5FNZA 1XEXB 4MUAA 4K03A 4UZEA 4X54A 2IXFA 4EL5A 1NUAA 2XUHA 2XV1A 2OAQ1 5JFOA 5IM4F 4AY3A 2CHFA 4EA7A 2G63A 3BWMA 4JROA 2IW3A 5B57C 2Z30A 4ZK2A 1CHNA 5HJ5A 3KEMA 3RTBA 4ZALA 2AQKA 2EOAA 5TARA 3VPSA 4FT4A 3I92A 4WIAA 2VHZA 3CLHA 4V0LA 5ALUA 5SY6A 3N2KA 2HSDA 1E6WA 1WXIA 1WMEA 3F9RA 1RYHA 3HA5A 4P2BA 4ZJYA 4FOTA 5JRZA 4ZO7A 3GT3A 1KEWA 2FSVC 4G01B 1ZXBA 1XPOA 4HUQA 4ZOLA 4MQ6A 1P4HA 3J7TA 5DN6A 4EYEA 3DE0X 3CRMA 3FVRA 4G1MB 5A1TA 4NBUA 4WLFA 1PS8A 3T7EA 4YEDA 2F1JA 3UK1A 1W36B 5JMPA 3VZBA 4IH9A 1WP9A 2FZ4A 1XEAA 2JCYA 3KKQA 3NAZA 4LHWA 4PTZA 4XJXA 5DXJA 5EJ4A 2NVUA 4WMLA 5DWVA 4JJZA 4XVRA 3IELA 4IIBA 2P6RA 2I8CA 4GX1A 1SKBA 4HLCA 2H2HA 4F4IA 2HL6A 4LZOA 4KAFA 4FDAA 2IKSA 1OYYA 2MSDB 1GTZA 4OHVA 4OYHA 1IZ8A 2C20A 4R2LA 4RZSA 4DQVA 1GTJ1 1IJEA 1T3GA 5DEOA 3HDVA 5B55A 4ISCA 4KTVE 3C8MA 5PNTA 3GHHA 2IZ0A 2M98A 3G1WA 4NV3A 2X4DA 3GOHA 1XCBA 3RF6A 1XRQA 3DC2A 5HZHA 4ES6A 3E61A 4D7AA 3UFBA 3CRZA 4YRFA 1W4BA 2Z56A 5I4BA 5F21A 5LUBA 2W0MA 2GS9A 4GLBA 4HB4A 3S99A 5FH9A 2XRZA 3WFZA 4JJKA 3PQ5A 4KG7A 5EE3A 1K6EA 1BO6A 2XITA 4TYMA 4FX5A 2J5BA 3I01A 5CPFA 3T61A 2ZXFA 4UQPA 4JN6B 3ZI7A 1WVIA 3DPIA 3ZD6A 4ZOEA 1I5OA 4B73A 2EL9A 4Q4DA 1V48A 1VPVA 1SC9A 4JQSA 5AJWA 3X1KA 1HO3A 2PUAA 1HDZA 3IR7A 3V55A 5T4HA 1NI4B 1G3QA 4ERNA 3HC7A 4TWAA 5I5GA 5K8UA 1RC1A 2O1EA 3V9PA 1H1LB 1UM8A 3G8DA 5E7QA 3DJYA 3TLGB 3OMWA 1TKBA 4G8BA 2D1FA 5CK5A 3FUXA 2JJQA 3OE5A 4H15A 5HKOA 1UT5A 5FWXB 2Q46A 3OIWA 2TSYB 1BKYA 2B8NA 1W5EA 4H7IA 2AFHA 3A36A 3JZFA 1RWMA 4MSUA 4Z8XA 4X41A 1TYZA 2IYSA 3WLIA 2KMLA 1FFEA 1KKLA 4WK0B 5ILGA 2POQX 3NHYA 3ZNOA 4F3KA 5HIJA 1DQZA 1NONA 1PNRA 4TL6A 2OCGA 1A77A 1SXJE 1X6VA 2VSXA 2O2DA 3NVAA 3LCRA 3OHMA 4JLSA 3TDNA 1HNZB 4V2UA 1M1UA 1GCAA 1MAUA 3BBLA 3LQRA 1K63A 3OD5A 1P9NA 1C30A 1TYEB 2BEVB 1U3TA 2PIDA 3PFWO 5C46F 1WZIA 5BSKA 4TTPA 5F5LA 2QNBA 5AVRA 5F7XA 3P9SA 4JI7B 3FRJA 1NJ6A 3WMXA 2EIXA 4EBBA 4V2IA 3T4UA 1GLNA 3ICPA 3KR1A 4D9BA 3DZBA 1ESEA 2H8GA 2Q0HA 3K35A 3OM9A 1TGYA 1UDRA 2P9HA 3AM1A 4RNCA 4X3CA 2G9UA 3LF2A 1FJGB 1B41A 2DULA 3VTZA 1YT5A 2CE2X 2C9YA 4EUSA 4W6QA 1D1SA 3IJ5A 2YRFA 1UR5A 2VAPA 4JLWA 3CR8A 4NQRA 1N2BA 2YJTD 1S2DA 1XCJA 2PN1A 3K7EA 4MW6A 4ZC8A 2NU7B 4PC7A 3WDKA 1IJBA 4QARA 1EB8A 1NURA 1WMBA 1MRNA 1UZNA 2VSNA 4A6PA 1GU1A 3WAGA 3D02A 1UOQA 2FQYA 5CW2A 5AT1A 4WECA 4FBGA 1BTOA 4HQLA 4B45A 3VNSA 4B79A 4AF8A 1X8LA 4FTWA 5EY5B 4LZZA 4PYJA 4BV3A 5JJCA 2FPMA 3LUKA 4FDMA 1YR7A 1ZR4A 1HZZC 4EJ2A 3GWGA 4ZK6A 4BPRA 1WSWA 1E32A 3M49A 4JR0A 3W8NA 2G1KA 4RKWA 3T7TA 4Q21A 1U6JA 4FJ0A 5K0CA 4H31A 1HT0A 3KL2A 3SEZA 1OLXA 3FPSA 4DV6B 3CB4A 1QTQA 5CM2Z 3SLKA 4TVOA 1G2IA 2WVJA 4JC8A 4NG5A 2HUNA 5FWAA 2CNWD 3KB6A 2GCNA 1T1IA 4BWFB 5B2FA 5KNLA 1JB9A 4BO4A 5D1HA 3IIJA 1FFGA 3RIYA 3EXHC 4KX3A 4ZI3A 1WOMA 3HCEA 1YUNA 5CVDA 2WVHA 4H1UA 4KNWA 4PQYA 5CH3A 1G8FA 2B36A 3GEGA 5ILQA 2PSDA 5SYMA 2G3YA 3WXMA 5F1YA 3ZK7A 3HZZA 2Z9BA 1B00A 1SXJC 1H1DA 2VJAA 3RD5A 1BVYF 1JEJA 2BL4A 3ESCA 3IEKA 4INJA 4LWOA 3NFRA 1PE0A 1DFGA 2VJBA 5DM0A 1W85A 2ENWA 4EA8A 3U60B 1BQ3A 4QOEA 1QF7A 5EZ5A 2VUTA 5F98A 5DB4A 4PLZA 3VOTA 3ZX5A 1T8TA 3E48A 1DELA 4LY0A 3KQYA 3OLZA 2Q8PA 1X39A 4TWZA 3HDTA 3R3VA 3AR7A 3PC3A 1PHPA 4RD6A 1GGFA 5L6MB 2WUGA 3BKXA 3M3DA 5B5SA 2JD1A 4FR5A 3PT5A 2BJVA 3LX6A 4I8XA 1QP8A 5G2OA 5FF9A 4LCJA 2CHGA 1C0KA 4FGJA 1S4MA 4GXQA 4R4JA 2IXGA 2WIJA 3OJXA 3PTLA 2VP2A 3GFQA 3LCVB 1JS1X 2WR8A 3OPVA 3AVOA 3KFVA 1B26A 5EGNA 4ZA2A 3K1AA 3RFFA 1JIJA 1W36D 5EXPA 2OQ2A 2AG5A 2BW0A 3QMWA 4DIUA 5EFZA 2GBIA 4BNGA 4C9BA 3HBLA 4LDQA 4FDVA 2C2OA 5JCPA 1EX1A 1Z83A 2YHBA 3E9MA 2WUEA 3L7NA 4JL5A 1YR9A 3OSZA 2A5LA 3H9EO 3HRKA 3NFYA 3GJ6A 3A6ZA 3NWOA 1T5DX 2FN4A 4FZRA 5CTAA 5BYBA 2QB5A 5H0IA 4XLTA 1HH4A 3QYFA 1UBHS 1XD2B 1M1YE 2FPGA 2H7CA 2XNCA 2ZBDA 3GPDG 4GPZA 5DWDA 1MIHA 2M1XA 4KQ6A 4J0DA 4I1OA 3JQBC 4RZQA 3HDGA 4ZVQA 4D0GA 4YECA 2JZCA 4QOJA 5MGNA 4B7UA 5AK6A 4LOAA 4NI5A 3ZDRA 4H6PA 1GQOA 1Q7RA 2VNJA 1JU9A 4B34A 1G20E 1TNDA 1SR8A 1U2QA 1KMHA 2Y27A 1OXXK 1PTKA 2NXWA 2WTNA 3F0TA 4RHFA 2FSHA 2N9UA 1UAAA 3MWKA 2IS2A 4CCYA 1BC5A 4KFRA 4I3HA 5K0FA 3E82A 4HSGA 1AQIA 1NDQA 1HE8B 2DU8A 4GXRA 3CCBA 4TLDA 1J22A 3FHCB 1NI4A 1W5SA 2B5WA 5ALFA 1K68A 3PTAA 4NOLA 5F73A 4YAGA 3H5OA 2YIMA 1TD9A 2DKOA 1T36B 4A0FA 4LVNA 1OZFA 3L92A 4ROSA 4PAMA 5IJ9B 1XQWA 3BMOB 2EFYA 4DT1A 1UOOA 4DJFC 2NNLD 4WAUA 3IODA 4D96A 1U0OC 1GCUA 3HFJA 4URXR 2TMGA 1OWNA 1AOXA 2OBYA 1RYMA 4K0RA 1KOLA 2G7ZA 3T1HB 5K2OA 1K1EA 4TLEA 2O50A 4FSHA 4LC9A 3KZVA 3KTAB 5EUQB 4EUEA 2N3ZA 5ENVA 1N9GA 1LDYA 2AQHA 3C3DA 3ZHRA 4FB4A 1UPFA 4LV5B 5ECDA 2ACEA 5C4GB 3ROFA 1RAIA 1K7CA 5CDFE 3T12A 4QFDA 5EGSA 4DYDA 5FUQA 2OBXA 4GDMA 5GPBA 3FNRA 2PMWB 2IPNA 4JQOA 1Q74A 4LSWA 5EG5A 4BO0A 1SD5A 2GTHA 4NJEA 2Q5CA 4BV9A 2EKBA 3MAJA 5JO9A 5AQ1A 1NX6A 3QKRA 3EUWA 4G0QA 4J0JA 3SYMA 5G4KB 1DB3A 1B74A 1I0IA 2INGX 3DXXA 3I73A 4L6AA 2IHVA 1Z5OA 2C5LA 4M7OA 1U4OA 3HUUA 1FMCA 4YP7A 3T7IA 4D97A 3THYA 1EDDA 3HMKA 2QA5A 3DEFA 1DC3A 2E4ZA 2I4IA 1FNBA 3KDAA 2LE0A 3KQWA 3CX4A 3QVMA 3BJMA 4WCFC 3V8QA 5L3VA 3E9NA 1LPSA 2FEOA 3ZCVA 3ESAA 3PV0A 4E1AA 1ISGA 1YA4A 2YYSA 1N1GA 3BZBA 3K5HA 4N82A 4Y67A 1US8A 1W1UA 3VO9A 3G1UA 5BSVA 1OI3A 1SUIA 4CDGA 2V74B 3IJRA 4PQEA 5CLQA 1UQTA 2DG2A 3EQ9A 3UM9A 5I7UA 1M10A 2JLVA 2PWYA 1AK9A 1OJ7A 1A97A 4P4UA 1KFJB 4XEUA 1RXSA 4KPYA 1SCBA 3HCOA 5E1DA 4DLBA 1GZDA 1HDEA 2AH5A 5CDGA 1BDJA 2B4YA 4K0KB 3BIFA 1OXUA 3DMDA 2D0OB 2O05A 1FS6A 2IDJA 1KDPA 4JLDA 3ML1A 2W37A 3QTLA 2GNOA 5GM2A 1GOTA 1FQKA 3ISJA 3OE4A 3QIAA 1Z6QA 3R7BA 4EYKA 1HNXB 3D7KA 5JAOA 1HR0B 5AYVA 4MRSA 4KQWA 1UQUA 2FK7A 1O6BA 1TO1E 2VYQA 4OFWA 1Z6PA 3MJ4A 1NHGA 4OK3A 2YWJA 3FVVA 1ADJA 1AF4A 1C7EA 3B52X 1PL0A 4PO3X 3OQMA 3ANYB 2QJWA 2QKYA 4FNOA 2YDYA 2YV1A 3OFKA 4NEQA 1E1DA 1XQXA 4QBTA 2BF4A 2WOOA 4KQ9A 2YVUA 4NZMA 5K2MA 5GV8A 1YVRA 4EPYA 3N0WA 4QULA 5JZOA 4BB6A 1VLQA 1V7ZA 3HBAA 3LBYA 3TI7A 4GLJA 1Z8FA 1PUIA 1YNSA 2FW8A 3LC0A 3A05A 3OJWA 2XLBA 4PQFA 3OF2A 3NOOA 4U2GA 4BEWA 1YQDA 1SGWA 1SQFA 1EQAA 1LX7A 2FZEA 2HFJA 3JVEA 2YWCA 4RL4A 5C34B 4OHBA 3M9LA 5A5EA 4XQ0A 3F96A 1EGVB 3DE2X 1NBHA 4EB6A 2G82A 2AW5A 2WFAA 5JNRA 1P62B 2JH3A 2Y67A 3UT6A 1EDEA 4Q47A 1GNVA 2YICA 3VUEA 4MW2A 4ZJUA 1GGNA 2I1QA 1JLLB 2E87A 3CEAA 3FPAA 3LS2A 3V2GA 3TUZC 3VKHA 4GRIA 3NQ41 1THMA 1UODA 2BMFA 3R3ZA 5DGHA 3O8QB 1A2QA 2FSFA 1JAIA 3K32A 4PSCA 4ZXPA 3HHPA 4DLSA 1ZITA 3K0HA 4GEKA 3MINA 2ERYA 4N0EA 4CMIB 3IVXA 1I7LA 3H8SA 1N7HA 2ZVQX 5CXSA 4M1EA 1P18A 2GN2A 4KDRA 1I13A 1GAJA 4EL0A 2C5SA 3QJ5A 4J9UE 1PF7E 2GN8A 1VL1A 4RD4A 4UDYX 3TL3A 1YHYA 3GY0A 2ODAA 5T8KA 4AO7A 3H13A 1RQRA 1NNSA 1X42A 2J7PA 3N86A 1CSEE 2RKBA 4K9LA 3WVNA 4RTLA 4IL5A 5IXYA 2ILVA 5KTOA 3L79A 2Z83A 4AZVA 4N3NA 4ZQEA 1K6XA 4KYUA 1JLKA 4YDHB 2J6IA 4TT3D 1E2KA 1AZTA 1EP1B 5IANA 4PGFA 2Z95A 3NEAA 3NJ4A 2CVFA 2X8WA 4W7HA 4XIGS 1C7IA 1KAHA 1EINA 4E12A 2F2TA 1CXZA 1JHVA 1PVDA 2I0FA 4REQB 1G8AA 3MAAC 4JMLA 3U26A 2HRCA 1T2NA 3WV4A 2QRVA 1KAGA 4BB0A 3NM5A 4GEGA 1DBQA 1S8NA 4AO8A 1G2QA 1M2WA 2DPLA 3UQZA 1WR8A 2V8OA 2ZROA 3LQFA 4A6DA 1QQ7A 1WKCA 4PNEA 4OAQA 4BCCA 1WHSA 4P4SA 4BKUA 3TCKA 1BOFA 4LK3A 1YAHA 1QG6A 2LRHA 5JAZA 4OSPA 2WYUA 4QRDA 3JQPA 1XTVA 1SG6A 3ZTTA 4HAIA 5CD1A 5CVJA 1DIGA 2EFHB 1YS2X 2QRGA 5LYJB 1NXPA 2IEDA 5H81A 2Y1EA 3WAJA 3P4XA 3IOMA 1O97C 1JU4A 1BQEA 3ON5A 5F2EA 5FA5A 2PIAA 1PKEA 5KOHB 4AKIA 1GUDA 3AYXB 3WYDA 4AJNA 1DAMA 1DAFA 1VJDA 3U2QA 1F8YA 4N6NA 5HQ3B 4NZOA 3WLTA 1IHXA 4JB0A 3P8ZA 5F9MA 3FFAA 5HJEA 2PJUA 2P4UA 3CBQA 1NPTO 5ER9A 3K5PA 3I61A 3WSTA 3AETA 3ZLJA 2UUOA 4Z7NB 4QEDA 2AN5A 4BKRA 4GBGA 4FW9A 3QPWA 1T91A 2ZSFA 4PFQA 1FTWA 3A0UA 3NHFA 2ZWPA 1AB6A 4UHHA 3RDPA 2PX4A 2XB8A 2IOHA 1JI0A 2AB0A 1B6TA 6REQB 1FP1D 2J9FB 1L5MA 5JCJD 5DW0A 4OXQA 4FGWA 1N75A 4KXUA 1H4TA 2VA9A 2R6FA 2OV2A 3H11A 1TYCA 3DZHA 1HEYA 3M89A 3GVIA 1OWOA 3OZRA 3AXSA 4DDKA 2XCTB 2VH1A 4PO8A 8AT1A 2E1PA 2A5GA 4BKMA 3UB4A 3AHFA 3JWIA 3HFGA 1V39A 4JB8A 4MQMA 2GPAA 3KDSE 2C5BA 3L1IA 3O1JC 1JA1A 4NMMA 4OU5A 4RMJA 1JV2B 1LLFA 1U1EA 4DKXA 2DF8A 3ETEA 4RHEA 2FGJA 2GGSA 2W2VA 3C7KA 3DT6A 4HEHA 4IIFA 5I7EA 3Q1KA 3IVMA 3K0AB 5FL3A 2J3EA 3TDMA 2WAOA 1IY0A 3ETJA 3CX3A 3BBPA 2GN4A 2VA8A 3DEHA 5JVDA 1JEYB 2VPIA 1FNNA 2UYGA 3CWZA 3NVMB 1Z33A 3HVUA 3WL4A 1VJ0A 3ZE9A 4D3ZA 3T99A 5I8PA 4WNAA 2R25B 1K2VN 4L7VA 3ONDA 4OATA 1CT9A 3AUSA 4MIKA 3MJSA 4R2HA 3UHFA 5CT8A 1ULAA 1S9HA 1Y89A 3LLCA 4NDAA 4YJ2B 1SIWA 3SMVA 3LBIA 3EC1A 5JNTA 2RGRA 1CB0A 2NO1A 2ZWVA 4U6NA 3SYKA 2HA3A 1EFVA 3W06A 5E95A 4MWGA 2XB9A 3BAZA 5AO9A 3ZE7A 4BO1A 4AWBA 4C89A 3DQPA 3HJAA 1LRLA 3CF2A 4CF5A 3T1TA 3ZIAD 2VG8A 3KZXA 5BUCA 1MTOA 2PSHA 2YWGA 4I50F 3ZCTA 1RM3A 2YCLA 4WINA 1C7QA 1CZUA 1UBTS 1E4VA 3E2PA 4CU2A 2P4QA 2XLCA 2EX0A 4L8VA 1X86B 1NVDA 1CJUC 4L08A 1QLJA 1JFTA 4BGEA 3AR8A 1J8MF 2I7TA 4AMVA 1ZGBA 3O31A 2VDWB 4QAQA 5FI1B 1KJNA 3UBTA 1Y98A 3ZD7A 4FCTA 2V7UA 4L4ZA 1TEZA 2BMVA 2OE2A 3VHXB 3B13B 3MD9A 1NRJB 4RFSB 5FX2A 4PTLA 5AESA 1MG0A 1YC5A 1S8OA 2W2LA 2XCIA 2ZETA 3NC4A 4QICA 3FMOB 4UTZA 4Q9LA 1KZ6A 4R7GA 4YACA 2YY5A 3ZKAA 2DHEA 3X3HA 1KFEB 1ZA2A 3QUTA 3RWOA 3SR3A 5BSEA 5JZSA 5ALSA 1UBEA 3WLNA 3L07A 4NXMB 5ENDA 2G6BA 4AICA 1BDHA 1R9NA 4AMGA 3GZTB 4KDEA 4MI1A 1Z6AA 3RS5A 5C8VA 4HDNA 4N54A 2YMMA 3BWEA 4UC0A 3G2OA 2W2NA 4FFSA 3STHA 4D74A 5IH7A 1WO8A 1WUHS 4IOJA 2CE7A 4IEIA 3N8IA 3UG6A 5EINA 1Z0DA 1IULA 1ZPDA 5C4MA 1C9YA 2J7PD 1RPZA 1FJHA 1NQAO 1ACMA 5AOCA 1MENA 1SO8A 2OO5C 2RB5A 3KKOA 1MOZA 3UJDA 3ZEIA 4HT3B 2WD9A 3C5VA 4JX8A 4PY2A 3H86A 3NAQA 3BD7A 3LCMA 2R84A 4HC4A 1ZUD1 2XEXA 4K6MA 4NU5A 4IDOA 4NBLA 1JLHA 1F60A 2LXNA 3UUFA 3R8FA 3EH2A 1NULA 4FQ5A 3FG9A 3NBKA 3VYUB 5K5EA 3FPHA 1T5TA 16PKA 2FX2A 3CTPA 1E92A 3DF7A 4BNKA 1I01A 1Z62A 4PAGA 4DLXA 2PGIA 3T4XA 1O0CA 2DEUA 3PWTA 3KK0A 4HNGA 1Y9DA 1FRZA 2GXAA 1IM5A 1NI3A 1S8FA 3QVVA 4TMFA 3EZYA 5J9FA 3UN1A 2A0UA 3LKVA 4MV7A 4HDQB 1M2JA 2QLFA 2R3SA 4Q4JB 5BSUA 3X2EA 4BYMA 3N58A 4XJVA 3O1IC 1T3TA 2I33A 4YH1A 1RKVA 2IXBA 3NBXX 6Q21A 2M9MA 3W1VA 2FHSA 5FPYA 1E79A 2E82A 2VJLA 4ZVMA 3VOBA 5TSDA 3AY7A 1ORHA 1KP3A 3BH6A 1CETA 2H2AA 2OGZA 3GPIA 3LLSA 3T0IA 1JFSA 4P0QB 3C3BA 1C1YA 3CWCA 1M8KA 3FHOA 3HU3A 1A4UA 1FFSA 4YT4A 3GLFE 1WB4A 5HX7A 1WMFA 3O4FA 1M6YA 1TU3A 3SBOA 4F9TA 1PT9A 2ZSEA 4C2AA 1T0IA 4HBZA 4EGCB 1XTKA 1KBQA 5TDHA 1N2OA 3MM4A 4G8JA 1I9CA 1CQWA 2ZJBA 1V8BA 1LLCA 2YCBA 5F78A 3RAPR 3LO5A 3V1KA 1KH2A 4JMPA 1TIPA 4PZZA 5HDBB 2GXUA 3V3KA 4M7WA 1Q19A 3H5NA 1MHTA 2CZGA 2O0JA 4QVKA 3RFCA 1BDMA 5EZYB 4DADA 2AG0A 4ZYTA 3ER9A 1QCYA 3B7GA 2GZSA 1C0PA 4JASB 1RAAA 2C4TA 4I55A 1JHPA 2ADFA 2BGJA 3K6RA 4PICA 5AVJA 3KALA 5BPFA 2QI9C 3V7NA 4YLEA 1PJ4A 3OQ6A 3ZY6A 4R1NA 2VAVA 5EPEA 1Y1RA 3K0BA 4R41A 1QQ5A 1TYDE 1QIKA 2LW7A 4XLLA 5CYGA 7REQA 5LXTA 2A30A 1T25A 3AW9A 4OQPA 3W79A 4ARZA 2GHRA 2HY7A 4ZKDA 4UHCA 3ILSA 4MTCA 1C0LA 3FR7A 5DK6A 5FP0A 5ALMA 4EMBA 1XKQA 4RA6B 5EWLA 3FKQA 1QX4A 2PUFA 2BBTA 1D7AA 3PHIA 3FFTA 2JBHA 5CNMA 1UCFA 3B8EA 2YWFA 4S2EA 2GPTA 5DTEA 1E5QA 2IYRA 4D6PA 2QNRA 3FVQA 1XP5A 4B6EA 4UD6A 3GRZA 4Q4CA 2IEZA 3EZ2A 1HFKA 5KSOA 3CW2A 3FVTA 3PWZA 3U9LA 4BNIA 5K8JB 6AT1A 4C6RA 2RFLA 2X0EA 3N28A 1AIPA 1NFRA 2IIQA 3AFIA 5L3RA 1KZGB 3IQHX 1CS0B 2VH2A 3H3JA 2GRJA 1QFSA 1PZEA 2I3ZA 1BXRA 3FPEA 3PC7A 4Q1AA 3HPRA 4RVDA 4EHAA 1US8B 4EKNB 5KTYA 2RD2A 4GKBA 1GUYA 2CL7X 5E9JA 4NV0A 1W88B 4RPCA 3MFYA 2FMIA 1XWIA 4EATA 4O8ZA 4F6RB 2ZLBA 4JIGA 3AEYA 3H5RA 5GQSA 3RC9A 3RM3A 5BWMA 1ONPA 1QK5A 1QSGA 4RPHA 1OI4A 3EXIA 3MWYW 2DM6A 2Q2WA 2JJMA 3OA0A 4X61A 5KYNA 1W8IA 3DP7A 2CDRA 3DL7A 1QH9A 1W2HA 2GRAA 2I6GA 3AWIA 1PI3A 3PPWA 4G9EA 5ISMA 4CN8A 4I2NA 1ZJZA 3D4LA 3QMVA 4GM0A 1WXGA 4X7BA 1FNCA 4CM4A 1VBFA 3AI3A 5FUWA 1JQ5A 1WEHA 1E2NA 3PF8A 4HYYA 4TUYA 3TRIA 3T5PA 3AVVA 2JDID 5GTDA 5AH0A 3SKVA 1O77A 3CRW1 3MCWA 4BMYA 5BUSA 4GKVA 1XKTA 2OK8A 2WTXA 4JLMA 4K6KA 4RPGA 5E8JA 5EMLA 1FYFA 5I3CA 3TW8A 3RSGA 1AC5A 1Q0LA 4Z9BA 5AVZA 4NATA 3VKGA 2FR8C 4UZFA 1EHIA 1NUTA 4FYIA 1CZRA 1ZKDA 4HWGA 2AA3A 3OKFA 2QN7A 4DC1A 2W2LD 2EFDB 5C1PA 1BKDR 1N6HA 3ITNA 3DFZA 4D0NA 4DWVA 2WM2A 3LPMA 3VZQA 1WHTB 3W8EA 4E7OA 4EYOA 3UMMA 1B43A 1OKKA 5BXQC 2HXSA 1GTL1 1RCUA 3RFVA 5L45A 4FYXA 3W1EA 4CIVA 2P4SA 2MSCB 3WJ7A 5FR2A 5FQOA 3ZGNA 1NOKA 4HNTA 4OHCA 2GQ0A 2NZ8A 1DEXA 2BFAA 2QTCA 2WQZA 2NYUA 1PJCA 3F47A 3OHSX 3TLZA 4BN4A 4O4HF 1DKNA 2WABA 2XTZA 3UJCA 3CPEA 4L95C 2J3MA 4OTZA 4ARAA 4RM2A 3A9UA 2PT6A 4ZEMA 1QANA 2AEMA 3TUIC 1CIVA 1E2DA 4E2WA 1C9NA 1YVDA 4N0QA 5EJGA 2X0RA 4D3FA 2PA3A 1Z12A 3EIXA 4J29A 5EVCA 5REQA 2PRKA 3G2KA 2DH5A 2GN1A 3A6HA 2PCLA 3IDQA 4LNUA 5G0SA 4CF7A 3HTXA 4UEJA 1IQ0A 4PWZA 5C31A 1W49A 2MTBA 3OZFA 2AR9A 3JQ6A 3AIIA 3INRA 4D9NA 2QQGA 3IEPA 1NC1A 1E58A 4CETA 1QZUA 4II7A 4YJFB 4FBMA 5MFZA 1UZUA 3A6GA 4O2BA 2R1VB 4MUXA 4R5MA 4KE6A 1OMOA 5C80A 3VNQA 1QH8A 4HRYA 4URZR 3T3EA 3SHTA 2C2BA 1B14A 3MNFA 3BB1A 3NM4A 1M73E 1DV1A 2C61A 1HE3A 3B7PA 4UOZA 2ZW9A 1XQ9A 5KOJB 2XCLA 1DTSA 1VJRA 2OHHA 2PJRA 2QN1A 1PG2A 3AUJB 1OBOA 4WASA 3JS5A 1YRYE 2VKQA 3DG9A 4M83A 4P6VF 3RRJA 5GZ6A 3A04A 5B6IA 3AINA 2PUBA 1WVMA 2WTUA 2NUPB 3SYTA 5E1OA 3TSZA 1UXJA 4KYVA 4B6JA 4BLSA 1CY7A 1N2EA 1RAHA 4U2EA 4F1WA 3C6YA 3BGVA 4GYJA 2HMTA 1G5PA 2VCYA 4NU8X 4KR9A 4ZTUB 2WWVD 1U8YA 2CXTA 2WSBA 4U7FA 5HJ7A 3SWWA 6LDHA 1TM2A 1XZPA 3W5DA 5D2CA 1S2GA 5BXYA 2ZT7A 1YL6A 4IJKA 2QGNA 2XMPA 5JNVA 3FWHA 4NXNB 4LYJA 3RIGA 1L1EA 3JX9A 3K1ZA 5HTKA 2PQ0A 2WFLA 2NOAA 3H9GA 3Q9NA 4HXEB 4BMXA 1RYBA 1QMGA 2W42A 3CZPA 3JAKA 4OHOA 3ZVNA 1R3DA 3FNFA 4QGHA 1AM4D 4LZAA 4MW1A 5TVGA 4F5YA 1T4CA 1TDJA 2WYWA 3I6YA 1CE8A 1V5IA 4LE0A 3BEOA 3LX4A 4P81A 5CIWA 2EJUA 3TNLA 4D9EA 3RIHA 2IOFK 2RONA 2RGDA 1VZ2A 4KPFC 2REQB 2DQZA 1RPAA 3IT0A 3SNHA 1KC3A 1HQYE 3E1GA 2KWIA 1WNFA 3LUPA 2X9QA 4JP5A 4LF6B 4P93A 5DHTA 4RELA 3R7WB 1Q16A 4BNFA 4TX1A 5BNIA 3FFXA 4DLAA 1RAGA 4YGXB 4DLWA 1JQ3A 5F2OA 3QW2A 4KVAA 1GQYA 1EZ4A 1PR0A 4MS1B 5CA1A 1RLIA 4HQNA 3NGMA 1XZFA 1DRUA 1UDXA 4MICA 3BG5A 4PIVA 3DFFA 2AE2A 1Z6GA 4NHEA 1U4NA 4NH4A 5CA1B 4KTTE 3KP1A 3QOXA 1AQ6A 1R16A 1W5FA 1X7WB 3OY7A 2QX8A 4BUCA 2AFIB 2QLNA 4FCCA 3WGKA 3SHWA 2LBPA 2CFOA 2RGGA 1PD1A 1M8GA 3FRIA 3KCNA 4NAUA 5DHFA 3AHGA 2IT1A 4A5SA 1G17A 2QUHA 1OHHD 1Z2DA 5AI9A 1PJLA 1Q0QA 3C41J 3L4EA 2IHUA 2W2MA 3RJ9A 3LY9A 3NOQA 5JATA 4A03A 1JQLB 2AF4C 4TMXA 5A4DA 2AR0A 2B1JA 4IPTA 4Y6QA 1W2WB 2C4NA 1SCDA 2HV9A 5KYXA 3SPXA 1QRDA 1SAYA 2X0IA 2IFTA 2ZTVA 3C14C 1VIYA 4L27A 5P8WA 4LF5B 3V7FA 3ASVA 2YXDA 4Q3LA 3T5DA 3R3JA 4KZPA 1J1IA 1RZRD 3GG2A 4JFAA 3FYCA 3LA8A 2D8AA 4M9UA 4Q3DA 1W2GA 2XPCA 1T5SA 3A9RA 3O9ZA 4XYEA 2VATA 3AQ4A 4QJ4A 2FUKA 2PX3A 4WXYB 2JDIA 3OQOA 3NTXA 4D4IA 3BFXA 5BNZA 2BFBA 3QXXA 4TKLA 5KNBD 4ZYUA 2ZBUA 2IUTA 1KOJA 2VJPA 2Y0BA 2I34A 1C3VA 3D1VA 4TQAA 4BVBA 4LFAB 4ITVA 4H0CA 4U7WA 2WHPA 5FEMA 1TC1A 4LJ4A 1Z16A 3AH8A 3Q7SA 1Q20A 4B3GA 1U0FA 4QT0A 3G49A 2FH5B 1MQ9A 2O3SA 3AEKB 4KHZA 4UFOA 4RXTA 3ANSA 3W78A 4LBZA 3ONNA 2O06A 3LXRA 3ZXIA 2J31A 4ESEA 3NJRA 5FYDA 5EYPA 5FBQB 4FNMA 4G8DA 4RK1A 5GWXA 4J0KA 4O02B 1TMGE 2NLOA 1DXQA 3OQHA 2BCEA 4GOJA 1VB3A 3F5SA 3UATA 5F3RA 2BEUA 3DUWA 3R9XB 2OK7A 3T3NA 5FLKA 3ISTA 3IQGX 1KDRA 2GBCA 5FL7A 2QMQA 4MA4A 4Z9AA 1U7OA 4R3WA 2RBGA 2BVNA 1R18A 1OI2A 1KJJA 3OU6A 4Y1FA 4EGFA 4S05A 2RH9B 3K2QA 4H16A 4TTIA 1AV6A 1F6BA 5K01A 1Z28A 1UJCA 1F4PA 3M33A 3G0DA 4MMXB 1TTPB 2ONJA 5FUYA 1YA8A 4P5DA 4PZEA 2FPPA 4OXRA 3ZZ1A 1KL7A 3P0JA 2J9YB 3FHTA 2SBTA 3I39X 2PSEA 3NXKA 2RB4A 4PAQA 3HDHA 4O29A 4AG6A 2C5FA 4MQBA 4PM4A 1W48A 2BWJA 2VT7A 4P3PA 1N5JA 1ZIOA 1J33A 4WZZA 3FZEA 5HCUA 1NYRA 3R5KA 1LD3A 2ZANA 1QFJA 3C4VA 3R1IA 4IIGA 2YXNA 2WP8J 1RJEA 7AT1A 1R74A 2ECQA 2HWWA 3AEQB 4BO6A 4OSEA 1LDBA 2CLSA 4B33A 4CQMB 3BXEA 5KNBH 1U0NA 1TF7A 4DNOA 3B70A 3MFQA 1V2HE 4HZUA 3STUA 2ODTX 3V4SA 1MC8A 1XF9A 2QTMA 1ZM4A 3CNBA 4EVQA 3O94A 1TL7C 3HB5X 2WWIA 3EEOA 3HKCB 1CNMA 1DAEA 1PDWA 1M8FA 2CDAA 4MO9A 4CEIB 2JHFA 3WKAA 1E5DA 1Q6ZA 2CJWA 5DYGA 5BN5B 3PVSA 4OQNA 3R9IA 1L5QA 1KH3A 4B3CA 5KCZA 1GL6A 3BQMB 2C5HA 5ICGA 4KVFA 3NDJA 3PITA 3L6EA 3MGCA 3LOQA 5E2IA 3U81A 2QZSA 4ZODA 1PUXA 3CKYA 1TMKA 3ZQKA 1FDUA 2RHBA 1RPNA 5K7SA 2W2PA 4IUYA 3WISA 4CNBA 5K99A 4OO3A 4LECA 2HB6A 3I5AA 4NBKA 5DNWA 3C6KA 2P5UA 1N2CE 1DMSA 3OJLA 4RTNA 3KSBC 2FR1A 1LGYA 2WKQA 1CUWA 3K4HA 4QGBA 1IMOA 4J9VA 2OKGA 2D4AA 2OENG 2VPXA 4QUGA 1N1EA 4WY2A 4HMQA 1LNZA 2P8JA 2ZT6A 5CJ2A 4ZPXA 3YASA 4INAA 3TD2A 4PGGA 1Z75A 5TQJA 1PEKE 1OV6A 4MNTA 3ND8A 3A4TA 1CLUA 1DP4A 2XYHA 4TXNA 4V0KA 4I1PA 1K3TA 2H5LA 5CUQA 4P0PB 4BP1A 1ZUHA 1U1GA 1OXKB 3BVPA 2P30A 4R6WA 3PFNA 2ZBVA 4RS3A 4JUFA 4DPKA 1N2IA 3H1AA 4ZU6X 3KHTA 3NAGA 3PJFA 4LJYA 4QOSA 3EW9A 4DV4B 1S4QA 2IUFA 3QQPA 1M0WA 1XXHA 4B40A 1ODIA 4JBYA 1X0XA 2PQ6A 1XZJA 4PYOA 4CDRA 5JROA