2NU9A

C123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
286
structure length
285
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNTPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 109
structure length 285
sequence length 286
chains with identical sequence D, F, H
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu9A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu9A01
4HV4A 1P1HA 2V6MA 1NTOA 1ONPA 2CVOA 2G76A 2I76A 4PRKA 1FDTA 1UXHA 4ZRNA 5L45A 1Z45A 4J90A 4XEHA 3QWHA 3WGIA 2Y1CA 2HO5A 4WE3A 5KJFA 4PVCA 3DDNA 4MINA 1QORA 3RQSA 3ZW8A 4DPKA 2O3UA 1P9LA 4NIMA 4I08A 5KJCA 5CDTA 1SAYA 1I0ZA 3B1FA 4CUZA 3VKUA 3I4FA 3OICA 3GNTA 4G81A 1MG5A 3VH3A 4IMPA 4QFDA 1P31A 4F45A 7MDHA 2W98A 1C0PA 1ZJYA 3RJ9A 1EK5A 4ALMA 2C54A 2X6TA 1KY4A 1E7MA 3GFGA 3B20A 5H83A 4QECA 5AQ1A 1R0KA 2YQ4A 3WSVA 4QSMA 5MDHA 3B6ZA 5JDCC 1LC3A 3TJRA 4E2XA 1BXGA 3KTDA 4E2ZA 3KETA 1ZH8A 4FB5A 1EVYA 1ONOA 3N58A 3F5SA 3ICPA 1ID1A 4XQGA 1PWXA 2NUAB 4MKRA 1HYEA 4XGKA 3TZQA 1SB8A 4M1QA 1P1FA 1T2DA 3DL2A 3CUKA 3GDFA 4PLZA 2BKAA 5IZCC 1E1MA 1NFRA 3OQ1A 1HXHA 3VPHA 4PLVA 4YJHA 3BIOA 4OXYA 2AEFA 3VTZA 2TMGA 1R4NB 4ZJUA 5HBRA 1A9ZA 1I2CA 4IQGA 1NPDA 3G3EA 5A05A 1GQQA 4OXNA 2DFDA 3RFTA 4BNIA 4AJHA 1MP0A 4J1TA 1E5LA 1V6AA 1EE2A 1UXGA 4ROSA 3H5RA 2EKQA 4CR7A 3GF4A 2X0JA 4N5LA 3ZU4A 1O89A 3LK7A 2GYYA 2JCXA 2HMVA 4YT2A 2I5PO 1CRWG 1IHYA 4NU5A 5IN4A 1VL0A 4EJ6A 1HLDA 4WLOA 5KIAA 1SZJG 4XZ3A 3ADOA 4D46A 3PXXA 1UXJA 2X22A 4KUEA 2PD3A 2Q46A 4QXMA 3V5NA 4GVXA 2EJWA 3JCZA 3GG9A 3DAGA 1SO8A 3TF5A 4WGGA 4P22A 1ZEMA 1UXKA 3K96A 2DVMA 2ET6A 1DO8A 2VNAA 3ZWAA 1JLLB 3LSYA 2DBVO 1NHGA 3ANNA 4P4LA 4EDFA 4DYDA 9LDTA 1IB6A 4Z0HO 1G0OA 1R15A 3P19A 3FSRA 1AGNA 5EESA 2CF5A 4H3VA 3ZH2A 1U3VA 4E32A 5G4KB 5B4VA 1HKUA 1YS4A 3UUWA 3F6YA 3QE3A 2B4QA 4NK4A 1T25A 4DQXA 4Y6RA 2Y1GA 4B3HA 2DFVA 2SCUA 1AXGA 3U62A 3U4DA 3EZYA 3WGGA 4D0RA 3Q6IA 2FY8A 3LZ6A 1A4IA 4PIVA 3ZW9A 3ZV4A 4NBTA 3AOGA 2EHDA 1ISMA 2PZLA 1W4ZA 3HDYA 3JQ7B 1BG6A 3EC7A 4FOSA 4FCCA 1QV7A 1U8FO 1NQ5A 2OORA 4RQTA 1HE2A 2UDPA 5MGBA 1VM6A 3P2OA 4BKQA 3E1KA 4QX6A 4KMSA 3AFMA 4XD2A 5L53A 1LLCA 3GMDA 1TVEA 3GK3A 1PS0A 4CLXA 1LUAA 4FJ2A 4HNGA 4NDNE 4D3SA 3HFGA 4E4YA 4J1NA 4LSWA 2FOIA 3B1KA 2GRAA 4RV9A 3RFVA 4EZBA 1YQXA 2FN7A 5A9SA 4IXWA 1HZZA 4CQLB 3O8QB 4M86A 5DULA 4LRSB 1A5ZA 2R2GA 3OQ6A 4YWJA 5EL0A 3TNLA 3ZWWA 3DR3A 2HLPA 5G0TA 5BSHA 3H6KA 2GF2A 2PKQO 4B3IA 5CAEA 2P68A 4XWYA 3K92A 2BI8A 1A27A 4JGBA 3EK2A 3PI7A 3L0DA 3KM0A 4MIOA 5TX7A 5GZ6A 1CQJA 2ZQZA 4UULA 2C59A 1R4MB 4HBGA 3LT1A 3K2EA 4HFMA 4D45A 3GQVA 3VOSA 5DBIA 3GEDA 2PNFA 5TJHA 3VZRA 5JXWA 1NNUA 1A4UA 1QR6A 4NBWA 1ISHA 3WNQA 4CM4A 1B15A 1BSVA 3NGLA 4PLWA 4YDRA 3VPGA 1HRDA 1JQBA 4A03A 1PJLA 3DC2A 3ANMA 3ONEA 2D1YA 1LRJA 1GCUA 3NTOA 4PLHA 5F21A 1PWZA 2ZJ1A 3KLPX 4GL4A 3DBHB 4IDCA 3TDKA 4WLUA 3MZ0A 4TZKA 3F3SA 4XYLA 4JX8A 1BW9A 5FWNA 4IS2A 3BYZA 4E0BA 4BNYA 1YONA 3NKLA 1I2ZA 1I36A 5TF4A 2EEZA 2HSDA 1GR0A 2HJSA 4FFOA 2HMUA 1Z7EA 2AE1A 4ZQBA 2PH3A 2YDXA 4CLDA 1SEPA 2GDZA 1EDOA 1N8KA 4W6ZA 4BO1A 4XDZA 4LN1A 3BHIA 3VKVA 3VZPA 1MXFA 4JQCA 5JMWA 2EIHA 3OMLA 4BNHA 4HY3A 3ENNA 4RGBA 4J1QA 4CLRB 2DM6A 2YFHA 2P9EA 4PZEA 4PZCA 4FFLA 3CMMA 4CMIA 4CM3A 5EPOA 1HETA 5IF3A 4Q3CA 1DXYA 4ZU3A 1X7GA 3WBFA 5CDGA 3MWDB 4BNFA 1PGQA 1VSUA 1JAYA 1KIFA 4YTEA 4LVUA 4J43A 4MVJH 2PV7A 1KEPA 1I3KA 5DOZA 2EWMA 3WTBA 3OIGA 3P2YA 5DP1A 1NR7A 4YT8A 3I9JA 3EUWA 5KJEA 3HSKA 4I5FA 3ABIA 4WEOA 5JDCA 3IJRA 1BDBA 1GUYA 1RM3A 3GDGA 1J5PA 4RCVA 3ZCXA 3H9QA 2O2SA 3HNPA 3L07A 3WX0A 4D41A 4E5PA 2CMDA 3ZU2A 3H9GA 4NU6A 4BKOA 1HTBA 4MDHA 4DIFA 5G0UA 5L7TA 2GZ1A 4Z0PA 4LMPA 1EUZA 2QZ9A 1E1LA 3HWRA 3RBVA 2BH9A 3WIEA 3AW9A 3KYCA 3NDRA 1LSUA 2PKRA 2X7HA 3TZ6A 3RUHA 3DXFA 5KCZA 4EGFA 5IZCA 4QQRA 3ZV5A 1DFGA 4Y98A 4Z9FA 5L7YA 1NQOA 4A5OA 2OUIA 1I3NA 4AJNA 5L9AA 1UDCA 4YAEA 3SJ7A 2BGMA 3C3XA 5ER6A 4FPXA 5JW6A 2JCVA 2VHXA 1XR3A 4R1NA 5GZ3A 1UAGA 1BWSA 3AJRA 3QHAA 5L51A 1F17A 3F9IA 1T1RA 2DU8A 5JFOA 2GN6A 5KNLA 3M2PA 1EEHA 3PHJA 4BNJA 2VYVA 1H93A 4E5YA 5ADHA 4RPKA 3CZRA 4BNWA 1XCBA 5IDYA 1PQWA 5FF9A 1I32A 2FZWA 2J5KA 3D3WB 4IIVA 1Y1PA 2PY6A 1ZW1A 4Y8VA 2NADA 3O26A 4RORA 4OHUA 4BO7A 3U49A 3ZNPA 4CM7A 4BMSA 1P1IA 2PZKA 3IQDB 2I67A 1E5QA 2OHXA 5ITVA 3JQCA 2DLDA 5K6AC 1PGNA 3I9MA 4RJTA 4IQ8A 2GLXA 2NWQA 6ADHA 4JROA 2IXAA 3F1KA 3OEYA 4ZQHA 4E13A 1ZBQA 5BSFA 3GRPA 4IY1A 4CMEC 2R6JA 1L7DA 1DRWA 2O3SA 4IMRA 3ICCA 1A9YA 2NUAA 2GERA 5JE8A 3FNHA 1H2HA 3ASVA 2NACA 1JA9A 4GH5A 2QIOA 2FWMX 1PL6A 1PL7A 1ENPA 3AY6A 3KEOA 3G49A 4A7PA 1AUPA 4GLOA 4J91A 4ZD6A 1QYVA 3OJOA 1U5CA 1Y9AA 1H0KA 3R3SA 2I9PA 3S8MA 3WQQA 4DXHA 1R16A 1R4NA 1G6KA 2NU6B 5I7EA 5JAMA 1HDCA 1YVEI 4D44A 2HKIA 4QO8A 2GR9A 3Q3CA 5IXSA 3ZGYA 2WD7A 5EQDA 2NU7B 3QVWA 4YACA 4IDFA 1RYDA 2OBNA 1FJHA 1LDBA 3KRTA 4MPDA 1I30A 3MJEA 1UH5A 4LRTB 4F46A 2PZJA 1ZK3A 1E1NA 4CV2A 5ENVA 2YHIA 3NT2A 3WQSB 3BXXA 4IUYA 2FPGA 1NVMB 3I9LA 1DC6A 3OA2A 2O48X 4RF4A 5I7VA 2H1SA 2R00C 5C7IO 2WE7A 3DTYA 3FRJA 3OP4A 3RUEA 4U6QA 1W6UA 2NV6A 2C2YA 4MOWA 1EDZA 2AG5A 1PJCA 1JKFA 3ZV6A 3W8FA 5TJ9A 3OQBA 2O3JA 3GC6A 2IEBA 3DWFA 1RYEA 3HUDA 3PZBA 4GWKA 4N54A 1V3TA 4TWRA 3TRIA 1BDMA 2ZJ0A 1CERA 3ZZNA 4BQPA 4XYMA 4MP6A 1B8PA 4BNZA 4AJ2A 3EY4A 1EMDA 4Q3NA 2NTNA 3AY3A 4JJFA 3M1AA 3A28A 4NBVA 5G4KA 5U1PA 1NM5A 2X0RA 1BVUA 4TRRA 1YWGO 2B5WA 3ZHXA 4UREA 1J0XO 4L4SA 4AFNA 2VWGA 4U0JA 4GWGA 1NQTA 3TZKA 2FPIB 4AVYA 3JQ6A 1HL3A 4DMMA 1HSZA 1ENYA 1PS8A 1MFPA 4K6FA 4J2OA 4L4RA 3WFIA 3H8VA 4MVJF 1UDBA 3W4KA 2P9CA 2H6EA 3A14A 4RPGA 4XQCA 1XDWA 2O2YA 4OOFA 4Z9YA 1KEUA 1E3JA 3HE3A 4FIZA 3TFQA 2AQ8A 3NTRA 3DAPA 4WCDA 1NPYA 3KOUA 4YAIA 4IDDA 1N7GA 3P5SA 2VT2A 5I9MA 4DBVO 3ZN2A 2P91A 1LSSA 3D4NA 3DZIA 3QW2A 4RVGA 3OJLA 5JY6A 3VDQA 1U1IA 4LMRA 3FNGA 2P5YA 3Q11A 4CQLA 3O8QA 1U2GA 5EMHA 1T2CA 4DREA 4DQVA 4J7XA 4L4XA 4RPJA 3WYEA 1PTJA 2EW2A 3NDIA 3BTOA 2NTJA 4KUHA 1RPNA 1DRUA 1F0YA 1LEHA 3E5MA 2CZCA 4CMBA 5G0WA 1YB4A 3AI1A 3GNQA 3ONFA 4LCJA 4YJDA 4IM7A 4S3MA 4C7JA 3U5TA 3JD4A 3PYMA 4JBIA 5K9ZA 4CLOB 1R4MA 4OXKA 1EFKA 4RDIA 1DPGA 4J0FA 4HKTA 4YJGB 2XXBA 4K1LA 3QVOA 3DEYX 4E3ZA 4PLCA 2Y68A 2J5QA 2I3GA 3C8MA 4YCAA 1CF2O 3F1LA 1DDOA 2FP4B 3ONDA 4QO7A 5B12A 3BTUA 4WKGA 3U4HA 3OECA 2NVBA 4TRJA 2OBYA 2B0JA 5DCYA 4L76A 3RBXA 4EI2A 1U2DA 1EUDA 3BMQB 3SBOA 1W8DA 1A72A 3T4XA 3UFXB 3UICA 1JN0A 2E48A 2Z1MA 3LF1A 4N5NA 3CIFA 3JTMA 1CQIA 2J6IA 3OIDA 3MWEA 3AI2A 3FD8A 3K8ZA 4OKIA 2QYSA 4E12A 1MG0A 4EEZA 1M2WA 5FYDA 4BOYA 2VUSA 4KDFA 4R16A 4XDYA 3PVZA 5JNLA 4NG5A 3K2BA 5CFZA 1SB9A 1WDLA 2WM3A 2FSVA 3PDJA 1UUFA 1H94A 1TB4A 1R66A 1DJQA 3WB9A 2B83A 3OSUA 2RBEA 4HX5A 4PCVA 1EFLA 3NDJA 3Q2IA 3VH2A 1WP4A 4R69A 1OOEA 1UZMA 3TFOA 1KEVA 1VE9A 4RZHA 3SVTA 5CDUA 1E77A 1MUUA 4XQ9A 1YL5A 2B69A 1YOVB 3TOXA 2WEKA 1GAEO 1ZK1A 3PFWO 3PIIA 1M6HA 1A7AA 2ZB4A 4DLLA 2GCGA 1GTMA 2CUKA 4BO9A 4AJ1A 1VJ0A 4GPD1 3LT2A 3BTVA 4HFNA 3LDHA 3WIDA 5GMOA 5ER9A 5C7LO 4IINA 4B4WA 1KC1A 1J4AA 3H2ZA 1LLUA 3U3XA 4U6SA 3U9LA 3EHEA 1E6EA 5K6AA 1Z82A 2VYVD 4I5GA 4CLHA 2XXJA 4HXYA 3I4CA 1HZJA 3RUDA 3T7CA 4CMGA 1B14A 2UV8A 4KOAA 2YV1A 4CMEA 1F12A 2FMUA 1GYQA 3ST7A 1DIBA 2OXIA 3DZKA 4OAQA 1X7HA 4DTIA 3AUAA 2CVQA 3BTSA 4A0SA 4E2YA 1NR1A 1ZK4A 2Q1WA 4PLYA 3GT0A 4BKRA 4TRMA 2HJRA 3CEAA 2QW8A 3JQ9C 2BFOA 3D1LA 1IZ0A 3GMSA 5IN5A 3V1TC 1QLHA 1Y8QB 3QWAA 3AU8A 1F8FA 1VKNA 3RU7A 3LT0A 1ZMOA 4OM8A 2X9GA 1IZ9A 4PLFA 3W8EA 4BO2A 2DBZA 1DHTA 4BB5A 1P1KA 1T2FA 3AU9A 3L4BC 5CDYA 4PN3A 3D3WA 1LSJA 5THKA 3MTGA 4H15A 3K30A 1SCUA 1SC6A 3PJDA 1U4SA 4GI2A 2R00A 1DOHA 2VUUA 4JXKA 3TZHA 1Q7BA 1WVGA 3M1LA 3Q2KA 2C0CA 4UUOA 4WASA 4WLNA 3I9KA 8ADHA 1E6WA 4FOOA 1PJ3A 3DHYA 2HMTA 5KKCA 4LISA 3RKRA 1T4BA 1RJWA 1JWBB 3CPSA 3VAZA 3GPDG 3L6EA 4BGVA 1SBYA 3RAJA 1NVGA 1IPFA 2WD8A 4KTVE 4ALNA 1FDVA 4J9UE 3EW7A 1WLYA 1SPXA 1XWFA 4IDBA 3D64A 3PZRA 3WDSA 3D5TA 3QVSA 5L4SA 4NBRA 1X7DA 4GGPA 1Q1NA 1PGOA 4YJFB 3L4SO 2Y0DA 4FR5A 4J0EA 3CXRA 4MP8A 1I2BA 4C7KA 4WJZA 1F06A 3H7AA 2QHXA 1OI7A 1PJ4A 2VZ0A 1H2BA 3ITKA 4ZICA 4RF5A 2NU6A 3A06A 3UCFA 2IE0A 3E6AA 2NU7A 1C3VA 4FBGA 1WDKA 4L9RA 3EDMA 1EE9A 3KXDA 3JQ8B 3N7UA 5G0SA 1N92A 1YRLA 2VZ9A 4GSKA 5DCWA 3DB2A 3MOIA 5JMPA 3NEPX 1W0CA 2PWZA 3IKTA 1LLDA 2BFPA 3RWBA 1K2WA 3O38A 4Q3EA 5TIIA 2GGSA 3I1JA 3DOJA 4YVFA 1HDYA 3F4BA 1S6YA 3LU1A 3MTJA 1AHHA 4YT5A 3FN4A 2J3KA 3SLKA 3ROMA 2YDYA 1KC3A 4XKJA 4UEOA 4B4OA 4XCVA 2Q50A 5BNIA 2DUWA 3R1IA 1IE3A 3KUXA 3BMNA 4M49A 2J3HA 1OFGA 2HK8A 5AVOA 1CETA 4FSHA 3JV7A 4L74A 1BGVA 1PL8A 1LU9A 3AI3A 1MLDA 2E37A 3IAHA 3ENKA 4W9NC 3FCOA 4J4TA 2AEMA 3H5AA 2B5VA 1Q7GA 2FZEA 1X13A 1T1SA 5A03A 4EUHA 2HDHA 1C1DB 3C7AA 5AXCA 4OOEA 3E48A 1H6AA 4BNUA 3PDUA 1BXKA 2JAHA 2POQX 2NSDA 1BVRA 2BMAA 3VHRA 4PG5A 1P74A 4JN6B 2AEJA 4BQRA 1PR3A 4BL5A 5JSFA 1VI2A 4UUPA 5DN9A 1HDOA 2EW8A 3ZDFA 1EQUA 1D7OA 4LSMA 2I65A 5FI5A 2GN8A 2ZYGA 2ZB3A 4O63O 4NFSA 1GADO 2VHYA 4WCFB 1E3WA 1JW9B 3PTZA 3E9QA 1ADFA 2OGUA 1GEEA 2W2KB 1P77A 3UAGA 3KV3O 5COAA 1GPDG 1OBFO 3C24A 1NHWA 1V9LA 3BHMA 2W8ZA 1BMDA 4B7XA 1UJMA 2HU2A 5LCXA 4ND2A 4BNXA 1FF9A 1WXDA 4I9UA 3ADPA 4FS3A 4M87A 2O7QA 3BMCB 2NLOA 3GVCA 1DB3A 3OF2A 1ZXBA 1MFZA 3QQPA 1YGYA 1Y5MA 2NNLD 1HWYA 3WICA 4JP3A 3WWYA 1VLLA 3L9XA 2NQ8A 3DBLB 2O3QA 1M75A 1QYXA 4RVDA 4R68A 3FI9A 1JKJB 1K6IA 2FR1A 4IZIA 2BHLA 3U4CA 2O3RA 3IJPA 3E5RA 1YE3A 1U28A 4R3WA 2X0NA 3RKUA 2YUTA 1GZ6A 3C1TA 1KY5A 1OC4A 5L3ZA 2C7VA 4E21A 4CLOA 3OH8A 4PLTA 4R1TA 2D0IA 4YJGA 1H6DA 5F1KA 4DRYA 2DTEA 4B7CA 3DZHA 1ZSVA 5LDHA 2G5CA 1DHRA 2PD6A 3IMFA 3FPLA 2CSUA 3UGKA 3BHJA 2EG9A 3WR5A 3WS7A 3PFFA 1DIAA 4WEQA 4R5HA 5TLSA 3BMQA 3TL3A 3E8XA 2VWPA 1GCOA 2FSSA 3DHEA 3A1NA 2VYNA 4LW8A 2GUGA 4W7IA 4WOKA 4CMKA 3ULKA 4YRBA 2D5CA 4PG7A 5CDSA 2P2SA 2WYWA 2OZPA 3PK0A 4Q3BA 4W7HA 1I24A 5TT0A 4YPOA 1HEUA 3WMWA 3PQFA 4UEKA 1E7YA 4GX1A 4ND4A 4BNGA 4GX0A 2TMDA 2Q49A 3VVCA 5DBGA 4XX0B 2JD1A 1ORRA 2X8LA 5FI3A 4B8ZA 5C7OO 4FC7A 3JQ9A 2GO1A 2A35A 3NUGA 3RUCA 1KBZA 3K31A 5B1YA 4W99A 1C0KA 3JSAA 1GQYA 3I6IA 4M54A 4NJMA 4UVHA 4LGVA 3S2GA 1B26A 4J16A 3TPCA 4BB6A 1GPJA 1K0UA 1DC3A 3H3JA 4M89A 4Q3AA 1GV0A 1E7QA 4CM1A 1X1EA 4TKMA 4TMFA 5H82A 2IYOA 4XJSA 4F3YA 4IDGA 3L4BA 2NVUA 3FWNA 3JQAB 4TKLA 5AYVA 4MVJG 1XA0A 1TI7A 1T24A 1IYZA 4YB8A 2OFPA 1KS9A 2AQIA 3GZNB 1B16A 3N74A 4XYBA 3IDSA 1NX6A 3VC7A 4CUJA 1H5QA 4PG6A 1LDEA 4UUMA 4MKXA 2DUUA 4D3DA 5JAIA 1M76A 2OP0A 5JPIA 4N7RA 1K3TA 3GG2A 3L6DA 5G2OA 5KVQA 1P44A 2Y1EA 3I3OA 1W73A 2O3TA 1PEDA 1LRKA 4BO5A 5AXBA 4G65A 1E3SA 4XR4A 2Z95A 2ZYDA 2C5AA 2QYTA 4U0KA 4RVSA 3RUFA 3WLEA 5JC8A 4ZVVA 2E82A 2G17A 2CFCA 1RM4A 2YHUA 4CM9A 4PLPA 2J3IA 4A10A 3FF4A 3RBZA 1Y8QA 3LC1O 4GKVA 3UXYA 1PR9A 4BHTA 2I66A 4KDEA 3H4VA 1I10A 4IZHA 3RVDA 1ADCA 2EGHA 3KEQA 1PJBA 2VT3A 4NQZA 2Q45A 1CIVA 3ON5A 4Y6SA 2J8ZA 5L4LA 1X1TA 1WMBA 3S1LA 5HS6A 2D4AA 4J7UA 2QG4A 4CJXA 3RI3A 1N9GB 1XIVA 4TVBA 2F1KA 1FDUA 1LRLA 1HE4A 3EYWA 1HDRA 2HUNA 3GH3A 4P38A 3PQEA 4BS9A 4DPMA 3MCVA 3SX2A 1YQGA 4L0QA 4DGSA 4R3NA 1IULA 5A9RA 2AG8A 1LBEA 2XAAA 5THQA 4W4TA 1ISIA 1TT5B 2NM0A 4GX5A 3BMOB 1P1RA 4YYZA 5JCJA 3DBRB 4CQMB 4RL6A 3A4VA 4B4VA 3DZGA 1DIRA 1MA0A 2QX7A 5DCUA 1HT0A 3CINA 1GV1A 1NVTA 4ND1A 2ZB7A 5G4LA 3GVHA 2FPPB 4D43A 1LNQA 1R12A 1RWBA 3DMYA 2VOJA 4YJFA 1U4OA 3DZBA 1D1TA 2YFQA 5EIOA 4W9NA 5I8WA 3INTA 1WPQA 3WJAA 4D3FA 1KVTA 1NWHA 3WJ7A 3JQFC 3WOHA 2DKNA 3UOGA 4H7PA 4BO8A 5T67A 2Q1SA 2ZKLA 1PGJA 2Q99A 4OGWA 3O9ZA 4YT4A 3RC2A 3QJ5A 5I7FA 4J4HA 3JQ8A 4TSKA 1ULSA 1EBFA 5TGDA 1Z73A 2X5KO 3DMTC 4AJJA 2G82A 5JBIA 3E82A 1PX0A 3TZCA 3ZU3A 4ZHSA 1RKXA 1ULUA 3MJSA 1O6ZA 4KUGA 3GGGA 4RVUA 2Y93A 5EJ2A 3EMKA 1BXGB 4JJGA 4Z6KA 4IJUA 4DLAA 2PGLA 5KJ1A 2A4KA 5DOVA 1NBOA 1ZSYA 4IXTA 1QSGA 2UAGA 3OEWA 4AJIA 1XKQA 1DFHA 1F14A 1KVRA 1P0FA 1Q0QA 2DTXA 2VZ8A 2AMFA 2PKQP 4CR6A 4R1UA 4RZIA 2A9FA 1K6XA 2PGJA 2BGLA 4CM6A 3VH1A 3QVTA 2Q4EA 3WFJA 1ZKMA 1EZ4A 4R41A 3AM4A 4UAGA 5DF1A 2PR2A 3GNSA 1LDGA 1DFIA 2BI7A 1XYGA 1F8GA 4YJHB 5L40A 3KB6A 3VZSA 4CM8B 4E5MA 3D4OA 2C5EA 4XQEA 4AL4A 4AJLA 1XQ6A 5DDIP 1MX3A 1JLLA 4C4OA 2Y0CA 1XU9A 2NU8B 3GN2A 3WGZA 3HDHA 3DTTA 3GLQA 2O50A 3MJ4A 1P45A 3AOEC 1X15A 5KOIA 3S55A 1DIGA 1B0AA 2VHWA 3AM3A 2PD4A 1UP7A 2VWQA 3PP8A 4BUCA 3JQGB 1GZ3A 3JQDA 3MJCA 2VHVA 3W6UA 4GVLA 5A04A 2CNBA 3C85A 5AOVA 1VJ1A 1ZFNA 5KJ6A 1C0IA 3UF0A 5KVSA 3JQ7A 4TROA 4OQYA 3G1TA 3D5QA 3FWZA 4DPLA 3G79A 2W2KA 2PLAA 3ZNNA 1XHLA 4FD3A 5KVVA 2ZTUA 4J2HA 4K26A 2EXXA 3NAQA 1WZEA 3TOZA 1SOVA 4HFRA 1S7CA 3HN7A 4ALIA 1TXGA 4Q3DA 4FFMA 4ZQFA 1IOLA 4WECA 3JD0A 1D1SA 5JS6A 2GNAA 3D3EA 5A5FA 4A73A 2UUOA 3ETGA 2UVDA 1GQ2A 2VYND 3EVTA 3I52A 3FR7A 1WNTA 3W6ZA 4DWVA 2X0IA 3JYPA 2OO5A 2C29D 2CDBA 3WQRA 3W8DA 1Q0HA 2SCUB 3AWDA 4R4JA 4FFNA 3WGOA 3Q0EA 1Y81A 3EZLA 3EVNA 3GUCA 4M55A 1JKJA 1T4DA 4U7WA 1Z7BA 3LC7O 4ZQGA 3SC6A 4EBFA 9LDBA 5BSEA 3NGXA 2VUTA 4Y67A 5C5IA 2GD1O 3INGA 4EJ0A 2QQ5A 3KSDO 2DC1A 2CVZA 1PJQA 5BNFA 5TT1A 5A06A 3T7EA 3WBBA 1NASA 1Z6ZA 2AXQA 3L6OO 2Q4BA 4UUNA 3R6DA 5DBFA 4I8XA 1QP8A 3JYQA 4URFA 4OSPA 1PGPA 4ONEA 1UZLA 3Q1LA 4D79A 4XR9A 4KZPA 1LSOA 1LJ8A 1U7HA 5F1PA 2EGGA 4BV9A 2EV9A 4O0LA 5A9SB 2Z5LA 1Q2XA 2JHGA 1ENZA 1B3BA 1BTOA 1Y9EA 3FPCA 3KYDB 4MIEA 4OIMA 4BNTA 1PIWA 1DSSG 1E3IA 3DZJA 4M8SA 4GKBA 2QRJA 3RJ5A 1NFQA 3M6IA 4UVIA 2I99A 2UUPA 1UDAA 1UP4A 3DBHA 1I01A 2BF7A 3T4EA 3MOGA 2V65A 1Q0LA 3CTMA 4J3FA 5FFFA 2H5LA 4WOJA 3MJVA 4E6PA 3O4RA 3SEFA 1ADBA 3ZWCA 1PQUA 4FQ8A 4NBUA 1CQJB 5G0VA 3AUTA 4UEJA 3D0OA 3SLGA 5HS4A 2IODA 2Q1UA 2ZQYA 1GFSA 3FBGA 4HFJA 1CYDA 3PJEA 4XGNA 5DZSA 2GASA 4I5DA 4BIIA 3F46A 3I23A 4KQWA 4Z0TA 1DIHA 4CM9D 4CLRA 2GPTA 2D8AA 4IDAA 5I7SA 1NAHA 3HDJA 3JQAA 3WYCA 4XRRA 1ZMTA 4B8WA 1B3RA 1U8XX 2I3AA 2ZCUA 1FK8A 2H63A 3RD5A 5ILOA 1VC2A 2HRBA 3MWDA 2B35A 3GZNA 2EP7A 3PEFA 5KWEA 1ML3A 4CLEA 2YZ7A 3U09A 3V2GA 4RF2A 1PS9A 1KVSA 4PLGA 4E5NA 1R0LA 1YQDA 2X58A 2QRLA 1N5DA 1GEGA 2PH5A 1NQAO 3PHIA 2Y1FA 1R0SA 4E31A 4DIOA 4BKPA 1PZEA 3R3JA 2G0TA 3QVXA 4IJWA 3IIEA 5CPBA 3EGOA 5BT9A 4MJLA 4EW6A 4HP8A 3TL2A 4OJNA 3HQ4O 1DLJA 1O0SA 2HMSA 5B37A 3WGQA 2VTEA 1MV8A 3JQFA 3R0IA 4BNNA 1GUFA 5JCJD 2ZYAA 2P4HX 1ISJA 2E6UX 2Q2QA 1IY8A 5C37A 4D42A 3QWBA 5LC1A 2PK3A 4XYGA 4IQ0A 1JDJA 1GUZA 1E3EA 4G2NA 4PG8A 2HMWA 1QYWA 1GU7A 3DMTA 1KETA 1Q7CA 1BRMA 3WXBA 4MVJI 5HRUA 1N9GA 5DNAA 3S2EA 3ZHYA 2Y0EA 3GGOA 4L8VA 1ZUD1 2WJPA 3MJTA 4Y6PA 5T57A 4AJEA 5TRTA 1D3AA 1P3DA 1ARZA 2DBQA 3G17A 5BNTA 1U7TA 1VRWA 5T8KC 3ZHBA 4NFHA 4S1VA 1LDMA 3C1AA 5GZ1A 1LDYA 4GAEA 4ILKA 1TT5A 2HK7A 3BMOA 4YAJA 1MB4A 5CEEA 2PZMA 4YRDA 3DBRA 4CQMA 1YJQA 3KYCB 1DAPA 3KSZO 1B8UA 1NXQA 2V7PA 3WGHA 2GZ3A 3CH6A 4HUJA 3UKOA 2E49A 2FPPA 4GGOA 1QRRA 4OH1A 1YBMA 3RUIA 2AE2A 2Y99A 4NMHA 5LDGA 2Y1DA 2GN4A 3STHA 3ANLA 1TLTA 4WLFA 1HE3A 4F6CA 1Y8RB 5CEJA 3CSDA 2A92A 5L4NA 3AOEA 2NVWA 4CMAA 3CE6A 5CP8A 3COSA 3F5QA 1Y5RA 2C82A 2G1UA 3FR8A 3PJGA 2VQ3A 4XB1A 5KTKA 2GN9A 2VCYA 3EAGA 1XELA 4KWIA 4FGSA 3UVEA 4CV0A 4FFPA 2PFGA 1UR5A 3AUUA 4FGWA 4OO3A 1SNYA 5EERA 3RFXA 3VZQA 4JLWA 2PA3A 3AM5A 3NJ4A 4OKNA 4ND3A 5T64A 4CL8A 4Q9NA 4FW8A 1LDNA 3OM9A 3BZUA 2J3JA 3PQDA 4DBZA 3KVOA 2LDXA 2WMDA 5KVCA 3ORFA 1PJ2A 4OSOA 5HA5A 1HDZA 1R6DA 5CG2A 3GEGA 4A26A 1C14A 1K5HA 2PGDA 2B4RO 3ETEA 4GBJA 2JL1A 2J5RA 3TSCA 4U5QA 5CG1A 5BQFA 5AXAA 2V6BA 4DYVA 4HWKA 3NX4A 4CM8A 4O6VA 3WG9A 1YB5A 4IJVA 5TQVA 4QTZA 1NPTO 5EINA 5I9LA 3VDRA 1EUCB 2NQTA 2WD7B 4BO6A 3D4PA 4Q39A 2NU8A 2ZCVA 4EUFA 3UCXA 1UZNA 3OFSA 5TC4A 5JO0A 1X0VA 1C1XB 1VKOA 3TN7A 3U0BA 1X0XA 4D0SA 1UP6A 1PSDA 3GPIA 2Y05A 1B7GO 3GN1A 3LLSA 2YHIB 3QRWA 5ES3A 1X14A 4KTTE 2VN8A 1V0JA 4DA9A 2FPGB 4K28A 1T26A 3I5MA 3CZMA 3JQGA 2D2IA 2FPIA 1YBVA 3KBOA 4PRLA 4ALLA 4BKUA 1VL6A 1U9JA 4ALJA 4GMFA 3ROQA 4XYEA 5IJZA 2YQ5A 3E03A 1RM5A 2ZK7A 1O95A 1OC2A 4MO2A 4DQUA 2AQHA 4FC6A 4UVDA 1K89A 1ISGA 3C7CB 4MP3A 4DMLA 3RSHA 2NU9B 2JKVA 3E18A 2Q2VA 3OJFA 3QV1A 1PU2A 1YL6A 4GLLA 2BFAA 4DL9A 5JAZA 2Y66A 3G1UA 3ITDA 4DVJA 1AE1A 1LQTA 2OP1A 1AN9A 1M6WA 3VH4A 5IXYA 5L7WA 4LVCA 3GGPA 1ZCJA 2E4AA 4NI5A 4CPDA 1FDSA 4R1SA 4AJKA 4CODB 5CPFA 5IFLA 1HDGO 2W90A 3LVFO 1C0LA 1EVJA 2EKLA 2HCTA 2V6GA 3WGTA 3ZWNA 5ICSA 4DLBA 2AHRA 3NV9A 1GD1O 4PZDA 4BO0A 4TVOA 3L9WA 3RUAA 1I33A 4XJTA 2IYPA 4GSLA 1ZO8A 4QEDA 2AQKA 4RPHA 4A27A 4YAKA 1HLPA 4I9HA 1T2EA 1O5IA 1E92A 4WPGA 1XGKA 3GRKA 1MC4A 3I9NA 2C20A 4E33A 5COBA 2IZ1A 3BA1A 1KERA 4JJIA 2RAFA 1G0NA 1WMAA 3LC2O 4FN4A 5COQA 3HB5X 3ETDA 2O23A 3OBBA 3RC7A 3Q9UA 4PGFA 1VPDA 3NT4A 1XQ1A 1AHIA 1AXEA 2BLLA 1JVSA 2O4UX 3JQAD 2FP4A 1D4FA 1LA2A 2YV2A 1UXIA 5T5QA 2CDAA 3D7LA 4B4UA 3KYDA 1FMCA 4TQGA 4NPCA 1PQPA 4CMCA 5EN4A 5TSDA 4E2WA 4ZA2A 3UFXA 1E3LA 3IOYA 1WZIA 4WCFC 4EJMA 3I9OA 1ZK0A 2GZ2A 3LF2A 1DLIA 3PRJA 4BO4A 4CUKA 2Q1TA 2IRWA 3IKVA 4XRGA 4R54A 4Z3DA 3ZNOA 3L77A 1R37A 2P9GA 2RH8A 4Z9XA 5JLAA 5H81A 4MVJM 1LC0A 2DQ4A 2Y1OA 1SMKA 4MVJE 3QWFA 1V35A 1ZIDA 3GEMA 1TEHA 5F5NA 4FJ0A 5IDXA 1P1JA 1BHSA 2AW5A 1E1KA 1H6CA 1KEWA 2D5AA 4R01A 3UCEA 1IPEA 2X1HA 4NNJA 1A71A 1YJ8A 3RIHA 4WLVA 3QLJA 2XF8A 1H9AA 1PZHA 4RPLA 3DHNA 1YBAA 4IGFA 3UH1A 4ZRMA 2ZIZA 1L1FA 3VTFA 2X9NA 2ZATA 2EERA 3PIDA 4KQXA 3PLNA 1N2SA 4RO0A 4WK6A 4ITUA 3HJAA 4MIYA 3H9EO 5FEUA 1EUDB 3PLRA 3PYLA 4QT0A 2IZZA 2Z1NA 1ZZEA 3RC1A 3OHSX 4NH4A 1YOVA 2ZTVA 4GX2A 4J1SA 1HDXA 1CQIB 1LTHR 1YXMA 1CEQA 5B4TA 1V3UA 3K6JA 3MWEB 3GFBA 5T8KA 5JY1A 4II2A 3NRCA 4LCEA 4R5MA 3IP1A 1GDHA 3V8BA 4BVAA 1B8VA 2YV3A 4O1MA 5IAAA 4DUPA 2WYVA 3VVBA 3H65A 4J7CA 5EQFA 1N7HA 2FHSA 1NAIA 1E0DA 3GAFA 1FXSA 3UN1A 3GY0A 2B36A 1YO6A 1NWCA 2DPHA 4R9RA 1EQ2A 3E9MA 3ZWVA 3KO8A 4IDEA 5AXDA 4RVFA 3NJ8A 4MVJA 1O8CA 4XA8A 4K6CA 4CV3A 4CQMD 1I3MA 3A9WA 1O9BA 3WLFA 4BNKA 3AUSA 5K0ZA 4EUEA 1GYPA 3S2IA 3ZI0A 3GHHA 2C2XA 3HG7A 2JHFA 4J49A 4YXFA 4TRNA 4O59O 4AJPA 1JU9A 2DT5A 3K5PA 3QIVA 2C07A 2F00A 5JO9A 4MKZA 3PGXA 1EVIA 3NYWA 4TZTA 5DT9A 2ZTLA 5U4QA 1O94A 2JJYA 1SEVA 3DONA 2XOXA 2YJZA 4YAGA 3ZU5A 5HWSA 1GY8A 5L95A 4R51A 4IIUA 4N5MA 5IZ4A 5A3VA 2Q3EA 3HN2A 3WMXA 5KKAA 3ZWMA 4A2CA 2C7GA 3OIFA 2YY7A 3ZNQA 3WGYA 1VL8A 3QP9A 4E5KA 1YDEA 4AG3A 3DQPA 1TA4A 3RASA 1ZSNA 3INRA 2JD0A 2CF6A 2QZZA 2W2LA 5ICMA 1YDWA 5TNXA 3GVPA 4EITA 3FTNA 3WWZA 1ZJZA 4BV8A 4CR8A 5JCXA 1JAXA 1I8TA 5ITWA 1NYTA 3JYOA 2D3TA 4BGIA 1YB1A 5I8ZA 4L75A 5JAQA 3Q9NA 2XPCA 2HK9A 3IUPA 1EBUA 3K9QO 2WSBA 5T6BA 4P4NA 3V1UA 3PHGA 4B3JA 4ND5A 3TWOA 1UAYA 4OYRA 4OL9A 4OQZA 4PVDA 4WNCA 3V2HA 4O5OA 4CMJA 2BFMA 3WNVA 1XSEA 1ZXLA 1MXHA 3JD3A 1Y8RA 3PWZA 4FJ1A 4F6LA 3DOCA 5GY7A 1H6BA 1KVUA 3FTPA 2CDCA 3FNFA 4RVHA 4QUKA 4ID9A 2IDZA 2VRCA 3ASUA 1GZ4A 3UW3A 1SCUB 4J4BA 5A9TA 4W82A 7ADHA 1P33A 4JIGA 4N18A 2H9IA 5JC1A 1M67A 3QSGA 3B1JA 2P5UA 4GQAA 3JQBC 4YA6A 1MGOA 3HZZA 1ZK2A 2RHRA 3GUYA 4KWHA 4DC0A 5BSGA 3GAZA 4EEXA 4II3A 4OMUA 4BGEA 2PTGA 5JYDA 3ROKA 3E9NA 4AICA 5BR7A 3CKYA 3FHLA 1OZAA 2B4TO 4INAA 4L73A 5I9NA 2HRZA 2O4CA 2VHZA 3KSUA 1QG6A 3W4IA 3KHUA 4RDHA 1MC5A 2Q2WA 3AK4A 5U9CA 3IS3A 4AJ4A 3HDQA 4KP7A 3GVXA 3WSWA 2X5JO 2DTDA 2AA3A 3FBTA 3KLMX 4IPTA 3DFZA 1QLJA 5B4UA 4B79A 5JDIC 3C7DB 4RLHA 1B2LA 4BNVA 3H9UA 2WTBA 4YRAA 2ZTMA 1ZEJA 2WDZA 5HM8A 2EP5A 3W4JA 1CDOA 1DC5A 1EUCA 3PHLA 2VOEA 1K6JA 3OJEA 2JAPA 1YKFA 4IBOA 1I5RA 3AY7A 1KYQA 5F5LA 1EVZA 3B70A 4NJOA 1C1XA 4X54A 3V1YA 4JK3A 2GSDA 1ZNQO 1DBVO 4G5HA 1N1GA 1D8AA 4FDAA 1Y7TA 1DEHA 3WYBA 2X4GA 2DPGA 2RHCA 1C1DA 3HFSA 3NT5A 4YBZA 1KOLA 3HB4X 4H16A 2FRDA 2Y67A 3JQEA 4IJKA 5C3MA 2VTDA 3ZWXA 5J23A 2RCYA 4Y9DA 1QYCA 3RC9A 4GMGA 2BGKA 5JYEA 1YH3A 3X2EA 2OOSA 3SC4A 3BMNB 1ADGA 1QKIA 3P7MA 2NU9A 2BELA 1JTVA 3ROPA 3LT4A 1LX6A 4WCFA 4B7UA 1LLQA 4MVJP 5A5EA 2YYYA 3JYLA 4DIBA 2EKPA 1DAOA 4YR9A 3ZWPA 1WDMA 3LQFA 1LI4A 4J9VA 3PPIA 3QWIA 3VPFA 4BO3A 5IDWA 2OL4A 2QRKA 3OETA 2CD9A 1SOWA 3GHYA 4NHEA 2V6FA 4JP2A 1T2AA 1Z75A 4JBGA 1WWKA 1IUKA 3BMCA 1RM0A 3H3FA 1OMOA 5ENDA 2P4QA 1U3TA 2OMEA 4HADA 4CL3A 4QFCA 2EJVA 4J6FA 2JCYA 2X23A 3GR6A 3SJUA 3DFUA 4JNKA 1XLTA 1QXSA 4P8RA 3DBLA 3S2FA 3G0OA 1VSVA 4RLSA 4I1IA 4P4GA 1HYHA 4BMVA 1I3LA 3VPXA 4NFYA 4IGEA 1CWUA 1N1EA 1E3WB 5A02A 2X9VA 3IP3A 3V2UA 3TQHA 4ZN6A 1HE5A 2HAEA 3M2TA 4WUVA 3IL2A 5ILGA 3DAFA 3UHAA 4ZQEA 4RQUA 2X5OA 1HSOA 3I6QA 1U3UA 3RCBA 2JFFA 3ZWYA 4YEDA 3OJ0A 3NTQA 2ZB8A 1OAAA 2O7SA 4K9DA 1BXZA 3IUSA 1IL0A 1HYGA 1Z74A 3ZWBA 1E7RA 3PHHA 1YL7A 1WW8A 2BD0A 3WTCA 3KZVA 5TS3A 4U8GA 2DAPA 4CV1A 3VPSA 1Y6JA 1DJNA 2CY0A 2EF1A 1ONNA 1NP3A 2D59A 2DBRA 4BMNA 4BNLA 2VRBA 4FFRA 2W4QA 1PZFA 2YW9A 4XX0A 4PFJA 5CAEB 4I5EA 2LDBA 5CHEA 1NFFA 3ZHZA 1PJTA 2I6TA 2JD2A 4MVJD 4E30A 4RF3A 3PYXA 3PWSA 2WE8A 4WNIA 3LYLA 3RU9A 4AJOA 1HF3A 5A4DA 1GYRA 1LQUA 2JFHA 4PG4A 5F3RA 3FNEA 8LDHA 1QMGA 1ZVMA 4Z3KA 2RH4A 1E7SA 1JKIA 5A3JA 1P0CA 2WYUA 3U4IA 5A1TA 6LDHA 4BNMA 4CM4B 2RIRA 1V8BA 1XG5A 3H9JA 1J6UA 3AFNA 2NTVA 4BGUA 3LLVA 1M66A 3PJFA 3O03A 4ALKA 3JYNA 1QYDA 4JBHA 2UYYA 1EK6A 1IHXA 1L7EA 4R9SA 3ZWOA 3OA0A 4YQZA 1BW9B 4IS3A 1FDWA 2IXBA 3GA0A 4UVGA 4NJMB 3DOOA 2W2LD 3DZFA 3X2FA 3DO5A 3MEQA 3GVIA 3GZ4A 2IEDA 3W1VA 1ISFA 4XIJA 2FR8A 1U3WA 4NK5A 4UVEA 5F1OA 1QV6A 3C1OA 2HQ1A 3BAZA 2FR0A 2JFGA 1VJTA 2NVUB 4CMIB 2ILTA 1XEAA 1ENOA 1XU7A 4NR0A 1LXCA 3GOHA 1KVQA 4EYEA 1J49A 2IZ0A 4NZ9A 3RROA 3K73O 4I9NA 1JWAB 3F4LA 3GDOA 4ZGWA 1A7KA 4XB2A 4CM5A 4ESOA 4CMHA 1TT7A 4JCOA 5IDQA 2BRUA 3JQBA 4HNHA 2VWHA 1CJCA 3H2SA 5DP2A 1V3VA 3F47A 3QY9A 3DBVO 1JVBA 3PGJA 5CEFA 1E6UA 4XIYA 1GL3A 3SXPA 3HHPA 3IC5A 3JD2A 2VRCD 4YQYA 3ZV3A 3I83A 1G1AA 2B37A 1E7WA 3CMCO 3JD1A 4D7AA 1U5AA 2A94A 1DRVA 2WWRA 3KYBA 4XGIA 3QA9A 1DC4A 1H9BA 1PJSA 1WAMA 2X86A 1PZGA 3PWKA 5HTOA 4LK3A 4WLEA 5JDIA 2VNSA 4DC1A 5IG2A 3HADA 3H5NA
chains in the Genus database with same CATH superfamily
1EP9A 3V80A 3ZHQA 3M1YA 3TSYA 2I76A 4WESA 1X86B 1YR7A 2G76A 3CUEF 3E3OA 4HQ6A 3K35A 3UWPA 4DCCA 4Z54A 3WIBA 3QWHA 2R4TA 3M6VA 2H85A 3AR3A 4PC1A 2JIOA 4QU9A 4RIHA 4TWAA 2WA2A 1EHIA 4BLVA 2HREA 4ZAYA 3HDGA 1MIOA 2FEAA 5CA1B 4BCBA 1XEWX 4I08A 1HNZB 3O8DA 1OYOA 1SAYA 1HOTA 4RV4A 3C1UA 1KZYC 1U0OC 3HXLA 3I9V6 1GWNA 2VUIB 4S24A 2G70A 2YVKA 4JV5B 3GP8A 2G1AA 3LY8A 3NHMA 1BCRA 5JXIA 5LQJA 1URPA 2V0CA 4JYPA 7MDHA 3QXHA 2V45A 1ESZA 5EJ7A 2ZRJA 2RFLA 1C0PA 4Q1CA 3LH5A 2JGIA 3PGLA 3TTYA 1OHHD 2H2IA 5DGHA 3ZGNA 4QECA 4CKEB 3OPYA 3MW8A 1B0UA 2OHJA 2YQ4A 3LUBA 4IILA 4IXDA 5AIAA 5T4BA 421PA 2FGJA 4MYRA 5KNBH 1LC3A 4MUGA 2JJ1A 2ZUFA 1VGQA 3DW3X 4U7TB 1Z29A 1Q12A 3FDXA 3MLBA 1P7PA 3H1PA 3V33A 8OHMA 4E2XA 1UBLS 1SK9A 2PA0A 3ESZA 1JQ5A 2I6GA 4UTXA 3KETA 5CJPA 4OX9Y 5I47A 3T12A 2AOVA 2NZWA 3HBMA 1EVYA 1N7IA 1ONOA 4L6AA 3N58A 4C76A 1WXIA 2ZRMA 3L7KA 4IHJB 1PWXA 1YDGA 5DPMA 4JC4A 2QDKA 2B0CA 1A3CA 4ENVA 3EZ7A 3BDIA 4DQLA 2CN1A 4QWMA 1IHUA 3G7SA 3T7DA 3CZPA 4JP1A 3QFHA 4MLPA 3UMBA 5BW4A 5F78A 1E20A 3PKIA 1PV4A 1NFRA 1ITZA 1VIDA 3I8OA 1A95A 3RHFA 3IE0A 2IGTA 1MT3A 3B89A 4PAQA 3HR7A 1L7VC 4PYJA 5KX5A 5LKRA 3FUTA 1A9ZA 1CPYA 1MAAA 3KPUA 2UYCA 1T36B 3BIJA 4D8XA 3QY0A 2VKQA 2WSSD 3U3DA 3DOIA 4FCWA 1HLFA 4OYYA 1MP0A 4J1TA 1E5LA 4AJHA 1V6AA 4LZAA 3K8YA 2WWYA 2A7QA 2YC2C 3QPAA 2K4MA 1EE2A 5G40A 5BXQC 2QN6A 1FJ2A 1E2BA 1E0KA 2ZI3A 3L79A 2D0PB 4YI5A 2FWNA 2H2DA 2X0JA 4UAUA 5HF5A 3S8EA 2GYYA 2JCXA 2HMVA 4NBKA 5DLYA 3M0EA 3ZD9A 3E9EA 5IN4A 1JEQB 4LWPA 4WLOA 1H9CA 1JXOA 4XZ3A 2QQGA 2F9FA 1C9MA 2GPNA 2XF2A 1ACJA 1JMYA 1UXJA 2X22A 4R40A 4Z7OB 2Q46A 4AZWA 3JCZA 2GAJA 4NEHB 5JWOA 2ARKA 4DM3A 4RK6A 1SO8A 3T94A 5CCEA 3TF5A 3IVAA 3PDWA 1ZEMA 4NLLA 4P22A 1IVSA 4HLDA 3GL9A 4KQJA 1Z12A 1SA0B 1CUIA 4IOMA 4LPKA 5AKZA 4HNUA 4MB2A 3ZWAA 4Q1DA 2ZSJA 4DABA 2DBVO 4XPIB 5EJIA 1I1OA 4B2PA 3ANNA 4ZV4A 3GIWA 3DVAA 4EPYA 5KU1A 4Z0HO 1W5TA 4G4IA 1FP4B 1R15A 5HJ7A 3FSRA 4RFVA 5TMDA 3I5YA 1ECGA 3TLCA 5B4VA 3TNDA 1U3VA 1HKUA 3ZHTA 1YS4A 2RONA 4CL2A 3N05A 4H4EA 3AKCA 4KG7A 2QP9X 1D2CA 3FWKA 3ROTA 5HRAA 5TMPA 3FVWA 1FFGA 1T25A 2G9NA 3D3JA 2Y1GA 2VHEA 2IYLD 4EPVA 4AF6A 4J0JA 2AFHB 1AXGA 2SCUA 4G0NA 5CVCA 1EYZA 4MUEA 1SBIA 2X3UA 2F1IA 3Q6IA 5DX0A 1UXOA 3EULA 5ADUS 3C3WA 3G0BA 5CB0A 1EBBA 2ZAOA 4EJSC 1R27A 1ABEA 2BVNA 4JWKA 5AM4A 2JJ2D 2PN1A 4RZSA 3HO8A 1LTKA 5BN4B 4EENA 1BG6A 2ZULA 1KMHA 1QV7A 1NVDA 1Z4JA 2HB6A 5HEKA 2EGUA 4N40A 3PQCA 1ZONA 2XCRB 1N5RA 3I8SA 1DDGA 5J4KA 4HLQB 2L18A 5H68A 4JYZA 1QHIA 3HBFA 4RTRA 3GK3A 4Q4AA 3P4UA 1VPTA 3ICOA 1AB6A 2GTHA 5LJLA 5KMGA 2R6R1 3VHLB 1CDZA 3K9WA 2G7MC 3W6OA 2CMKA 4XWGA 1SUEA 3U7QA 2FOIA 3B1KA 3RFVA 2B92A 2WJVA 1YQXA 2GRJA 4FYHA 5DBEX 2PZGA 1DQZA 4IXWA 1IDN1 1M8JA 1V25A 1K5GA 1W34A 2V58A 4LUCA 4RLFA 5DULA 1JH9A 3MMZA 3ZKWB 4P0PB 3OQ6A 2HSEA 3F7OA 3ZWWA 1GFIA 2WFLB 3OOSA 3KT8A 4J2TA 3TZLA 2YICA 3LUFA 2BZGA 3TRJA 4AKSA 3A3KA 1E32A 1F4LA 3FMIA 2I8CA 2YXEA 2ZOSA 3TEMA 2QMEA 5CAEA 4JXXA 2P68A 1C1HA 1WUJS 1UMDA 1XEXB 1W0KA 1Y5LA 2BI8A 2ST1A 3OIVA 4DCGA 1XCMA 2V9CA 1UT6A 3I39X 1CS0A 3EK2A 4MWGA 4RY0A 5TX7A 4UU8A 5DLEA 2EWVA 4NARA 4PAMA 1D5WA 2ZQZA 3BD6A 4PCLA 4LA4A 3IDFA 3MT9A 1VXRA 1G9XA 3LT1A 4D45A 4HFMA 5LYJB 1PWYE 1R9GA 3JWPA 3NWPA 5GONA 4E5KA 2OD2A 2G3YA 5TJHA 2FUNB 3VZRA 3S44A 5BVHB 5CFNA 5JXWA 1XZDA 4XWWA 3L8DA 1QQ7A 4RHFA 5T3YA 1R0BA 1JIKA 1QR6A 1WMSA 4MHSA 3NGMA 3V4VB 4YCNA 2WAXA 4GXRA 1G8JA 1BSVA 1QNLA 2IZ7A 2WINI 3QELA 3WLJA 1I0IA 1Z6TA 3GCWA 4TXMA 3VPGA 2F8SA 3ZIUA 1I9CA 1IHDA 1JQBA 4JLKA 3QLTA 1P91A 4MEJA 5E1BA 4O5AA 3DC2A 1K4YA 1H1LA 3ONEA 4GM4A 1MA3A 3TW6A 3C5WP 2D1YA 2GH1A 3OM8A 3NTOA 2ZJ1A 3KLPX 2QVZX 4PWZA 5TGTA 3BF7A 4TZKA 3F3SA 1ZCAA 3AETA 1BW9A 2CV0A 4IS2A 4P34A 2LGJA 4QPCA 4FE7A 4BNYA 2XMZA 3EF0A 1I2ZA 2WHEA 5TF4A 3A6KA 3B51X 2OHVA 3KVRA 3MWYW 2HMUA 1Z7EA 3QJYA 1UC4B 2AE1A 2JZCA 1QTIA 2AGVA 2YDXA 4CLDA 4TXJA 3B2EA 2QL7A 4XDZA 2AWNA 4LN1A 3VKVA 3VZPA 4D8UA 3VKFA 4CTMA 2W58A 5JMWA 2EIHA 1NOJA 4BNHA 2QRHA 4HY3A 1RXWA 4CLRB 1WABA 2YFHA 1WUKS 2P9EA 1GL9B 4PZCA 5JMOA 1U2SA 2YIJA 5DGIA 1V9SA 5EPOA 4YRGA 1MTOA 1UDXA 1VL1A 2VH1A 1JHDA 3OHMA 3M3HA 1CZNA 1XVUA 3JRNA 4O2BA 1X7GA 2P8JA 5CDGA 2FEMA 5CJJA 4I9GA 3MWDB 4QTTB 4ADSG 1VSUA 1KIFA 1Q91A 1RW4A 1WW3A 4PR0A 4ZO9A 4YTEA 3SZOA 5HGJA 4G4GA 1LBIA 4RW0A 1P2UA 4B6RA 2P1DA 3PD1A 2F4NA 3P2YA 1II0A 2G07A 5DP1A 4YT8A 3DE3X 5KJEA 5BQ3A 1NN0A 1ONBA 2JGEA 4RKYA 3HZOA 1BDBA 2MYNA 1M34E 2BBSA 4LV6A 4RFSB 3MC1A 2B5OA 4G24A 1OT3A 1RM3A 4QOFA 4ENWA 4KMOA 4KJZA 1SXIA 3H9QA 3L07A 4JS0A 1YFZA 3M4YA 4D41A 1IXSB 2YW2A 2ZRHA 2CMDA 3ZU2A 4ZMBA 3IQGX 2ZYVX 4NU6A 4D8YA 2ZRKA 5L7TA 1LK7A 1ZGJA 4R0VA 3KT0A 5IWAB 1YFLA 1JBKA 3E84A 5EKXA 2UXCB 3PUVA 5HCNA 3STVA 1YU6A 2HFJA 1T9DA 2P7IA 2RIPA 1EWYA 2XE7A 1EM8A 2C97A 2C2KA 1T6YA 1DBIA 3ELWA 2R6HA 1T9AA 3KG2A 3KYCA 1KDVA 1N3BA 4EKYA 4D3XA 4EFLA 1LKZA 1R8YA 3RTEA 3TIFA 3GBSA 2GJAA 4EGFA 4C6TB 5IZCA 4OQPA 3NONA 4Q05A 4BZWA 4BLPA 1OXSC 4RXUA 5AICA 3EPHA 4JOSA 3GLSA 3MD9A 2VFAA 2JEOA 4E11A 4Z1MD 4CIBA 2WJGA 4TN5A 4PYLA 3WDLA 2Q4RA 5LMCA 4AJNA 1TO6A 5L9AA 1PR1A 3MQ4A 5EP4A 1QRSA 3C3XA 3SXJA 1NMQA 2EOAA 1E9CA 2CL6X 3FCAA 1HNWB 1FTYA 3B1XA 4R6WA 1PTKA 3AJRA 5EWLA 5L51A 5DK6A 4GQIA 1DJPA 1T1RA 2DU8A 1BN7A 3GFOA 3IUNA 4YROA 1TCAA 3GELA 4RC9A 4BFXA 1DKNA 1T4CB 3INYA 5HX7A 2ZANA 2NO9A 3EPPA 5ECYA 3CZRA 5ADHA 1XCBA 1L4BA 2VC2B 4FHGA 3D3WB 4IIVA 2FZGA 1Y1PA 3AQ4A 1MNAA 1ZW1A 3AC0A 3K0HA 2PRYA 4KX5A 4V3BA 1EWVA 3QLVA 4F38A 4MQUA 4OHUA 1GNQA 4BO7A 3QFCA 5FRDA 4CM7A 3GLIE 4HEQA 3PNYA 5FIUA 2P62A 2IIVA 1UPCA 1P1IA 2VNHA 2ZGVA 5ALWA 3UMSA 1E5QA 5ITVA 2DLDA 1OKKD 3EHDA 1RXVA 1EA5A 3SIPA 4NFLA 1KIAA 2FZ5A 1NY5A 4L95C 5CBKA 2KHZA 4ZQHA 4UQPA 3K70B 5LKAA 1UT8A 1DRWA 1V26A 3ZDZB 1RLTA 3GRFA 4P93A 1SIBE 3ICCA 5BWLA 3VO8A 2GERA 1K0FA 5JE8A 4BX2A 4NAUA 2EZ4A 1QVVA 2R4QA 3HP4A 3MRSA 5HF9A 2HDNB 2PM8A 4DDMA 4RUKA 1I6LA 3IOBA 1PHRA 4X3PA 4AF7A 1YFKA 3GV0A 5BT8A 3ZK8A 2AS0A 2XA9A 1F5NA 1QHYA 4F4FA 3HRKA 4ZD6A 4JI6B 1QYVA 3OJOA 1U5CA 5FADA 4UMFA 1UK7A 2I9PA 3S8MA 4BFSA 2VTBA 1ZRNA 3I2IA 4XASA 4DXHA 4B7ZA 2RSLA 4CHGA 5FBVB 5I7EA 2LR0A 2HLDA 3WKCA 5ICCA 2P6RA 3QMMA 2WD7A 5EQDA 5DTEA 3C3PA 3VU0A 1TCBA 5HIJA 4ZHQF 4RQAA 5AVXA 1T6ZA 1XCOA 3QIAA 4DNXA 4LRTB 3QH4A 3V7NA 2BKLA 5F52A 1E1NA 3N8NA 3S8YA 4KO2S 1R9JA 5ENVA 2YHIA 1ZQ1A 2GEKA 4IX1A 3MWJA 5BW6B 1L2TA 1NQXA 1T2NA 3CGWA 1YMQA 4M53A 2YXNA 1NVMB 2P9BA 3EGDA 4NOJA 3N0WA 4DCPA 1MGPA 1DJMA 2C8JA 2QVCA 4ZVLA 3CN7A 5CITA 4U6QA 4DIUA 1Y8AA 5A4AA 3F73A 1N6KA 2PX2A 2Q4DA 1EDZA 1BHO1 2GSWA 3NBYC 2AG5A 1OQAA 3O83A 3O8NA 1CHNA 4IICA 4LIPD 4NYJQ 2OECA 1EFTA 4LGMA 4LF8B 4LKOA 3H0KA 3UYKA 2IT1A 2IUUA 1EK2A 3LIPA 4G67A 3DWFA 4A6PA 1IOZA 2ZJ0A 3CNEA 3EXHB 4U3JA 1ZPDA 4BQPA 3WLTA 2G63A 3LP5A 2NPIA 4XYMA 2QTVB 4MP6A 2BGJA 3RG2A 3C3BA 4QSHA 3UATA 1EMDA 2NUTB 4MUNA 4Q3NA 3AY3A 3DE2X 1G3UA 3M1AA 4NENA 3CVUA 1RYFA 1NM5A 4TRRA 3WMEA 4YMHA 4ZTBA 1Q50A 2B5WA 1YS2X 2EJBA 2BGIA 1S9DA 1L7NA 4AFNA 1RQGA 3PF9A 4GWGA 3TZKA 2ZS8A 1WKBA 3KPWA 1HSZA 1JEOA 4BFTA 3B3QA 1FUIA 2COEA 3CIOA 3UJPA 2VTVA 2GEVA 3O4HA 4J2OA 5LLTA 2GWHA 3OQIB 4MVJF 4CKWB 4D9BA 2CVHA 4EVQA 2ODNA 4OATA 4NYIR 5DLPA 5KNCA 1TYCA 2AX3A 2BY4A 2P9CA 3A14A 4XQCA 1E98A 2O2YA 3S7TA 3ZD6A 5BV1A 2LKDA 2VQEB 4DB2A 3K9BA 2HJ9A 4Z9YA 1CYEA 3FNQA 4LGCA 4WI1A 2YNMD 3LUKA 1H0RA 1MPTA 2IL1A 2RGAA 2VT2A 2WKRA 2XVMA 3GLFA 1HOXA 1F7UA 3ZN2A 1NVWQ 1EIWA 1W9HA 1TCVA 5DHRA 3QW2A 1EFRA 4RABA 1P7ZA 1P4AA 3LOUA 2W6IA 4RVGA 3OJLA 3RABA 1LBSA 1TNDA 1A97A 5JY6A 2B4YA 5C1IA 4Y6GB 1U1IA 3VDQA 3FNGA 2P5YA 2PTHA 1ZL2A 3QGMA 3LMKA 2ONYA 3QU7A 1Y0BA 3HJBA 3O8QA 4PZUA 4QYXA 5HF8A 3RWOA 4FNOA 5M2QA 2XGJA 4B3DA 2GM5A 1ZHHA 2SKCA 2V7TA 2FEWB 1KAOA 5T3UA 3WYEA 2EW2A 2QN1A 3L43A 1W4BA 3SPXA 1JG3A 4TS4A 1FFCA 1JLSA 3O3CA 1YVRA 4QUAA 1CUUA 3OE5A 4JODA 4IDOA 3OOYA 3RVLA 1WKVA 2CEAA 1SUFA 1Z2PX 2BM0A 1LPBB 2GZDA 2ZTHA 1JH8A 3C3CA 4GXTA 4HYTA 3DO6A 5G0WA 2VJPA 3HXOA 2RCNA 4KRGA 3IIJA 4YJDA 4MVXA 4UXIA 4AWBA 5CFPA 1N3IA 2CZGA 1MJ5A 3NLLA 2ADFA 3CUTA 3PYMA 5B2EA 4G01B 4CIAA 1MJFA 4WVFA 1PFVA 4OXKA 3SZ3A 2C2BA 4HKTA 1B0PA 3HYNA 2RHLA 3HSYA 4EFKA 2IIBA 4FINA 1J7KA 3DCNA 3DTVB 3DEYX 4K1LA 1UQUA 4PLCA 4IFEA 4JMLA 4REMA 1VYUA 3SHQA 1DDOA 4QO7A 4KVFA 4Y2PA 5EIFA 5ESXA 5KBYA 1ZC3A 4WKGA 3U4HA 1ZM9A 4Y2UA 2NVBA 2Q28A 4TV9B 3RBXA 4EI2A 3V7FA 1U2DA 1EUDA 4FDLA 4G4SO 2Z0MA 3UFXB 3A6LA 3UICA 4LOLA 4N5NA 2O1WA 5HJ5A 4ECAA 4MPJA 5EIBD 5GM1A 1SM4A 1L1RA 4PTYA 5EGNA 7GPBA 2J6IA 4C4PA 2DJ5A 3IH5A 3EE6A 3KQMA 3A6GA 3CEJA 4WBXC 4Z9BA 4EF6A 1Z4LA 4L3VA 1VHWA 3AF2A 3L01A 3OTQA 3ZWQA 2HPZA 2GJKA 4KQHA 2CYCA 5FYDA 2XNDD 1I5OA 2VUSA 3K4HA 4R16A 4UU7A 2ZBGA 4WL0A 1E2GA 1LK5A 3C6ZA 3EEQA 3PVZA 4DM7A 1BDIA 2P40A 3K2BA 5TQJA 4E3WA 4IJ6A 4I1UA 1N6HA 1UIMA 1ZGHA 3H2GA 1R66A 3X2FA 4MZXA 3QFFA 1P62B 2OCXA 1FUYB 1ULBA 3R5FA 5B7QA 3GJZA 4PCVA 3DJYA 4BVJA 4RTNA 1M33A 2F1RA 2VAPA 3E53A 4F3CA 2FW8A 2WSMA 4OHPA 3U80A 3SVTA 2JNWA 1MUUA 4ECEA 1QQBA 1YL5A 1L5RA 2WEKA 4E1VA 3VR5H 3RREA 3E7FA 2C95A 16PKA 4D9IA 2G28A 1RI5A 2I0FA 6GPBA 1A7AA 5HKLA 4DLLA 1ZI6A 5CEEA 2VJMA 1GU0A 5FPQA 5IEJA 1V1RA 3LT2A 4JX9A 3LDHA 1ZZGA 4YUZA 1LWNA 2QKYA 4A82A 3IKLA 3CS3A 3R7AA 2AD5A 1TTQB 1C7FA 3L92A 2WJAA 1G16A 1XXLA 1OWPA 1GPYA 4WK2B 5FHRA 4MW1A 3W90A 1J4AA 3TGLA 4HN2A 5K20A 1LLUA 1XKTA 4U6SA 3U9LA 4JJEA 4G5SA 5K6AA 1W76A 1YKSA 2VYVD 1OAOC 5IT4A 2WT4A 2XXJA 2F2TA 3I4CA 2NXEA 4WDQA 4P7BA 5A3SA 3RUDA 3T5TA 3PXEA 5JRDS 1DCKA 1FPMA 2AR0A 4KOAA 4E5SA 5ITZB 4CMEA 3K6KA 1F12A 1GG5A 3PC6A 2XVYA 3AKDA 5DHUA 5JZVA 1J2UA 1GYQA 2HEIA 3DV2A 4U6NA 3DO8A 1W5BA 2ZJ5A 3EIUA 1DIBA 3LX8A 3PDIA 3SC2B 2CFOA 1A7JA 4RK0A 1D7AA 2H2FA 4E2YA 3PC4A 1UOQA 5GPBA 2AT1A 5HP4A 3LUHA 2BUCA 3UAVA 9GPBA 2YWCA 3GT0A 3F8SA 1L7BA 4LJ7A 3JWGA 3D1LA 4BEWA 3GMSA 4LTDA 4UZSA 4W5OA 1SD1A 3AU8A 1F8FA 2Z2XA 2Z1DA 3NVKI 5TQ2A 3SQNA 4EHJA 1KFJB 1Z13A 2Z4TA 4XUCA 2ZKIA 4PLFA 4TKZA 2WHPB 4BRUA 2J3EA 4EKIA 1JJ7A 3RGWS 2G4LA 4MRMB 2DCMA 4RNDB 3BILA 3PNPA 1T2FA 2ADOA 4BBZA 1ISRA 1FX0B 2FDRA 4BFYA 1HG0A 5CM9C 3EWIA 3VPAA 3MTGA 4QG7A 4IO0A 3VV3A 4AZ3A 4PO9A 5B57C 3QHPA 4AX8A 4J0QA 4QU8A 5AI9A 2R44A 2BR4A 4EG8A 4X7RA 3REQA 1DC7A 5FTKA 1NU8A 5L3RA 5K8UA 2RI6A 1YR8A 2D13A 1SKYE 1HO3A 1TJYA 3DNPA 2C0CA 4HATA 4Q93A 1H05A 2YINC 3K0AB 4WLNA 4O4LA 1E6WA 4BQNA 4CG0A 3VNBA 2JIZA 4DR6B 2EKZA 4GT1A 3ROZA 1ZAYA 1TYBE 1Z28A 2DR0A 1JWBB 3CPSA 4KYIB 4KXNA 2BT4A 3GPDG 4AY4A 4KACA 4YY3B 2X9QA 4I4IA 2ODPA 3AJ9A 4YUWA 3QE0A 1T1JA 5KOHB 3WZ2A 1XWFA 5CB4B 4C2UA 5MF6A 3D5TA 2ECKA 1WUHS 2O6HA 3C6MA 4NBRA 3TLGB 1T5DX 4MUFA 4YJFB 1ABFA 4ZZIA 3IP9A 3QVVA 4RD0A 4E08A 3F96A 4MP8A 5F7JA 5EWMA 2W37A 3JVDA 5BSUA 2ODEA 2H3HA 4CKXA 1TUBA 2A84A 2GDJA 1PBTA 3H7AA 2J87A 4P84A 5ECWA 3LE8A 1OI7A 4LXQA 2QR5A 1YZYA 2VZ0A 2XGGA 1NDHA 1IIBA 1IXRC 2V8OA 2RD2A 1YACA 4IXMA 4RF5A 2NU6A 5JD5A 2VF7A 1UPFA 2VPQA 3UCFA 3TPZA 3PNSA 4N1AA 1L7OA 4GMXA 4FBGA 1Z5NA 4HN9A 3CF6R 5LUAA 4F5WA 2J6CA 1CJUC 1P7YA 1XF1A 1JYFA 3JATA 1BD3A 3R8XA 4HQFA 2E5FA 5G0SA 2IH4A 4M7RA 2VZ9A 3UJ9A 2BOVA 4GSKA 5DCWA 5GTDA 3DB2A 2V4MA 1KJWA 2Y0PA 1YSCA 4I3HA 3IKTA 3E9RA 2BFPA 2PANA 3UAOA 1RAHA 1K2WA 3O38A 2FHPA 3UJHA 1AO0A 2OFXA 1VECA 4YJ3F 2UU9B 1E9VA 2BMDA 2EFHB 5C1OA 1DPFA 5JARA 1YVDA 3I2KA 3I72A 1AKUA 4CTNA 5BR8B 3DOJA 4YVFA 1JJVA 5BW5A 1S6YA 1AOXA 3JALB 1OI4A 2BMEA 4GQBA 1QP0A 3F2IA 2VCHA 1JDNA 1QGOA 4JT9A 4YP0A 4YT5A 1RNLA 5K0BA 2XZLA 3ROMA 1CDEA 4KNWA 4YP5A 3K4PA 5FUQA 2YMMA 2VEDA 4RCYA 3Q85A 5J5VA 1IAVA 2Q50A 4Y2XA 5AVRA 3E15A 4RANA 1USIA 2BCGY 3O8BA 2SKDA 4GOND 1GKKA 3BE5A 4H77A 1O54A 1GQRA 4M49A 3OKPA 3T6KA 1DAFA 1CETA 2YIDA 5FWXA 4D02A 2JLWA 2H1IA 1XVIA 2Z57A 3OEEA 4EG1A 1MLDA 1OYVA 2E37A 3IAHA 2GCOA 3B6JA 2X1LA 5FOVA 1RJDA 3CGGA 3NYIA 1QCYA 4HDKA 3MNFA 3B53X 1H4SA 2FZEA 1YZHA 4FEGA 3HKBB 1H23A 3EXFB 4TT8A 1XXHB 2A9JA 1EIZA 4LJLA 1T1SA 3HGMA 3QEJA 2VDVE 1JHYA 1KH3A 3DE0X 3IR7A 1UJ6A 4I7EA 4TKVA 4FYMA 4KQMA 4TLEA 1XD8A 1SUCA 3E48A 3KQWA 3LO5A 5LUBA 3DH0A 1IATA 4BNUA 1JJFA 3PDUA 4OHWA 5JYCA 1RZ3A 2POQX 4ZEOA 1BVRA 3VHRA 1W88A 5KYYA 4JN6B 2AEJA 3E1SA 4D0NA 1QU3A 1TM2A 1JIVA 1Z63A 1WP9A 1EFPA 3F9RA 4DUGD 1FFBA 1YRAA 4KRXA 3I2FA 3WMGA 2Z9CA 2DEUA 1EQUA 2DUNA 2OCPA 2OR3A 3EFOB 5C9ZA 5KQGA 3G2NA 4WZZA 4A15A 5MFPA 2C3UA 2ZB3A 1GADO 3STTA 2VHYA 1J0CA 1THGA 1EX1A 1E3WA 4WCFB 5CTAA 2PMDA 3E9QA 3D8UA 2H1HA 2OGUA 1UODA 2CLFB 1ECCA 3FZNA 1JDBC 1RIIA 4HDMB 2C96A 4D8WA 4Q7EA 2Q2OA 4MQ5A 2QL6A 1XDGA 2W2KB 2PNJA 3W3AD 1REQA 1FJGB 1CNFA 1PP4A 1OBFO 3C24A 4P80A 2AOUB 3BHMA 1AK9A 1IG3A 2DLNA 4PBTA 1Y8CA 1UJMA 3O31A 4M8NE 4UC0A 3L04A 5H9VA 5LCXA 3UOAB 3WRYA 4BNXA 3JXEA 4U4AA 3ADPA 3MSCA 5C5EA 4F3NA 4XX1A 3HWX1 3TLBA 4NXMB 1JQJC 4FDMA 3HKCA 1YGYA 1Y5MA 2NNLD 4PYIA 3E7WA 5JS8A 1E8NA 1RHRA 4HWSA 3ZC3A 5ISMA 1HMPA 2X77A 2NQ8A 3Q8MA 4FFWA 1I51A 1W94A 3DW1X 4P98A 4M36A 4B9AA 4KE6A 2L0XA 5K8CA 4FSDA 2CVPA 3RIXA 1BKDR 1YHYA 1K7FB 1K6IA 2FR1A 3OU7A 2QLTA 1BAPA 1W44A 2QRNA 2F1HA 1Z38A 4URHA 1B76A 1U28A 2X0NA 4R3WA 4P35A 1PBNA 1OC4A 5L3ZA 3C6KA 3X1JA 3OH8A 1PEKE 1N2CE 1CEXA 2A5JA 3QF7A 4R81A 4YJGA 5F1KA 1E96A 4DRYA 4B7CA 3OU2A 2CNWA 1DHRA 4MW5A 5HZGA 3IAS1 1S8NA 3WL4A 3GFPA 3NYRA 3DDWA 3EIQA 1Q1BA 3WR5A 4FYPA 1DIAA 1XRRA 3PFFA 4WEQA 5K51A 5TLSA 3I1YA 1HE8B 1SVMA 1TKBA 1GCIA 2GNPA 4XDGA 1D4ZA 3OFNA 4YCMA 4W7IA 4WOKA 1MOSA 5SZHB 3ULKA 1AZWA 3UOWA 1QTQA 3FZYA 3II6X 3NHFA 1T2VA 1Q7TA 4Q1VA 3DBOB 4W7HA 1I24A 4ZOEA 1D6JA 3VDMA 3HWWA 3LA6A 3PQFA 3WMWA 4RJ2A 3DGEC 2L17A 1YK1A 5BV7A 1N9KA 1TJPB 3EZNA 3QX8A 1PZXA 1MN6A 4GX0A 5D3MA 1AS3A 2TMDA 2XE8A 3AFOA 4QBFA 2Q49A 3MB8A 4OXRA 3I9FA 2TRSB 5C4IA 1DQNA 5FI3A 4DEYA 1ZP6A 2Q3BA 2BBWA 2YS6A 2VDQB 4FC7A 2R84A 1ZIXA 1T35A 3BG5A 2W70A 3AXSA 1MH1A 4Q4DA 3FF1A 4W99A 1KFKB 1A77A 3PQ8A 2EBFX 4LGVA 3S2GA 5EUQB 3WXMA 2QM8A 4K9QA 3FB4A 4ITVA 3BEOA 4J16A 3UC9A 1T43A 2ZXFA 1UPAA 5BSVA 5BVGB 4Q7KA 2CT8A 4Q3AA 1L7XA 3GJ8A 3ADCA 4Q7QA 2ZJ2A 1E7QA 3ECCA 1YMUA 4EI7A 3Q7IA 2A9VA 1UAAA 3V4LA 1Z5GA 2IYOA 3R7BA 4X8HA 4JB3A 4AG6A 1J2JA 4E1AA 4XCXA 5IWCA 4JBYA 3NOVA 2VXOA 2HJVA 2DMRA 3L4BA 1AC5A 3PNBA 4N5IX 2PWYA 3FUUA 1ZM7A 3HCRA 4WKOA 1P2TA 3KJGA 1QHEA 3NZEA 2FV8A 3AP2A 3TQIA 4AS1A 2MSNA 2P9HA 4O2LA 4YB8A 5IFKA 1QWSA 2AQIA 2YYZA 3Q10A 4AIIA 1K7XB 1CJKC 3H75A 3PTLA 4QVGA 3ZBQA 3IA7A 4QC2A 2Q9BA 3VR6A 2KB0A 1H5QA 4IYRA 3W5VA 2IFTA 1IONA 4XEUA 4UUMA 3NG1A 4P4TA 4D3DA 4EVSA 2PKEA 3N7TA 2LWIA 3NCTA 4QPZA 3N7AA 2JI7A 4BU0A 4QM7A 3K6SB 4BZPA 1KY3A 1Z4PX 5G2OA 3UG6A 3WO0A 2WIGA 4RTLA 1S1CA 1ZH0A 1RKBA 1HTTA 2O3TA 4V0ME 5BSRA 1LRKA 3VR6H 3BWMA 5AESA 3WGMA 4EEKA 5EE3A 2Z95A 2X13A 4U0KA 2VAMA 2PT6A 2PQ6A 1Z6PA 3HN6A 1IMOA 1JWLA 2G17A 1W6RA 2CFCA 3LQYA 2HXGA 1Y3HA 2Q3JA 3D0KA 3LKBA 3UB4A 4CKYA 3G8AA 4Q48A 2QUAA 4U2EA 3K70D 1QIMA 1G5PA 2HCRA 1X8KA 2TS1A 3LC1O 5EHNA 3UXYA 4B6FA 4E1BA 1XZAA 1UKAA 1V37A 1TVKA 4IJ5A 1HNNA 4LSGA 5B1IA 4BHTA 3EXIA 4GE0A 1I7QB 5EJFA 4KDEA 4H3SA 2WHRA 2YWFA 3H4VA 4YRJA 1PJAA 3RVDA 5ELXA 4D25A 2DETA 2EGHA 4NICA 2VJCA 4R83A 1GA4A 3ZIAA 2FG7C 4IR7A 3ON5A 2XYPA 3BGOS 2J8ZA 5HZKA 1WMBA 3VR4D 5DGTA 1KI6A 4G8BA 4P92A 2G0NA 3U40A 5GGYA 3RI3A 5IARA 1XIVA 1LF0A 1XZQA 1FU7A 1R9NA 1YRQA 5CX4A 3I30X 4JLMA 4BS9A 2ZJ7A 1DI0A 4B45A 3ZDEA 4TTVA 2BM9A 2MR5A 1G6OA 3GEBA 1ZN8A 2AG8A 3F7NA 1W75A 2YZNA 4N3CA 4Q12A 1NUPA 3GUUA 4WK0B 3A8TA 3OFKA 4TKUB 5THQA 5J5CA 2JVIA 1DUSA 3BDVA 1F3OA 3FPAA 4W4TA 2BL4A 4TL6A 2R48A 5G41A 1PDWA 4HRVA 3BOSA 1GKIA 3RVMA 5JCJA 5JD3A 4DDVA 4CQMB 3W2GA 4RL6A 2A0WA 4DNOA 3CX6A 3DZGA 3K72B 1DIRA 2PRZA 2W2OA 4JLVA 2WF7A 1PNTA 3LJKA 2E2WA 4Y0VA 5G4LA 4ND1A 4EG5A 3CONA 2FPPB 4KZKA 4DDWA 1LNQA 2PPLA 4L0MA 4QULA 1QO7A 3KD2A 3LBIA 1D1TA 1TM1E 1X1CA 4TXLA 4W9NA 5DH9A 4RV5A 4YI3A 2AL7A 4L27A 2G1PA 4D3FA 2C2ZA 2VXYA 1TAQA 1BYUA 2G8LA 3N2LA 2DKNA 1M8PA 2IZOA 3P2KA 4IX9A 5AJTA 5DGCA 3PCTA 1ZJWA 1TYZA 4P5EA 3FMGA 2PMBA 2Q1SA 1U1CA 1IBLB 2ZKLA 5DYTA 1PGJA 5E1OA 2Q99A 5B1EA 2FJUA 2F8MA 3OLZA 4L8WB 3RC2A 5ALVA 3QEBZ 3IBTA 2C7OA 4L6IA 4W1PA 4YUXA 5JV5A 5I7FA 2QUKA 3JQ8A 1ULSA 1NU6A 4QOSA 5TGDA 4C7MA 3FPGA 3DMTC 1PI3A 1KL7A 3RADC 2H5EA 4E14A 5HUQA 1Z2DA 3ND9A 4LDRA 3R7WB 3QTTA 2ADMA 5CLFA 1Z2CA 2IDKA 2ZDGA 3LC0A 1RKXA 2VDKB 2FOXA 4OQEA 1O6ZA 1WV0A 2PR7A 4LWQA 1DKRA 3LI2A 3GGGA 4G1CA 4RVUA 3UB3A 3EMKA 4ETIA 1BXGB 1QJ4A 1DEKA 3FMVA 4Z6KA 5BSWA 3R3ZA 1SG0A 2D0DA 2ON6A 2PGLA 4LZOA 4O4IA 5DOVA 4ZXFA 4LF5B 1NBOA 3VR1A 1Z83A 2UAGA 1U6JA 5JQGB 3X1DA 1CY6A 1RKQA 1W49A 4PZ0A 3CCFA 2RHHA 1KYVA 1P0FA 1Q0QA 2P8SA 3NNNA 2IKQA 4Q9KA 4KODA 2PKQP 3OPYI 1K6XA 1JA0A 2ID9A 3UTDA 4JJ8A 3EN0A 3L0CA 1TUGA 3KOYA 1N2OA 4LV8B 4NP6A 2MTBA 3CX3A 4V03A 4CM6A 1NJ1A 2Q4EA 1XTRA 1R6BX 2JAQA 3C3JA 3MCWA 3QBTA 3WFJA 3CLTD 4K1XA 3AM4A 3ORRA 4UAGA 4HDQB 4ZC1A 1JLKA 1XRLA 3JX9A 1PSZA 4XSGA 1LDGA 2DFNA 2JLAA 2BI7A 3Q7RA 4YJHB 1NQUA 1H2FA 3KB6A 2XCIA 3M6AA 2X76A 2C9DA 4ZU6X 4AL4A 5CTJA 1RT9A 1XQ6A 3VO1A 1MX3A 2E4WA 1V47A 2W6QA 4H3HB 3SR0A 5KTYA 3WGZA 3PKZA 5EYPA 3TLEA 3RYFA 1W30A 1BGWA 2YWEA 3EVAA 4I1OA 2QM3A 3HDHA 5LP6C 2PUDA 3KYJB 1SELA 1IM8A 1DIGA 3S55A 5LXTA 2ERYA 1KAQA 4MRSA 2QD3A 2HRRA 1C9YA 3WOVA 4MS1A 3JAWA 2ZRBA 4QARA 1U8EA 5I9IA 2ISQA 3DLCA 4WY8A 2OV1A 2J9FB 1ZVQA 3EBLA 2PKYX 1V96A 2BISA 1QGYA 3GLHB 3NM4A 2XWPA 2NV2B 3KIPA 2CNBA 2HQRA 2K6GA 2OWDA 3T1TA 5AOVA 3NH6A 1ZFNA 1YRWA 1U0LA 5KJ6A 1C0IA 2ASVA 1JEYA 4C7OB 5KVSA 4A92A 2PSFA 1J2YA 1I1NA 1L4GA 3MA0A 4FYJA 5CYGA 3HV2A 2P6OA 3D9QX 4FR0A 2HV8A 2ZSDA 3DTVD 3FWZA 2I22A 2K7ZA 1MO5A 2WWIA 4JNCA 1XHLA 2QZJA 1KEEB 3P96A 3EF1A 4RK4A 2EXXA 1MC1A 3TOZA 1TADA 4JJKA 5JOQA 4CQNA 4HFRA 3DAHA 3OTGA 4ZQFA 5BN1A 3GRRA 3JD0A 4Z99A 5JS6A 4B47A 1MAHA 2GNAA 1JIXA 2O14A 4KQ9A 4X0EA 4D9CA 2HM7A 5BUZA 5HFJA 4Z53A 3LP6A 2UUOA 2FMHA 2JGDA 2R7NA 1RAFA 3SM9A 5JO0A 4W9MC 3I52A 3HA5A 4ZO8A 2XNCA 4ZEWA 5K3FA 1H4QA 1HLGA 2VDOB 2PXHA 1Z25A 4BN4A 3JYPA 3UH0A 2P6NA 4PZZA 5BMVF 1EFHA 3WQRA 5IYZB 4R4JA 2ZJZA 5HR5A 1PR4A 4M0LA 2QAGA 4K0RA 4BMDA 3U56A 4Y0NA 4UTZA 1JKJA 2IIQA 5C18A 1EE1A 5I48A 4U7WA 1Z7BA 3DCIA 4INPA 4RMHA 5ALJA 1IUPA 3DCJA 3EVGA 1YJBA 3SC6A 3W5UA 1JPUA 3NGXA 3INGA 3KLOA 4KV9A 5LU9A 5TT1A 2CVZA 3ET4A 3Q40A 2I2AA 4GNKA 3W6NA 4F60A 3SP1A 3KCQA 2ZSKA 1Z0IA 3WBBA 4JAVC 4HNSA 5E95A 1Z6ZA 1F6BA 2J3LA 2HWYA 4FMCF 3KAKA 1D9ZA 2I6QA 1MO3A 2HWUA 3HFJA 3R0VA 3JVEA 2Q8NA 5M3BA 5DBFA 2OCLA 4I8XA 5DI3A 3V4FA 1K8YB 2QVXX 3RARA 2IHBA 5BNZA 2O8FB 1S8FA 4OSPA 4UPDA 3NIGB 4LHWA 3SYKA 4C0JA 4J0GA 2H52A 4KZPA 1QIKA 1E1RA 2PIDA 1Z8FA 1T13A 4L16A 4LHEA 2AOXA 2O8BA 2B9EA 3PFIA 4O02B 3PE3A 4QE3A 2O54A 3B38A 4UJ5A 4AYXA 1L7MA 2Z5LA 4MB6A 3LD9A 4M60A 1ENZA 1BTOA 3FPCA 4MIEA 3BD9A 4OIMA 3T4PA 4V2IA 3TSAA 1DSSG 2HYDA 4DIMA 3GPLA 2E87A 5C8DA 1EUYA 2FSGA 3G8DA 2QRJA 4GKBA 1MVNA 1NFQA 4M0EA 4JLPA 4W8OA 2UUPA 3BE4A 3I6YA 4WZAA 2BF7A 2EKBA 2N1BA 2AK3A 3PRKE 2VCEA 2OCDA 1Q0LA 3CTMA 3FJOA 2GK6A 2H5LA 4OJYA 4HNVA 1BD4A 3CQ9A 4MQLA 4E6PA 5EJ9A 4JH0A 1PQUA 3AONB 4FQ8A 1QIFA 1CQJB 1Y42X 3HJFA 3E4CA 3CW9A 3AUTA 3VYVA 3EDCA 3W2TA 2ZJ6A 1M2JA 4X44A 2Q1UA 2ZQYA 1VCHA 4HFJA 2D7JA 3HY6A 3PJEA 4XGNA 2GASA 4I5DA 4PSCA 4BE4A 1E2MA 3P4XA 1CLUA 3E22A 5EC8A 4TLAA 3G7UA 4KQWA 3RFUA 4R6XA 4HRXA 4DE5A 2ZR7A 4GRIA 3NHSA 3ZGYA 2W22A 5K8JB 3IAS6 2WIFA 2DPXA 4NOKA 5BV2P 2XUAA 3HDJA 2A88A 4IKOA 1PNVA 2ZUCA 3ICWA