2NUAA

C123av mutant of e. coli succinyl-coa synthetase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNVPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 104
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nuaA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nuaA01
3WOHA 4IJUA 3G49A 5L4SA 2VYNA 1ZXLA 2HCTA 1IZ0A 2FSSA 1LQUA 3B70A 1KOLA 1SCUB 2OP1A 1A71A 1ZW1A 4ZN6A 2QIOA 1DC5A 1Q7BA 4PLZA 3VH4A 1MXFA 3C3XA 4R3WA 3VZSA 1UXJA 1PJ2A 1GEGA 4JP3A 3WSVA 3BHIA 4BKOA 5TGDA 2GCGA 3D4OA 3O8QB 3U09A 3DC2A 1D1SA 4GX0A 3U3XA 3R3SA 2PGLA 3LLVA 2J3IA 2W4QA 1B7GO 4EBFA 4RORA 3VKVA 2BHLA 2JD0A 1DIGA 2CZCA 4RZHA 2GGSA 4PCVA 5L51A 3OA2A 3F47A 1U3VA 4NJOA 4YTEA 3QJ5A 1HDZA 4UUPA 2B35A 1CEQA 1B16A 3A1NA 1ULUA 3GNSA 5DBFA 3RKRA 5JBIA 1WAMA 3D4PA 4B79A 5FEUA 4I5FA 2IDZA 4IUYA 4UEJA 1XHLA 4DUPA 3AOEC 5EESA 3IP1A 4J4TA 4E12A 3MOGA 3FTNA 4GWGA 1E3WA 3AU9A 1E3EA 1NFRA 5AVOA 3DL2A 5DBGA 5U9CA 2Y1FA 5JAIA 1I2ZA 2DTEA 1LLCA 3LVFO 4KUGA 4CMBA 5IJZA 3RJ5A 1CIVA 1BHSA 1C0LA 1ARZA 1UAYA 1ZEMA 1E7SA 2ZTLA 1IPEA 1A9ZA 1RJWA 1MP0A 4IGFA 2JFFA 3E82A 3U4IA 2GN8A 1ZJYA 5IN4A 4ONEA 5IDQA 1F8FA 4CM4A 1NWCA 4IZHA 4JCOA 5B4VA 4AJOA 3DZJA 1F12A 1EVZA 5EIOA 4PRLA 3ULKA 1I8TA 1GZ4A 3P2OA 4JLWA 2VNSA 1Q7CA 1B2LA 2WJPA 1RWBA 4WEOA 1ZH8A 2RIRA 2DT5A 1A7KA 4W82A 1N8KA 1VC2A 3W4JA 2O3TA 4UVEA 1EFLA 3H9UA 4B8WA 1P1FA 2BI7A 4W9NA 4BL5A 3E5RA 4NFHA 2H9IA 2DKNA 2ZJ0A 3H9QA 5T57A 1FJHA 2P91A 4S1VA 4AVYA 4FR5A 4N54A 2BKAA 2TMDA 3PYMA 3GEDA 3JV7A 4CV3A 1VJ1A 5F5NA 4BQRA 4FQ8A 1KIFA 4E6PA 1AN9A 2J8ZA 5HM8A 3GFBA 3D3WB 3GGOA 2VZ9A 2V6BA 3K30A 2OMEA 1KEVA 3LT2A 3QVSA 4H15A 5LC1A 4DQXA 5ENVA 4YJFB 1OC2A 3SLKA 4LN1A 3GRKA 2NVUB 1V3UA 1R4MA 2DUWA 4OSPA 1DFHA 2FPIB 4DC1A 3GVIA 4TKLA 3WGQA 1YGYA 3E48A 2VN8A 4MOWA 4RVSA 5T8KC 3ZU5A 4TMFA 1DRVA 4FCCA 1LLQA 1KVTA 3ICCA 2HU2A 3HWRA 3L6OO 3TSCA 1HYHA 1SB8A 1X7GA 3MTJA 4DQVA 3ZWBA 3QA9A 5C7OO 4OM8A 5L7YA 1WNTA 5TF4A 2C7GA 1X7HA 1J0XO 4BKUA 2JCVA 1E3IA 4IXTA 1JLLB 1QV7A 1YO6A 2I3AA 3PWSA 1ZK3A 3VKUA 1HETA 5A9SA 5A04A 1KYQA 1I36A 4L9RA 3Q2KA 3NX4A 4UVGA 3BTSA 4J4BA 3VTZA 1J5PA 5TRTA 1EVIA 3QY9A 1DB3A 2VTEA 1ZCJA 2O3RA 4M86A 2PD3A 2PV7A 2HRZA 2PA3A 5DCUA 4OHUA 3WGHA 2JHFA 4D0SA 3DBHA 1ZXBA 2J3HA 3B20A 1H6CA 4FW8A 5IZCA 4WEQA 3ZWNA 1PS0A 3U0BA 1KC1A 1Y9AA 2Z1MA 4ALNA 1SMKA 4U7WA 3GN2A 1CQIB 1UAGA 3LZ6A 5JDCA 1XWFA 4J7XA 1YWGO 1VRWA 2EKQA 5B12A 3GFGA 4WLOA 5COQA 4ZQHA 2DLDA 5A1TA 4TRMA 1LSSA 3ZWYA 4W7IA 4B8ZA 3DBLA 1CJCA 3ZNOA 5L9AA 2WYWA 2PKQP 3JQ8A 4L4SA 3W6ZA 4A5OA 4XKJA 1IB6A 2VTDA 1WDLA 1JKIA 4GVXA 2X0JA 1GPDG 4BUCA 4G81A 4WOKA 4HY3A 2FR0A 1YQDA 2D59A 1HEUA 3N58A 2HKIA 4MINA 3SX2A 4YWJA 3KLMX 3PFFA 1RYDA 2VYVD 5G2OA 1PGNA 1YB5A 2O48X 1ISGA 1DFGA 4Q3EA 1R16A 3D64A 5B37A 5I8ZA 3ZV5A 4E5PA 2VT3A 3R1IA 1CETA 5KCZA 1WDKA 4YAEA 1V3VA 1DIHA 4HX5A 1U8XX 2EW8A 2TMGA 1KVSA 3PQEA 3ZV3A 3K6JA 2ZYDA 2EKLA 2O7SA 4CL8A 1GQ2A 2OL4A 5F1OA 4B3IA 3UCFA 1IOLA 3N74A 3TPCA 1NTOA 2PWZA 3RFTA 4L4XA 3KVOA 3C7AA 4R1SA 3NT4A 4IDDA 3OIGA 2ZTUA 4UEKA 5EJ2A 4DBZA 3IMFA 4BNXA 5JS6A 2Q1UA 2D3TA 4PLWA 4FFNA 3FWZA 1KC3A 5BSEA 3G1UA 3FCOA 3DFZA 4FOOA 2BGLA 3DBHB 1YL7A 4UUNA 1XR3A 4JBGA 1U3TA 4BV9A 5TJ9A 3IOYA 3O8QA 1UJMA 3PJDA 4RF5A 2QG4A 3H9JA 3HFSA 2ZB3A 4FFPA 4P4LA 5IN5A 3G17A 1NFFA 1JVBA 3DXFA 1YE3A 1I3NA 4Y8VA 1UP6A 1UXIA 2EKPA 3ASVA 2BFAA 1NNUA 3PI7A 1HZJA 3R0IA 1LNQA 3QWIA 1XU7A 5DT9A 4IBOA 3SEFA 4CLRA 1DRUA 1T2CA 1TEHA 2HLPA 3RASA 3RWBA 3VDQA 1N2SA 5BNTA 3E03A 4M49A 4O5OA 1WWKA 2FSVA 2BH9A 2GN9A 2HO5A 4FOSA 4ND4A 5DBIA 2Q46A 1SBYA 2Y67A 1HDGO 1W0CA 3GDGA 3F6YA 4JJFA 1NVTA 2CUKA 2V7PA 3V1UA 3PXXA 1PL7A 2GLXA 2VHXA 3AI2A 5K6AA 4FGWA 4R68A 5L45A 4CPDA 1PGOA 1ZSNA 4PLVA 5BT9A 4RJTA 5CPBA 3VC7A 1IHYA 5BQFA 3C1OA 3DAFA 4PGFA 4FS3A 4TROA 2IYPA 2PD4A 3ZCXA 3K8ZA 2RHCA 2JCYA 4C7KA 4ZGWA 1FDWA 2B83A 4FC6A 3SC4A 1UDCA 4J2OA 4UUOA 4F6LA 4HV4A 4FFOA 1E1LA 3MJTA 5G0TA 4WPGA 3ZHZA 2VUSA 4BNMA 4M1QA 5ICMA 4GKBA 3MJCA 5A5FA 3U4HA 4XDYA 3I1JA 3WYEA 1ID1A 5F3RA 3DR3A 3E18A 5FYDA 3DZGA 4IQ0A 5JO9A 4Z9YA 3FBTA 1Y81A 1MUUA 4W7HA 3UHAA 4W9NC 1OAAA 3W8DA 2Y1OA 1YOVB 1YJ8A 1H6BA 4L74A 3LT1A 3S2FA 5KVSA 2DM6A 1EUDA 1CQIA 4XZ3A 3RC7A 1H6AA 5JAQA 1DHRA 3AY6A 4OKIA 5L40A 1NM5A 5I9MA 7MDHA 1SO8A 1L7DA 3PLRA 1VJTA 1QYXA 4GI2A 1M67A 1E0DA 1X15A 2OORA 3NDRA 4DXHA 1NYTA 1XYGA 3FTPA 5EERA 1I3MA 1DOHA 1P1JA 2Q1TA 4XQEA 2ZTVA 3JQ6A 4R3NA 1I3LA 1JWBB 2NU7A 4ZQEA 1RM0A 1N1GA 4Z9FA 3NGXA 3EMKA 4DIFA 1LLUA 2OGUA 2AG5A 1LSOA 3AUAA 3Q9UA 4RVDA 1U7TA 2A92A 3ZWOA 4CM7A 4P22A 2NVWA 3ONEA 5I7FA 1VJ0A 4MVJA 3UXYA 4BNTA 3FBGA 1YQGA 4YJHA 3GMDA 5JE8A 3GQVA 4EZBA 1DJNA 3DMTA 1UZMA 3U49A 4WLEA 4MKZA 4CJXA 4LVCA 2VWPA 4I9UA 3Q3CA 2X5JO 3M6IA 4RPHA 1GFSA 5CEEA 4EUFA 4WNCA 4QQRA 2C54A 2I66A 3L6DA 3PJEA 4BB5A 3RUIA 4I8XA 1VKOA 2NVBA 3JCZA 2D4AA 3K2BA 1LLDA 3MTGA 4RGBA 1ENYA 4P4NA 4DPMA 4QUKA 4FC7A 1HKUA 4RLHA 4YEDA 2V6FA 3AUTA 3PGXA 3I9MA 4U5QA 5FFFA 1E7QA 1JKJB 4NDNE 3K92A 4GVLA 4MIEA 2IXAA 4X54A 4JGBA 4RDHA 4GWKA 3DMTC 5A4DA 1H93A 2HK8A 1P1HA 1ZVMA 2I65A 3TL3A 5BSHA 4BO6A 3GVPA 1V3TA 3JQBC 4EJ0A 4AICA 4LCJA 1WMAA 5K0ZA 2F00A 1LEHA 3F1LA 4J3FA 1VL0A 3EVTA 4CLRB 3ORFA 2J5KA 4EI2A 4YCAA 2P5UA 1GUYA 2CMDA 3LDHA 3DZBA 4IQGA 4L73A 1QYCA 2VHVA 1KEWA 3JQAA 1FF9A 4FIZA 1PL6A 5GZ6A 5F21A 1G0OA 2NU6B 2YQ4A 2VYND 1FXSA 3LC2O 2O2YA 4PG8A 3ZW8A 3AUUA 5JAMA 5KWEA 4GMGA 2HJSA 2WEKA 4WK6A 4JX8A 3RQSA 2J5QA 4QEDA 3GK3A 2W8ZA 3EVNA 4OYRA 2I76A 1T2AA 3TFQA 4DIBA 1H9AA 5F5LA 2Y0DA 2JAPA 4MP3A 1ZMTA 4XIJA 3ZWVA 4NNJA 3GVXA 3JQCA 3OJLA 4DBVO 1YXMA 2C5EA 2H5LA 1F14A 1ULSA 3LLSA 1X1TA 1Q0QA 2QYTA 1LDMA 3ONDA 3V1TC 4GGOA 2RAFA 5JDIA 4XYGA 3WFIA 3W4IA 5JPIA 1I33A 4BNJA 3RC2A 3GEGA 1C14A 3WSWA 4NG5A 3DBRB 4XWYA 2GDZA 1JWAB 3DTYA 4PG6A 4XGIA 4J16A 1R66A 1NQTA 3Q1LA 4IMRA 2PZKA 3NTOA 3S2IA 4Y67A 1B26A 2O4CA 2ZB7A 2JHGA 4CQMB 3SC6A 4CMKA 3I9NA 1CWUA 4FJ1A 3RUEA 3OJOA 1EUDB 2JAHA 3WFJA 2NWQA 4R9SA 4YBZA 2VHWA 2YV3A 1A5ZA 3EY4A 3S2EA 5AOVA 1T1SA 3MWDB 3NGLA 2EHDA 4G5HA 4BNGA 2EEZA 1J4AA 2NACA 2A94A 1Y8QB 1PEDA 5KJEA 5TS3A 5COAA 3JQAB 5ITWA 2OZPA 1W73A 4XB2A 4LK3A 4I5GA 4E5KA 1E7MA 4IDEA 1KS9A 4MVJI 1B0AA 5JAZA 4MVJP 3P7MA 4O63O 4CUKA 1P31A 2B5WA 2CY0A 2AE1A 3PHHA 5AXAA 2WD7A 3PWKA 5A5EA 4AJ2A 2VHYA 2BD0A 3R6DA 1ZMOA 4J43A 2VRCD 4P4GA 3JQ7B 3MJVA 3FNFA 2E37A 3OH8A 2GYYA 1PGPA 1VSUA 4WLFA 3WYBA 4EITA 1EMDA 4UUMA 1H0KA 1WP4A 1YB1A 4IPTA 3RC9A 3RFXA 4E30A 1P44A 2GPTA 1HDOA 5A3JA 1HWYA 5ADHA 1DEHA 2FPPA 4HNHA 1H2HA 1X1EA 5B1YA 3NV9A 4J49A 2F1KA 3PYLA 4DYVA 4YAGA 4RQUA 3LT0A 3KOUA 4XX0A 4XEHA 3AOGA 1N7HA 3HB5X 2Q1SA 1T2EA 2OXIA 2RHRA 1I24A 5DP1A 5TIIA 3SVTA 1YOVA 4XR9A 3RI3A 4H16A 4TRRA 4NK4A 3BMOB 3UFXB 4ALJA 1OC4A 3GPIA 1WW8A 4CV2A 4D3FA 1M75A 3W8EA 5JDCC 4YYZA 1EQUA 1E6UA 3JD4A 1PGJA 2CVZA 3TZCA 3BHMA 5A9TA 4TRNA 1ZBQA 4E2YA 3OHSX 3AFMA 2FRDA 2NTNA 4TWRA 5JNLA 2VRBA 3L4BA 2NNLD 2NTJA 3VZRA 4MIOA 4Z3KA 3HN7A 4ALMA 1KBZA 4LW8A 3ZGYA 2QRJA 1T2DA 2D8AA 3GRPA 3WDSA 5B4UA 4WJZA 1N7GA 5F1KA 2PK3A 2YDYA 1BVUA 5CDGA 1ONPA 1QYDA 3IDSA 4IY1A 4WCFC 4YXFA 5JY6A 3GG2A 1LSUA 3T7CA 3H5AA 3F1KA 1ADBA 2GUGA 2XAAA 1PQWA 1M2WA 1ZO8A 2Q99A 3L4BC 4DGSA 4EDFA 4BNIA 4OQZA 3PHGA 3DAPA 1A7AA 3O9ZA 3TOXA 3ETDA 4I9NA 4Y98A 3W8FA 2ZQZA 3I9OA 1ENPA 3EZYA 4IDBA 4OKNA 4RV9A 3JD0A 1DXYA 1I3KA 1BXKA 2NM0A 3MZ0A 2X58A 2ZYGA 1U9JA 2WMDA 3BTOA 4YRDA 4UREA 1IL0A 1XEAA 1U3UA 2RBEA 9LDBA 1OMOA 3PRJA 3HB4X 1PZGA 2I6TA 3RU7A 1TVEA 3JQ9C 2Q45A 1MGOA 5ICSA 3QLJA 4IIUA 2CVQA 3DB2A 1WXDA 2O3SA 1XGKA 1RM5A 2B4TO 5KJ6A 5CEFA 1YS4A 1GEEA 4FBGA 1XELA 1EBUA 1PJQA 2VOJA 1CQJB 4IGEA 5T5QA 3WG9A 3FNHA 1R0SA 5JO0A 1AXEA 1ISMA 2NU7B 4XJSA 3I23A 3OFSA 4ZRNA 4IXWA 3GY0A 3WWYA 3FR8A 4HFMA 4LSMA 3I4FA 3PZBA 4GH5A 4WGGA 2NU9B 5G0SA 4Q3AA 3ZH2A 2Q50A 3DMYA 2SCUA 5ILGA 4MDHA 4E5YA 3DO5A 2WTBA 4QECA 4BHTA 3OECA 3UW3A 1XQ6A 3E1KA 4GPD1 4JP2A 1PU2A 1Z7BA 1KERA 2ZQYA 2GR9A 2D2IA 3PPIA 5DOZA 2GO1A 3WJ7A 1NAIA 4B7UA 3DWFA 1Y9EA 4CV1A 3CH6A 1O6ZA 2QQ5A 1LI4A 3G3EA 3AFNA 2PZMA 1BMDA 1DLJA 4E5NA 5FWNA 4EJMA 3GR6A 2RCYA 3L9WA 4OOFA 4CLDA 3W1VA 5CG1A 4FFRA 3IKVA 4LGVA 1P45A 5ENDA 1UP7A 2C07A 4I5EA 5FF9A 3A14A 5BNIA 3D3EA 1I30A 1WPQA 2GD1O 4HNGA 1YBVA 4PLYA 5JSFA 3GDFA 4IINA 4OH1A 5C7LO 4GSKA 1E5LA 1JN0A 1D7OA 3ZHYA 1HYGA 2VZ0A 1U4SA 2FMUA 3IP3A 2B36A 3WGZA 1GQYA 2QYSA 4BKRA 5L4LA 2OFPA 4CODB 1IHXA 2HDHA 3SBOA 1YJQA 4FN4A 4NJMA 1P74A 1VPDA 1L1FA 1NASA 3CINA 2R2GA 3OJEA 4HFJA 1DO8A 1HSOA 2YQ5A 1ADFA 3QIVA 3ZWWA 1IY8A 1TA4A 2YJZA 2HMVA 4BO4A 4PLHA 5G4KA 1GPJA 2B4QA 3ETEA 1GYRA 2V6GA 5A02A 2EWMA 1F8GA 1V0JA 4G2NA 5HS6A 1P0CA 4I9HA 3G1TA 3PJFA 1DC4A 3VPXA 1MB4A 3LT4A 4A2CA 4RPJA 3SJUA 5CDUA 4NMHA 1U1IA 3OJ0A 1Q0LA 1ZKMA 2AEJA 2V6MA 3VH1A 2CDBA 4RDIA 4D41A 1KVUA 2OOSA 1GZ3A 2JL1A 2C2XA 4M54A 2YV1A 5I8WA 3JQBA 1MA0A 1O89A 2Y1EA 3GF4A 1G1AA 2DTXA 4KUHA 1OI7A 3LQFA 3X2EA 4GX1A 1BWSA 5G0UA 4BO0A 3I5MA 3BMNA 3PP8A 5BR7A 4NFYA 2R6JA 1XSEA 5ES3A 2VUUA 3EC7A 4IJVA 2X7HA 1HE4A 3FWNA 1P9LA 4CM8A 3H7AA 4K6FA 1P77A 1GCOA 5L95A 4F3YA 3M2TA 4OGWA 1E5QA 1CERA 5IXYA 3RVDA 1I10A 2ZATA 1NXQA 1XCBA 3VPGA 2Y1CA 3ZI0A 1UH5A 4CMGA 3HJAA 1BW9B 1S6YA 4IDCA 2EGGA 2EF1A 2HMUA 2VHZA 1N1EA 1GZ6A 4E5MA 1O5IA 1Y8RA 2AEFA 1EBFA 4NH4A 1EUZA 4XCVA 5AXCA 2FHSA 1VL8A 3MJ4A 3ZWAA 2I5PO 4ZRMA 5KKCA 2GRAA 3IS3A 3QSGA 2DBZA 3DZKA 3ZW9A 4YRBA 7ADHA 1LDBA 1O94A 2EV9A 1LDNA 4LRTB 4XQCA 3C85A 3V1YA 4J1TA 1QORA 3L9XA 1GYQA 2CNBA 2E6UX 1BG6A 2R00A 1Q1NA 1UUFA 3HG7A 4NIMA 3Q9NA 2B69A 3I4CA 2EG9A 4JXKA 4Y6PA 4GQAA 4YQZA 6LDHA 3OP4A 4YJGA 3UGKA 3V2HA 3BYZA 3HNPA 4L8VA 3UKOA 4N5LA 4A7PA 4XR4A 2HQ1A 3H6KA 5H81A 3LSYA 5DZSA 1BTOA 3GPDG 5TQVA 5JW6A 2YHIA 1HL3A 4FFLA 3GZNB 3H4VA 5A03A 1U4OA 2WYUA 2C20A 1NR7A 1TT5B 2JJYA 2ZB8A 4M87A 5T67A 3S1LA 5JC1A 3Q11A 4BMNA 3JYNA 3UFXA 3ZU3A 4EUHA 1UDBA 4CQMD 1UR5A 3JQFC 4E2WA 1BDMA 3EDMA 2QZZA 2IZ1A 5JC8A 1Z6ZA 2BF7A 4N7RA 2X23A 1YL6A 3OICA 4U8GA 4QXMA 3C1TA 5I7SA 1I5RA 1T4DA 4YAJA 1XG5A 1E7WA 3DOOA 2FZEA 1LX6A 3A4VA 3UUWA 4NFSA 1BXGB 4U6SA 4JROA 4HP8A 3K2EA 3ADPA 1CQJA 4OXYA 4YJDA 3ZN2A 3WLEA 4CQLA 4CMEA 1O9BA 3KETA 4KDFA 2NVUA 2YHUA 3CEAA 4PG5A 1LSJA 1K5HA 1QXSA 3CSDA 3DTTA 4R51A 4XGNA 4Y6RA 3RUCA 5DULA 4YT2A 8LDHA 1PS8A 2QW8A 1LUAA 3VH2A 1JAYA 2P5YA 3OSUA 3K96A 4AFNA 1LQTA 1B3RA 1PJ4A 1VM6A 3NKLA 4TKMA 2O3JA 3ITKA 5TX7A 3ZNNA 3TRIA 3F5QA 3KYDB 4K9DA 4WCFA 3OIDA 2I99A 1V9LA 1LC0A 4TQGA 2Y66A 5GMOA 5KJFA 2B37A 3AJRA 1S7CA 2X6TA 1SPXA 3WX0A 1P33A 5DF1A 3V2GA 1ISJA 3DBVO 4L75A 5A9SB 1ONOA 3TZHA 4DYDA 4KZPA 2AQ8A 2OBYA 2QRLA 4ZHSA 4YR9A 4K6CA 1QSGA 4UAGA 1X7DA 3INGA 3MJSA 4XDZA 4BNWA 2IYOA 3RC1A 4R5MA 1AHHA 1QV6A 4HKTA 4FDAA 3FR7A 3NT2A 1XKQA 4C7JA 1FDUA 1LRLA 3AM3A 3GT0A 5CAEB 4WLUA 3INRA 4MP8A 3EAGA 3KSZO 4ZD6A 3WIEA 3SLGA 3JD2A 4IJWA 2FR1A 5H83A 3JYLA 2IZZA 5C7IO 2UUOA 3AW9A 1Y5MA 4FSHA 1LDYA 3QW2A 5JXWA 2YY7A 5ER6A 1EQ2A 5U4QA 2P68A 4E31A 4AJIA 2XPCA 1DRWA 4ND1A 1YH3A 4R9RA 4FFMA 4GSLA 3A9WA 3O38A 1ZEJA 4RPKA 4NBVA 4ZQBA 2E49A 5COBA 1Y7TA 4JK3A 2Y68A 4DWVA 1B8PA 4DLAA 3UOGA 3ZV6A 3KSDO 4IDGA 4NI5A 1E3JA 2BELA 5JMPA 3ZDFA 2O7QA 3TNLA 1EE9A 1Z45A 2VOEA 3SXPA 1BGVA 2A35A 4UVDA 2A4KA 4XGKA 1R4NB 5G0VA 1U5AA 1GAEO 2Q2VA 1T1RA 2GNAA 3MCVA 4FJ0A 3FPLA 1VE9A 4J6FA 3RJ9A 1UDAA 5FI3A 5I9LA 4CMEC 4G65A 5KJ1A 4YJFA 4Z6KA 2J3KA 3C8MA 3JQ7A 3S55A 5BNFA 4QT0A 1EFKA 3ANLA 4YDRA 5ITVA 4PZDA 4AJEA 2D1YA 1KEUA 1TT5A 4WE3A 2C29D 4CMHA 2CVOA 1QMGA 2GF2A 3OEWA 1W6UA 5K6AC 3H9GA 4XA8A 5TT1A 3RSHA 1Y1PA 4JBIA 4YPOA 4CLOA 5CAEA 3P5SA 2HSDA 2W2LD 4ITUA 3ZZNA 2Y1GA 1GL3A 4RVFA 4F6CA 1K6IA 1ZSVA 1OBFO 2XF8A 2DTDA 2GN6A 1ZIDA 1DJQA 2AE2A 1Z74A 4R1TA 1YB4A 2J3JA 4GX2A 4BNFA 1YRLA 4R41A 3HSKA 3JYOA 4J2HA 4JBHA 4ESOA 4NK5A 1LRJA 1C0PA 2VYVA 4IQ8A 1U3WA 5GZ1A 1C3VA 3WMWA 2PFGA 4HXYA 3RUDA 2DAPA 1ZNQO 2GZ1A 3A06A 3H5NA 4RL6A 5K9ZA 1NPTO 2H1SA 3H3FA 3QWHA 3H5RA 4Q39A 3IJRA 1IE3A 3RKUA 1F06A 3KRTA 4Z0HO 2I9PA 4J7UA 1GQQA 2YZ7A 2X8LA 2FWMX 5IG2A 4EEXA 1B3BA 5T64A 4KTTE 2Q1WA 2FPIA 4LRSB 3WGYA 3VHRA 2AW5A 4XJTA 1V6AA 2J5RA 2JD1A 3G0OA 2UYYA 3WWZA 3PHIA 2X5KO 4J90A 4WUVA 3ROQA 3WS7A 4MIYA 1QP8A 1CRWG 1J6UA 1H2BA 2IEDA 4BNUA 4ALIA 3GN1A 3I3OA 5I9NA 1DBVO 3WGIA 1WDMA 2CDAA 3JQ8B 3UCEA 3NYWA 2ZCVA 5ER9A 1DDOA 1T26A 5LCXA 4A03A 1UP4A 1EDOA 4PLGA 5JMWA 3JQFA 2OHXA 4Q3BA 4IDAA 4R69A 3E9MA 3F4LA 5B4TA 5HRUA 2EW2A 4MKRA 1KY4A 1Z73A 1EVJA 2Y0EA 3JSAA 4BQPA 3PDJA 3KSUA 3UAGA 2ZCUA 5CEJA 3E5MA 2B0JA 2DBQA 2FOIA 2VWGA 3KBOA 4TVOA 4U0JA 5DP2A 3W4KA 4BNLA 5DDIP 1HTBA 1ML3A 2GERA 5C5IA 3MJEA 1MC4A 5T6BA 3MWEB 2FZWA 2VZ8A 3TOZA 1T4BA 1U28A 3PQDA 1PJSA 2G0TA 2VT2A 1JQBA 5KVVA 2IXBA 4NBUA 3FNEA 1YDWA 2UDPA 2SCUB 1K2WA 3QHAA 5TT0A 4AJNA 4WCFB 3T7EA 2CF6A 3WLFA 3WGGA 3KEQA 3NJ4A 4OOEA 3RBZA 3T4XA 3WTCA 2ZYAA 2NU8A 5L53A 4ND2A 3RBXA 1M6HA 1ZSYA 3F3SA 3K73O 3L6EA 1M66A 2HJRA 1PZEA 3WIDA 4D0RA 1XQ1A 3JQEA 3PGJA 3UN1A 3D1LA 1O95A 2DC1A 2IZ0A 1KY5A 3MWDA 1SB9A 2RH4A 3LF2A 3ZU2A 1X13A 1EUCA 4QO8A 2G17A 2DUUA 3GNTA 2HAEA 2X9NA 3GAZA 1AXGA 3PWZA 1LDGA 1Z82A 3AK4A 4CM1A 4J9UE 3UH1A 3JYPA 3GAFA 2HRBA 3BMQB 4NBWA 3RROA 1FDVA 1DAOA 5A05A 1A4IA 5DOVA 2JCXA 4R5HA 3IAHA 3QV1A 3OF2A 3HDYA 1N5DA 5DCWA 4DMLA 4KOAA 2C59A 3H3JA 3KO8A 3RIHA 3PHJA 1AHIA 1K89A 3S2GA 1MG0A 3BMNB 4CL3A 3I6QA 3GC6A 1JAXA 3FN4A 4M89A 4BO3A 4UULA 4BB6A 2H6EA 1LDEA 2BFOA 3CXRA 3LC7O 3P19A 1M76A 3M2PA 4CM5A 4EJ6A 2YW9A 1JDJA 2FY8A 5TJHA 3VDRA 3U9LA 2PKRA 3L77A 3NEPX 2BRUA 3DBRA 4GGPA 1HDXA 1Y5RA 1SC6A 3GZ4A 1FDSA 4IMPA 3AM5A 1L7EA 4R4JA 1PQUA 1HDCA 3V2UA 3VZPA 1GUZA 3JQ9A 1PS9A 1ISFA 5CFZA 5EMHA 1D1TA 3FI9A 1ISIA 5EINA 3HDQA 4YAIA 3GA0A 3CZRA 3H9EO 3DZHA 4OXKA 4B3JA 1HXHA 1QKIA 4S3MA 1ISHA 4XIYA 1DHTA 1R37A 4E21A 4MVJD 2ZKLA 1SOWA 2FN7A 4RPGA 3ENNA 3D5TA 2C2YA 3N7UA 1D8AA 1ORRA 2D5AA 1M6WA 2X86A 4E33A 2DBRA 4DTIA 3RUFA 3BA1A 1T24A 4IM7A 3L0DA 3H65A 4JIGA 4DLLA 3P2YA 4BGUA 1DIBA 1PJ3A 4BNHA 1TLTA 3K5PA 4YAKA 2BFMA 4Z9XA 2O4UX 1HE5A 4BGIA 4F45A 1EEHA 4M8SA 3VZQA 1PR9A 2AQIA 2O2SA 4FGSA 3KTDA 1GDHA 4QFDA 1DIRA 3QRWA 2IEBA 2R00C 1D4FA 1LC3A 2VUTA 3IIEA 4BMVA 1EVYA 3PHLA 5L4NA 4B7CA 2DBVO 3D3WA 5BSFA 4NR0A 4F46A 2ILTA 3DOCA 4OL9A 4FPXA 3LF1A 1IPFA 3CE6A 2Y05A 2YFHA 4CUJA 2Q3EA 3GOHA 1R4MB 2UV8A 1ENZA 1G0NA 4KUEA 2LDXA 3DOJA 4QFCA 3KHUA 4R1NA 3T4EA 4CR6A 3NTQA 4CR7A 3NDIA 1I0ZA 3E9QA 4DIOA 1H94A 5BSGA 4CM4B 4MVJE 1FDTA 1W4ZA 2PLAA 3DHEA 4E2XA 3KYCB 4AJ4A 2WE7A 1DAPA 3ON5A 1F0YA 4E32A 1SZJG 4J1SA 2CF5A 4IIVA 5AXBA 6ADHA 4PG4A 3GLQA 2YFQA 2NU9A 2CFCA 1U2DA 2W2LA 5KJCA 2HMWA 3BHJA 2VWHA 1I32A 3DAGA 3H8VA 5IDYA 4CMCA 1HF3A 5TSDA 1GD1O 3TZQA 4XYMA 2W98A 3JYQA 3RUHA 1BVRA 3EYWA 4LSWA 1YKFA 2FP4B 1E7YA 2Y1DA 2ZIZA 3OQ6A 1IULA 1DLIA 2OUIA 3F4BA 3GH3A 3L07A 4XX0B 2WD8A 2X0RA 4FB5A 1DC6A 3DZFA 3OEYA 4QX6A 1TXGA 2NV6A 4BKPA 4D43A 3WNQA 4D3DA 4P8RA 1Y8QA 2AHRA 1J49A 2P9CA 4KWIA 3WB9A 1H9BA 4YT4A 4I5DA 1LJ8A 4DVJA 5FI5A 3TWOA 4CMAA 2X9VA 1EE2A 2VCYA 3H2ZA 3VPHA 4ALLA 5CDYA 4KQXA 1Q2XA 3QVOA 3HDJA 1GADO 2HK9A 3KM0A 1E3SA 3NRCA 2GSDA 4CM9A 1NWHA 4EW6A 3JQGB 3TZKA 3KZVA 1ZJZA 2Q2WA 1DC3A 2WSBA 1RPNA 1GY8A 4CLHA 2I3GA 4IS3A 3CUKA 5CG2A 3W6UA 3E8XA 3RD5A 1TT7A 2ZJ1A 3Q0EA 1E1NA 1UXGA 1Y6JA 1CYDA 3U4CA 4XD2A 2C7VA 2IRWA 5MDHA 1AUPA 1B15A 3ANNA 4QSMA 1VLLA 1PX0A 2P9EA 3O03A 4NPCA 3ZWCA 3CZMA 2ZK7A 1X0XA 2NQTA 3GG9A 1OFGA 4BO7A 4DPLA 2AA3A 4INAA 1WLYA 1DFIA 5DCYA 3F9IA 4ZQFA 2WWRA 4RCVA 3M1AA 3D0OA 1A9YA 1LRKA 2X5OA 4YQYA 5LDGA 3WBFA 3V5NA 4MVJF 3WYCA 2O23A 2NU6A 1W8DA 2DU8A 3D7LA 1PTJA 2ZTMA 1I2CA 2EGHA 1UZNA 3OMLA 2EERA 1B8VA 1R4NA 3GGPA 4O59O 4NHEA 2DVMA 1NQAO 4PZCA 3QQPA 4MJLA 3A28A 4AJJA 2JKVA 1G6KA 1MX3A 3VH3A 4EYEA 5CDSA 1NP3A 1QLJA 2AQKA 2DQ4A 4NZ9A 4QO7A 3WQRA 4BNVA 3KLPX 1O0SA 4CR8A 1LA2A 4BOYA 5DN9A 3PZRA 4BO2A 4IDFA 4CV0A 5EQFA 1KETA 5CDTA 2GN4A 2HMSA 3AWDA 3FNGA 3OIFA 1UXKA 3JTMA 5LDHA 4KQWA 4OO3A 4D7AA 3TFOA 1PR3A 3EZLA 3WICA 1LU9A 3BIOA 4R01A 3B1FA 3VAZA 4CM8B 2G1UA 3PEFA 5MGBA 1RYEA 1MG5A 2GZ3A 4I08A 3DDNA 4JQCA 2E82A 3CMMA 4IJKA 3DONA 2PKQO 4QTZA 5EQDA 4XRRA 4RVGA 3BMCA 2YV2A 4B4OA 4JNKA 1JKJA 1HZZA 1NX6A 3ITDA 3GVHA 3CTMA 4WCDA 1HE2A 1NBOA 2C82A 3QWBA 1C0IA 3FF4A 1NPDA 4KP7A 3EUWA 1VL6A 2UVDA 1GV1A 3JD1A 4B7XA 4AL4A 4KTVE 4MVJH 3BMOA 1E3LA 4KWHA 5KOIA 4DA9A 1PSDA 3NUGA 2OO5A 4DREA 1HT0A 4J9VA 1EDZA 4CQMA 1NAHA 2GASA 3AU8A 4A10A 2NADA 1ADCA 2PR2A 3OA0A 3TZ6A 3ZWXA 3GGGA 4FD3A 4L0QA 4GBJA 1MFZA 3QWAA 2NSDA 5CPFA 1A72A 2W2KB 4A0SA 1YVEI 2WM3A 1C1XA 1B8UA 1C1DB 2EJWA 3FHLA 2Y99A 4HUJA 1JLLA 1PJCA 1C0KA 5CHEA 3ROKA 3GZNA 2AEMA 4D42A 2FR8A 1QYWA 1R15A 4E13A 4OJNA 3WXBA 4EEZA 1YL5A 4PLFA 1EUCB 4B4UA 2LDBA 2P2SA 5IDXA 2DFVA 4TRJA 4PRKA 1P1KA 3PLNA 1BDBA 2EJVA 2GZ2A 2WE8A 3DQPA 4M55A 1V8BA 3PVZA 4I1IA 5C3MA 1WMBA 4H7PA 2DFDA 4O0LA 1HDRA 2CD9A 4NU6A 5JFOA 4JJGA 3WTBA 1XU9A 2O50A 4ND3A 5TLSA 1K6XA 3K31A 3KB6A 2P4HX 3I52A 4XB1A 1ENOA 1YQXA 3I83A 3BXXA 4CM3A 3KYCA 3GHYA 2BGMA 2PD6A 4BIIA 4RVHA 1AE1A 1JVSA 3AY7A 3JQAD 5L3ZA 3B1JA 4MVJM 1NQ5A 3ANMA 4PVDA 4GLOA 4L4RA 1ZK4A 4WLVA 2Y93A 4PIVA 4E4YA 3NDJA 2PGJA 3OETA 4H3VA 4NJMB 4Y9DA 4ZJUA 3PDUA 1KEPA 4O1MA 1ZUD1 2NU8B 5JY1A 2G5CA 1OOEA 1YBMA 1MC5A 3WQQA 3EK2A 3GEMA 5TNXA 1N92A 1QYVA 1P0FA 4RVUA 1HSZA 4TSKA 1HE3A 1JU9A 2VWQA 3LC1O 1TI7A 1E77A 5IAAA 4PG7A 4Q3DA 4BGVA 4OMUA 1C1DA 4R16A 3WGOA 4JJIA 4MPDA 4MO2A 1MXHA 3QWFA 1R0LA 4J91A 5KVQA 1A27A 4GL4A 3O26A 1JW9B 3VOSA 1R6DA 3IQDB 1ZZEA 1YDEA 2NLOA 5HA5A 4Z3DA 4N18A 1X14A 4BNNA 3ZNQA 1E92A 1K6JA 3VPSA 2EP5A 4NBRA 1QLHA 3KXDA 5KTKA 4LISA 1GV0A 4PLPA 1K0UA 2E4AA 3AOEA 1U7HA 4GX5A 4Q3NA 5EPOA 1D3AA 3OJFA 2PZJA 1RM3A 3OQBA 4E3ZA 2XXBA 4YRAA 5HWSA 5KKAA 3CKYA 3DHYA 1RKXA 4Y6SA 1XDWA 3RCBA 1UXHA 2AQHA 2G76A 2JD2A 3PIDA 4ZQGA 3RAJA 4A27A 4BO1A 5L7TA 1YONA 3V8BA 4BO9A 2HK7A 3AM4A 2BGKA 4N5NA 3Q2IA 4DPKA 3G79A 1DPGA 4IS2A 2A9FA 1YBAA 3ZU4A 5A3VA 5L7WA 2YUTA 3MEQA 2X0IA 3C24A 3OM9A 2FPGA 1ADGA 3UVEA 1VSVA 1VKNA 2P9GA 2NQ8A 5U1PA 2B5VA 2E48A 4B4VA 2RH8A 4BV8A 2FP4A 3VTFA 3C1AA 4UVHA 2VQ3A 3GNQA 5HTOA 3AI1A 1ZK1A 4Q3CA 4OSOA 5THQA 4GMFA 2NUAB 1GR0A 9LDTA 4XYBA 3JQDA 3CPSA 4L76A 4N5MA 2JFGA 5AXDA 2D5CA 2PH3A 4UEOA 2QX7A 3Q6IA 3DHNA 1ONNA 4BVAA 4LMPA 1B14A 1Y8RB 4PN3A 3VVCA 5JCJD 4OAQA 4EGFA 1Z75A 1MLDA 4RF3A 3WGTA 2W2KA 4WNIA 1E1MA 5AYVA 3DZIA 4LVUA 2C0CA 8ADHA 5ILOA 1BXGA 1LBEA 1QR6A 5DNAA 1NHGA 2HMTA 1H6DA 2Q4BA 4J1QA 4ZU3A 3LU1A 1PWXA 2Q49A 4BMSA 4CQLB 3IL2A 3WMXA 2H63A 4Q9NA 3UICA 4XYLA 1NFQA 2BLLA 3C7CB 3TL2A 3ASUA 4YACA 4O6VA 1I2BA 2OP0A 1PWZA 3UCXA 3TF5A 4PVCA 4XYEA 2AMFA 2CDCA 3LK7A 2UAGA 5TC4A 1GCUA 4GLLA 1PJTA 1Q7GA 3VPFA 4U6QA 4EUEA 2Z5LA 3ADOA 2Q2QA 2EXXA 5EL0A 1E6WA 1KVQA 5H82A 2Q4EA 3KYBA 5I7EA 3BMCB 3GUYA 4TVBA 1NHWA 1BRMA 4PLCA 4J7CA 1U5CA 1U8FO 1T25A 1NVGA 3K9QO 4BO8A 4BO5A 2FPGB 1AGNA 2DPGA 3GMSA 2O3QA 3ZWMA 4BNYA 4CLEA 5IFLA 3D4NA 4PZEA 4BNKA 2XXJA 2NTVA 4BS9A 4TZKA 3WR5A 1PZFA 4AJHA 3CMCO 3PK0A 5J23A 4RLSA 1NVMB 3E6AA 4HADA 3TJRA 2V65A 1LTHR 4JN6B 3WBBA 4DL9A 1SEVA 2AG8A 4ILKA 1PL8A 4E0BA 3BZUA 4NBTA 2WDZA 2OBNA 3C7DB 4XRGA 1MV8A 5IZCC 5CP8A 4BKQA 1IYZA 4RF2A 3FSRA 1EK5A 4PFJA 1UZLA 4Z0TA 4MKXA 2P4QA 1XA0A 4XQ9A 4D45A 3D5QA 1N9GB 1E1KA 3H2SA 1C1XB 4OXNA 3TN7A 4MP6A 3EGOA 4R1UA 5F1PA 1XLTA 3UF0A 1P1IA 1T2FA 2PZLA 3PIIA 3RU9A 3ST7A 2QRKA 1ZFNA 4MVJG 1QG6A 4HWKA 1A4UA 4KDEA 4BGEA 5IXSA 3ONFA 1P1RA 4WASA 3KYDA 4NQZA 4RQTA 4OIMA 4YJGB 2PH5A 3HZZA 4ND5A 3SJ7A 4DLBA 3S8MA 1HLPA 1R12A 3STHA 1SAYA 5KNLA 1HDYA 1WVGA 4A73A 1ZK2A 4ALKA 1PQPA 4FJ2A 4YB8A 5HBRA 1PGQA 4TZTA 3PFWO 4J4HA 2YYYA 3B1KA 3FPCA 1E3WB 2I67A 3F5SA 3R3JA 3AI3A 1GUFA 3BMQA 4D44A 3L4SO 5GY7A 2JFHA 3INTA 4CMIA 1CF2O 1EZ4A 1XIVA 1PIWA 4Z0PA 2VNAA 4II2A 5AQ1A 3IUSA 3I6IA 5G4KB 3MWEA 3RBVA 4GKVA 1PJBA 1ZK0A 2UUPA 3M1LA 4NU5A 5JYEA 1SEPA 3QVWA 2DPHA 2BFPA 4AJKA 4UVIA 4WECA 3BTUA 3U62A 4ZA2A 3WQSB 2IODA 1HRDA 4ID9A 1P3DA 1WZEA 1PZHA 1IZ9A 2QZ9A 2X0NA 3I9JA 4K28A 3KEOA 2X9GA 4K26A 4AJLA 1VI2A 3COSA 4RZIA 4DMMA 3AY3A 4BNZA 4OQYA 5JDIC 3HUDA 3FRJA 4URFA 3OQ1A 1FMCA 3ZV4A 1K3TA 3U5TA 3IC5A 3VVBA 3FD8A 4E2ZA 3GDOA 4D3SA 3X2FA 4WLNA 4B3HA 3ZWPA 4CM9D 2YHIB 3GHHA 5IF3A 4CM6A 1JKFA 2AXQA 2G82A 3DEYX 4DQUA 2D0IA 3NT5A 2IE0A 3EW7A 3TDKA 4AJPA 5THKA 4WKGA 3ROMA 3IKTA 4DC0A 1EK6A 2X4GA 1GYPA 1U2GA 4HFNA 5A06A 4ZICA 1NPYA 1OZAA 3JD3A 1DSSG 3F46A 5HS4A 4HFRA 3HADA 1DIAA 3JQGA 1NR1A 4AG3A 1JA9A 2Y0CA 1F17A 1PJLA 1MFPA 3QP9A 3NTRA 1BXZA 3HDHA 2EP7A 2XOXA 4ZVVA 4U0KA 5GZ3A 3ZHXA 4II3A 2W90A 4HBGA 1FK8A 3I9KA 1SOVA 3QVXA 4D79A 5IDWA 2PNFA 2Z95A 3CIFA 1E7RA 4W99A 2PGDA 1JTVA 1BW9A 4W4TA 4A26A 5T8KA 4C4OA 3KUXA 4RF4A 3ROPA 4CLOB 3MOIA 3ZNPA 4YA6A 4D46A 3WNVA 2HUNA 5I7VA 1SNYA 3ETGA 2POQX 1R0KA 1GTMA 3HE3A 1SCUA 2O3UA 2PTGA 5KVCA 1TB4A 4LMRA 3QE3A 4CMIB 1H5QA 4ROSA 1BSVA 4B4WA 3RFVA 2B4RO 3U4DA 3BTVA 1O8CA 4GAEA 1X0VA 4KMSA 3NJ8A 3HN2A 4CLXA 5EN4A 3PQFA 4P38A 1Q0HA 5G0WA 5G4LA 5C37A 2VRCA 3EHEA 2X22A 2WD7B 1N9GA 3WJAA 2EIHA 1GU7A 3AUSA 3DFUA 1CDOA 3HHPA 4LCEA 3NAQA 2Z1NA 2ZB4A 5JCXA 1Z7EA 3E9NA 5JYDA 3B6ZA 4PLTA 1V35A 3I9LA 1QRRA 1KVRA 3ICPA 3KV3O 4YVFA 1WZIA 3TQHA 2CSUA 3ENKA 3DBLB 3HQ4O 3LYLA 4RPLA 3RUAA 2X1HA 3QVTA 4K1LA 2FPPB 3PTZA 3PYXA 2BI8A 2PY6A 1HYEA 3GUCA 3HFGA 4YT5A 4WOJA 5IZ4A 2BMAA 4IZIA 1E6EA 3IJPA 4YT8A 4CUZA 5KIAA 4RO0A 1I01A 4J0EA 4YJHB 4J0FA 3IUPA 3OBBA 2NUAA 2YDXA 5JLAA 3ABIA 3BAZA 3O4RA 2QHXA 1HLDA 3GVCA 1IUKA 4CMJA 4W6ZA 2ET6A 3PJGA 1LXCA 1NQOA 5A9RA 4R54A 4XQGA 5JCJA 2J6IA 4DRYA 2C5AA 1RM4A 4J1NA 4AJ1A 3ZHBA 2WYVA
chains in the Genus database with same CATH superfamily
5BR8B 2XMZA 4FCTA 1V96A 2GBFA 3WB2A 3UT6A 2IIVA 3AR7A 3TQRA 2V4ZA 1IZ0A 3NPAA 4D26A 3ZLUA 2F17A 4RIFA 1BFUA 4RFVA 1AGPA 4CF7A 1A8SA 3OX1A 2PL5A 4OHKA 4N4AA 5AKIA 1PR5A 3H1GA 2FQYA 4MCIA 4M4SA 4RZ2A 3BB3A 2QW0X 1DAFA 1A0OA 3C3XA 1JNXX 1WM1A 1GEGA 2BDTA 4FFSA 4MAAA 4R8LA 4RK0A 3WK8A 3DA8A 3WSVA 5AM2A 3D7NA 2GCGA 4IIHA 4K2HA 3THOA 4LHSA 4K81B 2IIQA 1H9CA 1TZKA 1UC9A 3R3SA 4Q66C 1TZBA 2W4QA 5EP4A 4RORA 3TI9A 1I2AA 3CJTA 2GEJA 2GGSA 4LIPD 3G7NA 4PCVA 5L51A 1A9XB 2WJ6A 1UJ2A 2ZJBA 3WZMA 1OT5A 4FB4A 4LE0A 3HA5A 4OM7A 3IBYA 4UUPA 2B35A 4UUBA 3WP1B 4JJ4A 2EU8A 5AJYA 4CI0B 4N12A 5K0SA 5JBIA 4WFKA 3DEJA 1WAMA 3CUVA 2BJWA 2JDIA 5FEUA 4HAXA 4YJ2B 1R5OA 2IDZA 3FY4A 4IUYA 4UMEA 1XLUA 2PX8A 1YZTA 2AKAB 1T6NA 4TWAA 5EESA 4PO9A 3RYIA 4B4DA 2K7FA 3IP1A 3EA4A 4OQ4A 1XRLA 1E96A 4KR0A 1E3WA 2FRDC 1E3EA 3FSEA 3ABSB 4ZP1A 5A0TA 1OI4A 1SIWA 2YVUA 1I2ZA 2QLNA 1AQLA 5KYKA 3NJRA 1DJMA 3M5WA 3I62A 3NM4A 1CSEE 2NO9A 1T8SA 5LKRA 2IHNA 3BFXA 3LWBA 1MOPA 4E7OA 1JKMA 1DG1G 1RJWA 1GSAA 1MP0A 2HF2A 1CZRA 2IPXA 2QVXX 3B89A 2PLFA 3H2GA 3WRXC 5IWCA 1OWNA 2BR4A 3FI0A 3NFRA 5TPZA 1THZA 3ILXA 3HXTA 1U0JA 4DLXA 4JC8A 5IWAB 4EB6A 2P4SA 4RX1A 3PL5A 5AK4A 3DZJA 4OP3A 4KH0A 2A1UA 3ULKA 1I8TA 5LQMA 1GZ4A 1QZ3A 1ZMRA 3HJGA 3P2OA 4I1SA 3SYTA 1B2LA 5ES4B 3ZE1B 1RWBA 3H2KA 5TGZA 2RIRA 2DT5A 1A7KA 4QHSA 1JEYB 4GKJB 1VC2A 3W4JA 4URHA 4EX6A 4ZI7A 5A5DA 1O97D 1O6FA 4DIMA 1JJFA 2BI7A 4Q93A 4W9NA 4WXRA 1JDUA 3SHQA 1I51A 1M34E 3OHMA 4NFHA 1ZP6A 3R9IA 3VO2A 3VDNB 1Z33A 5DYTA 3I64A 1JQLB 5DNWA 4AVYA 5J1TB 4REOA 4Y2JA 1VJ1A 3FJYA 2O8FA 5IJXA 4Z1MD 4BRZA 3CGWA 4E6PA 5IT5A 1YSCA 3UQYS 2JIOA 1NW8A 3N9IA 3QVSA 2V6BA 1X2EA 3CR3C 3LJKA 4H15A 5DK6A 1TEXA 5EJIA 5LC1A 5P21A 4DQXA 2OEPA 3R7BA 4YJFB 1P4RA 1E98A 2DR3A 2NVUB 1SCAA 2G28A 2ZJ4A 5EYPA 1C30A 4TQ9A 5DVZA 4M8LA 4PTLA 1FVFA 3GVIA 3AL0C 3UB4A 3G8CA 3E48A 1Y6FA 4MOWA 4I2NA 4XVRA 2I87A 1KJ9A 1TM2A 2XF2A 4TMFA 3CUSA 1LLQA 1M1YB 1PX2A 4NESA 5IMBA 5CYFA 3V4SA 4PV7A 5CHYA 4HH1A 3TSCA 1X7GA 1IFXA 3O2SB 4O3FA 4MUFA 3A1CA 1OE0A 1Y1RA 4XWGA 3LM8A 3U81A 3E3MA 2C78A 1E1RD 1WNTA 3DUFB 2ADOA 3R41A 5CGQB 5TMDA 2FYTA 5CA1A 2C95A 4BKUA 1AB5A 2UZ0A 2ZSBA 2INGX 4KO2S 4ZC8A 1EJ6A 2IYAA 1M8KA 1ZK3A 3QA3E 4XXHA 4CF3A 2C7RA 4DKJA 1KYQA 3A10A 3UTCA 4LGCA 5F78A 3Q2KA 5E1DA 4HB3A 2FSGA 2YXLA 3U3MA 4RGVA 1DG9A 1MGPA 1U0NA 4TVKA 1XJ5A 2GTIA 1EDDA 5KREA 2DMRA 2O3RA 3QVGB 5I7HA 4C20A 4F71A 2PV7A 1UFVA 2YWBA 2JA2A 4MYHA 2GESA 5DCUA 2QRVB 1W1IA 2ZR9A 3DBHA 2ZBDA 3KWLA 1WUKS 2Q3CA 2P6NA 4ZVTA 3VOBA 2VTVA 1YMQA 1N8SA 1O9HA 2N42A 4HNAB 4JI6B 2IPNA 4FW8A 4DDWA 1PS0A 3U0BA 3EASA 4RUKA 4M9UA 3KCQA 4RELA 3MQ2A 4DUYB 3UG7A 3I61A 4DA0A 3M5CA 1MB0A 1CQIB 3BGWA 4QYWA 1Q91A 2YHBA 4D97A 1C29B 2RGDA 3LZ6A 1NBWB 1UKAA 1XWFA 2VQ6A 2GYVA 3AETB 3NIWA 1V2HE 4J7XA 3MPOA 1FP4A 4CWAA 4EG3A 1C3OB 5GV7A 4RABA 4URVR 3HWX1 4EIWA 2FEAA 5IP5A 2HNBA 1EFRD 3MUFA 3TXXA 1LSSA 4DFDA 3L5KA 1XKXA 4I36A 3DBLA 1IY9A 2GZSA 1AKEA 2JW5A 1SOAA 3O3OB 4DJDC 2WYWA 2PKQP 4L4SA 5JARA 3K15A 2Q6IA 1X80A 1XDSA 1Z5OA 4XKJA 5E9JA 4RLFA 3PKJA 5BWBA 5JHGB 4ZK2A 1ZD1A 1GPDG 3A32A 1LJLA 5EP1A 4BATA 4DXDA 3H1PA 4F72A 4MINA 3A6PC 4YWJA 3KLMX 2QXTA 3DEIA 3RW9A 1RYDA 3U39A 1NBMA 3IDOA 2R1TA 3K5IA 4NEQA 4XWAA 1D2HA 3VHXB 2XIQA 1M34B 3OLWA 2O48X 3EOZA 3D64A 1OLXB 2PRIA 3W06A 2B1JA 1FMLA 1TU4A 1BMTA 1Z6GA 4UQPA 4DA4A 1PT5A 1GXSA 1FFGA 1ORHA 4UOZA 1DIHA 2E4WA 3FROA 4HZUB 4MI6A 4O4IF 3EGIA 5H02A 2TMGA 2V0CA 3OPMA 1B73A 3JAWB 5F1OA 5CB6A 2RG1A 1MEOA 3LO5A 5EWJB 3TPCA 5H1YA 4N0DA 1O57A 3ZDAA 3RFTA 1OX4A 3SZOA 1T6YA 3ZDYB 4UZEA 4DRXB 1MABA 1PNOA 3SVZA 3NT4A 4UEKA 3UMVA 4MW1A 4A82A 3LTEA 4DBZA 4OYLA 4QBGB 1LBQA 4YCMA 4F5YA 5DX8A 5JG7A 3TO5A 1SUIA 4CL0A 2AI2A 3LL4A 4Z4EA 3HVUA 4FFNA 5FPTA 3G1UA 1VPEA 2OQ2A 3C8UA 2BGLA 13PKA 2XKKA 4DBLE 4KBYA 4S12A 2PUAA 3DCYA 3IOYA 3WGKA 8OHMA 5IVKA 1RXYA 5ALGA 1FXUA 3TQCA 1MJFA 1JBEA 1EHYA 3HCCA 3HFSA 6GPBA 2X7XA 1NE2A 4FFPA 4OX9B 4PSVA 3EF3A 4LYYA 2GCOB 3FPAA 4KSCA 2WYHA 4IV8A 1E20A 2ENWA 2X4IA 4MR9A 1T8PA 5DRTA 1KJNA 1UP6A 3GYGA 4OXRA 5KHAA 3U31A 1D6NA 3U7HB 3GUUA 1SGWA 3G2PA 3BGSA 1NNUA 1R27A 3H99A 1Q1BA 2X42A 3FAZA 4N65A 1XU7A 2A0XA 3WLRA 1BJTA 4EPWA 5F12A 5FUMA 3TVTA 2C57A 2QQGA 1S2DA 2Y77A 3HCWA 2VK4A 1DRUA 2IZ5A 3KDAA 1TFUA 1T2CA 1TEHA 2HLPA 3R76A 3RWBA 3D7SA 2IHUA 3P2EA 3Q72A 4HRVA 4O5OA 1NYLA 1RRKA 1IHOA 2GN9A 5M3BA 1W5FA 3ZHSA 1NDQA 1Y37A 2C2BA 5IJ9B 1OWLA 4LBWA 1T0IA 3QPWA 3PCRB 5JQGB 3DDUA 5DHQA 5EP2A 4NCHA 3HVHA 3MRVA 2OGTA 3H19A 5BNZA 2GAOA 1VE7A 1FFDA 1ORIA 1TRHA 1XZFA 2ZVDA 1DMSA 1NUHA 1Y7LA 3TLXA 3WSTA 2AUTA 4CPDA 4CTNA 1PGOA 1ZSNA 1N2IA 2NO6A 2PAFA 1AU9A 2XITA 3ZHOA 3DAFA 4LJ5A 5HOQA 1NMQA 5EMKA 1F51E 1VMEA 4G84A 4RZ3A 1VE3A 2BEKA 4FNOA 3DV0A 1ZVVA 3EZ7A 5BSVA 1P2FA 4QWMA 4UUOA 3MJTA 4BNMA 3CCCA 2RC5A 4WPGA 2VUSA 3R6GA 1TJNA 3DQQA 4EWLA 4EJSA 6PFKA 5EOVA 1NDUA 4AO8A 3C16C 3U4HA 5DYYA 1W34A 3AIOA 3HEAA 4AG5A 4UATA 2WUWE 3I1JA 4IQFA 4F92B 1ZMXA 5AVVA 2B3TA 2WAMA 4PO3X 4L07A 1C8BA 2YWHA 1G5QA 2IDJA 3DR3A 2VRNA 3DZGA 3E18A 3LE8A 3P45A 2HF8A 4IQ0A 5JO9A 5LZ7A 3KKEA 1UK9A 4V38A 5AOAA 1T2NA 4W7HA 5LDDC 1L8XA 2EFCB 1XTZA 2IHYA 1OAAA 2Y1OA 1QC5A 1OX4B 1ZYUA 4RY0A 5J2TF 1NUPA 1YJ8A 1Y3AA 1H6BA 1YUMA 2D5LA 2WWWA 3B8EA 5AKHA 4BYMA 5I7UA 5KVSA 2PLWA 1EUDA 3D7KA 1IJFA 2WSIA 2M9MA 1QFMA 4XZ3A 3RC7A 1Y4DE 5JAQA 1DHRA 2JGDA 4NYJR 4GL2A 2HDWA 2ZRQA 3BXOA 3C4JA 3AKCA 1SO8A 1Z4MA 1L7DA 1ESZA 1VJTA 4D6PA 3AR2A 2IHJA 4GI2A 4DYHA 4O4LA 4L5AA 1M67A 2R6R1 1E0DA 1MO4A 4DSTA 1XMXA 3LH5A 5LP6C 2WJWA 5L6MB 1XZPA 3DMFA 4DHWA 3KJIA 3VDMA 1G8SA 4YRRA 4HQ0A 1KFEB 1ZMBA 2C9BA 4GC9A 1G98A 5EERA 1DOHA 3WLAA 2AR0A 4JYCA 3L49A 1DBIA 4UE3S 1H2XA 1WKVA 5J4HA 4OIFA 1W4CA 1EPUA 2W2PA 4MJ3A 1RM0A 4EPVA 3N87A 3LECA 4NV3A 2OC9A 4DIFA 1LLUA 2P2ZA 4WZZA 2AG5A 1LSOA 3AUAA 3SYMA 4CDGA 3ZLTA 1U7TA 2I7DA 2PMDA 2A92A 4CM7A 3DFIA 2VF7A 3ZK8A 9ATCA 4J3NA 3L4JA 3UXYA 3GROA 2LTAA 1B1AA 3EEFA 5HKBA 4QYIB 2OFXA 1JKXA 4L3WA 4QOFA 3ZZ1A 1QQTA 4HS9A 5K0JA 1SVOA 3GMDA 5JE8A 3EPPA 4BJ1A 4UFPA 3RADC 1AKWA 3P2JA 3GQVA 3CRW1 3ZH9B 1DJNA 3DMTA 4B7ZA 4EZBA 3FPBA 4WLEA 2PSSA 2J4FA 2WJIA 2ZIWB 4LVCA 4OLBA 5KYWB 2IS2A 2PA0A 3W9BA 4WJLA 5ALYA 3S44A 1PYOA 3MWLA 3WMGA 2LPMA 2QRQA 5I3ZA 5ALPA 3VOTA 4R8KA 3FGPA 3WL7A 4MV3A 4OFWA 4N0EA 4LFCB 4FYIA 4KCGA 4JBYA 2I66A 3L6DA 4G0OA 4YGYA 1LF0A 4MR8B 4JYPA 1VKOA 1RIFA 2D4AA 3PUHA 1O4VA 3HVRA 4Z4CA 4DILA 1RKBA 1ENYA 1EX7A 4P4NA 4DPMA 1JZTA 1NTRA 3PGMA 4RLHA 5FFFA 3PHCA 3TGWA 1A5BB 4U5QA 3WAGA 3JARB 4NDNE 3LG2A 4GVLA 5TS2A 4J03A 3G2OA 2IXAA 3RRXA 4X54A 4CG3A 5A4DA 3BGVA 2HK8A 2YJNA 3FJOA 2G9VA 4X64B 2QX4A 3TL3A 4BO6A 1X8KA 4LJ8A 1LK7A 4OI0A 4NPAA 1WMAA 4C3VA 1KFJB 1ZD3A 4R83A 4TTAA 3TTXA 3FYUC 1Q1ZA 4FWIB 1W5AA 3F1LA 2GT1A 3EVTA 4J3FA 2J5KA 3D8HA 4A8TA 4YCAA 2JI8A 2P5UA 3S70A 1GUYA 2CMDA 5AJZA 2PIDA 4IQGA 4Q05A 1NUSA 3GJZA 4FX5A 1QYCA 1E5DA 2VHVA 1EK1A 4GDMA 2Z0MA 3P5BA 3TIGA 2YQ4A 1OAOA 1QX4A 1Y80A 1AKUA 2BFWA 3A2NA 2O2YA 1JEDA 3ABOB 4PG8A 1Z0FA 1GOTA 3I30X 3PQ5A 1QF6A 4OG2A 3NVKI 2FQQA 2HJSA 4D25A 1GJRA 4JX8A 3ILSA 1E8DA 2J5QA 3E7DA 1JQ5A 2VDUE 2W8ZA 1GFZA 1DQZA 1IM2A 1HM5A 2I76A 2MMCA 3MBIA 1HOXA 4DIBA 4WBNF 2Q9BA 5F5LA 1LBHA 4ZFNA 2R8OA 1OD6A 3ZXIA 2O57A 1N5IA 1LWNA 3FPGA 2C5EA 1F14A 3LLSA 3NG1A 4G25A 5MFZA 4B85A 3PD1A 1H66A 1XVVA 4CKZA 5ALNA 3I73A 4H3KB 3ONDA 3QU4A 5SZIA 3F8WA 2RAFA 4UEWA 4WOBA 3V1TC 1Z6TA 5EPEA 2ZJ7A 3IUYA 3WFIA 2QSZA 4Q1BA 4X9XA 5CVVA 4ND8A 5JPIA 3QVKA 4C0WA 4IDNA 2G4LA 4ZJPA 1XQ9A 3GEGA 4NENB 1IUOA 1UQTA 4OHOA 3VV3A 3FYHA 2MSCB 4KW7A 4YK7A 2WQZA 1E61A 4D8VA 5NULA 4XWYA 4WVLA 1Q95A 4MHSA 4EAQA 3Q1LA 2AZTA 2XTZA 1WX1A 2XOKA 5BURA 3S2IA 1IPHA 1BROA 2JHGA 2NYVA 1MB9A 3E5HA 3QMMA 4CMKA 1PK9A 1CWUA 3I9NA 5FX2A 2R1ZA 4FJ1A 1NSFA 4MS3A 3TNDA 1WXFA 2RFLA 2TYSB 1RXCA 2YS6A 1N2EA 4IIDA 3WHIA 1SKYB 2NWQA 3JZIA 5F2OA 4G8BA 1FFEA 1KI8A 2QYOA 2VQFB 2OHFA 7REQA 2VHWA 4W9MC 3EY4A 4ZCIA 2BCEA 3EZGA 5CBPB 5B6IA 3IIKA 1K92A 1RBZA 3H9BA 5IUKC 3NU1A 4E3WA 4UCWA 4BNGA 2EEZA 2JBHA 1FA9A 2X1MA 1UDWA 1JYSA 2AUNA 2LCFA 4H0NA 1ZHOA 4YRPA 2A94A 1Y8QB 3G82C 2PIAA 5KJEA 5TS3A 1M2OB 1E69A 1W73A 1U2SA 4XH9B 3TW4A 2C2MA 1KQOA 3N86A 4E5KA 2KYRA 1W0KA 4UBLA 3VR2A 4ZJZA 4KLRA 4BLOA 1W85B 1LNSA 2YVKA 3KKQA 3L8ZA 1T5SA 3NHWA 3P7MA 3PSAA 3AVUA 1P31A 2B5WA 2FZVA 2CY0A 2WWGA 3N8KA 2BBSA 4JR1A 3THYB 3PWKA 4DLUA 4MRVA 2GN1A 2V1XA 4TTRA 4ZXPA 1SC1A 1NI3A 4AJ2A 1IIBA 4HUQB 2BD0A 2EOAA 3OZFA 3WLTA 4P4GA 4C7OB 1WHTB 4RHCA 4C9BA 1NMEA 1Z15A 2VP3A 3FNFA 3JAKB 2E37A 3NHLA 3TE7A 1VHLA 5HEKA 3LRTA 4XWKA 2BBOA 3R3VA 2CHVA 3L92A 3A1FA 1SVSA 1FFBA 3DPIA 4RQAA 5IAKA 4MUBA 1JFFA 3RFXA 1K08A 5FPKA 3KJFA 3GA5A 4KV9A 4TV9B 5A3JA 2AZMA 1DEHA 2VPWA 2FPPA 3IEPA 4IR7A 1H2HA 5FAKA 1EK2A 2HJWA 1KZHA 3KVNA 1C4XA 1X1EA 4BUJA 1U8CB 4J49A 3PYLA 3RV4A 4RQUA 3TR0A 4RFSA 4DJ5X 2R97A 2FMXA 5K8LA 2OHOA 3KOUA 4XEHA 1ZIXA 2XMQA 4XWOA 4B34A 2OXIA 3TKLA 4ZMBA 2YIVX 1G19A 1PRYA 5DP1A 4HBZA 1UBKS 2Y8EA 3PC8A 4XR9A 5ALUA 2X0DA 2BM1A 1CUFA 1XPUA 3BMOB 1CDZA 3UFXB 1XAHA 2GD0A 3EPRA 3HKCB 3ICQB 1M75A 1GT6A 3JD4A 3ONVA 3ELWA 1AG9A 2XA2A 1JEAA 2CVZA 5DX1A 4N3BA 3G0IA 2F2TA 1DAIA 1XLVA 1NYRA 2YXPX 4RETA 4V02A 4C5CA 1AS3A 4K88A 4E2YA 4KFUA 5JNLA 3KG2A 1O08A 3KTFA 3L4BA 2M2IA 2NNLD 4JXZA 4Z3KA 1IG0A 1SCJA 2W6PA 3PGKA 4WY5A 4XSVA 2ZIEA 3C5CA 4ALMA 4C4XA 4LW8A 5JJLA 2OHVA 4Y2PA 2FCRA 3A4IA 4WJZA 5CLGA 1AIPA 5CDFA 4QLOA 3U4QA 5D85A 2OSBA 2VSYA 5HF6A 4HDSB 1PFYA 4KN5A 1FU7A 2YWDA 1BVUA 3FM9A 5CDGA 2CXOA 4F4JA 3R5TA 4IP0A 2GYWA 4KQHA 2DG2A 4AYWA 2XAAA 4WAUA 2DLNA 3AHGA 1ZO8A 1RNLA 3PFIA 4K9LA 3UJ3X 1H4QA 1IXSB 2OECA 2QT0A 3N5KA 4BNIA 1AQUA 1I4DD 2WA1A 2ZQ5A 4JOCA 1N36B 5BUQA 2Z56A 1X8XA 4OQZA 1OHHD 3IRVA 3O9ZA 3VZBA 5JZVA 2BGGA 1XNQB 4Y98A 3W8FA 4LRUA 5CA1F 5EIEA 3CVYA 10MHA 2CYAA 2PBLA 5JV5A 1VCIA 5DHSA 2O1SA 4RDCA 1NV9A 1TM3E 5LKAA 3KLOA 5IW8A 5FUVA 1XEAA 1U3UA 5C8ZA 1RLUA 3LXMA 4QGBA 2ZROA 3O1JC 4D8UA 3HB4X 2I7CA 1PZGA 2I6TA 2VYQA 3NOOA 3L05A 5DB4A 3A1WA 4B0PA 3IAEA 3JQ9C 4DDHA 2JCGA 3I2YX 1MGOA 4QUHA 4IIUA 4DWOA 1DKMA 2AC7A 3S2SA 5JI2E 2WWXA 1Z35A 3DB2A 1NA5A 2BZ0A 2QRHA 1TC1A 2VHEA 3AFHA 5CEFA 1VB3A 1W4LA 1M72A 1XMPA 2NTYC 3HU2A 4JOBA 2A3RA 3RVBA 5DK4A 5L3SB 4KX3A 1CQJB 3GLIA 5DN6D 3LDUA 3WG9A 3FNHA 4JJEA 4DTCA 4J0JA 3FOWA 5CA0B 4ERNA 1UK7A 3N53A 5JO0A 3Q5DA 4BQEA 1XAIA 4B75A 5LXTA 1XDUA 5A6SB 1UZUA 3P2IA 4ZRNA 4C6TA 1CVRA 2VJMA 4IXWA 1RWQA 3FR8A 1VBNA 1AXRA 3E3LA 3GEEA 3H16A 3O8OB 3CKMA 3MIIA 4LSMA 2ZBVA 4Q3AA 3LXUX 4RA9A 4TQAA 5G0SA 3TTYA 4CCAA 4CDMA 4YS6A 7REQB 2F3SA 2BFFB 2GXUA 4QTUB 4TTQA 5AP9A 2YUIA 3OECA 4BHTA 2H2GA 1DRJA 4JP2A 3EMVA 4RGYA 3T3NA 1LW7A 1TZJA 4S0XA 5DOZA 2Z4RA 1JDBC 4JODA 3WJ7A 1AHNA 5E3HA 4CV1A 1XL1A 2J7PA 4KVFA 4L4YA 5I7AA 2O0KA 4M38A 5IBCA 1T3LA 2N46A 2CNDA 2H16A 5EFOA 5BV7A 1ZU4A 3K9HA 3WNBA 4GEKA 5H4GA 3C6XA 2VTBA 1IIRA 2P11A 3NV7A 1DBSA 2QUBA 3H3XA 3OQPA 5CLIA 4ER6A 3STUA 3M6WA 4FFRA 4UNSA 3OCVA 4Q7MB 1FQKA 1PTKA 2WKSA 3LTNC 1MOZA 5U4XA 1XC7A 1Q74A 2NT4A 1IN6A 1UP7A 2A0KA 4TKVB 3RFUA 1U7OA 3P20A 1ESDA 4NMWA 4BLVA 5ARDA 5E7QA 5H3HA 4U7HA 2REQB 2Q2NA 2GD1O 5LBTA 4Q02A 3VPBA 4UOEA 1D0SA 4LUCA 4PLYA 5JSFA 1IQUA 3GDFA 1QHEA 2FZLA 2FGJA 3HLKA 4G5RA 2VZ0A 4YMVA 4L95C 5LM3A 1FYXA 1L3CA 4UBKA 2B36A 3WGZA 4P5PA 3RS0A 3QJYA 2R1VA 4G1CA 4CODB 1IHXA 4PN7A 3ZHCA 1RRGA 4GU5A 4BU0A 1ZR4A 1O95C 1T4MA 2VHCA 3WKCA 5KPDA 1M54A 3QM1A 1WETA 3MK31 1Q12A 3AFIA 3HVJA 4OFZA 3OJEA 3DD1A 3KB8A 1H69A 1IRIA 1HSOA 1KYYA 4N9WA 5ALIA 2A0UA 1VMDA 3KPUA 4P1ZA 5BVHA 2EBWA 2R7MA 1ST3A 5ICFA 5KEIA 2HMVA 3E4CA 4PLHA 2WNSA 5G4KA 3BOSA 1YA6A 2O1XA 1GYRA 1F2UB 2PX5A 3BSSA 1L9KA 1QO7A 4NARA 3JZFA 4LNAA 3N2ZB 3W8NA 1FSGA 4KNYA 1VLHA 4MV1A 3ZDRA 3U13A 3VDXA 2RGBA 1FSZA 1P0CA 2RSLA 4MZDA 1U90A 3PJFA 3PFGA 1UMBA 3DDSA 3KOXA 3VPXA 3IHKA 1MB4A 3S6JA 3EDCA 4MQ4A 4A2CA 2CXXA 1E1RA 1U1IA 4A23A 1ZKMA 4DZZA 1Y98A 5HKOA 1ATZA 2V6MA 2LKCA 1Q7RA 3VH1A 1A76A 3TG8A 4J1TC 1RI3A 3KTAB 5K0GA 2A1TR 3B52X 1ZNZA 4G0VA 2A9JA 1KVUA 2VHTA 3SSAA 2O7NA 2QN7A 2WRZA 5DN6A 2VDJA 2JL1A 3BILA 4BJ6A 2PX4A 1KDTA 3IOMA 4QXOA 4JBNA 1XZAA 3H5IA 3E8SA 4RA9B 5I8WA 5FUYA 5KNBA 2AG6A 3T95A 1MA0A 1T9BA 2Y1EA 4R2JA 3ZBQA 1G1AA 2CNWA 4V1CA 5TMEA 4JDPA 1BWSA 4NYIQ 1VECA 3COZA 4LI0A 2DWOA 3MTAA 1WF6A 1GUDA 4BO0A 2VL7A 4NZNA 5IM4A 3ICEA 1Z7GA 2K5UA 2IYWA 2HK6A 1DBQA 2BGRA 3DLTA 1QHGA 3NBXX 4FDTA 4HQRA 4F86A 3IDZA 2X7HA 2P1DA 2HJ9A 1LGYA 4LDNA 4CM8A 4Y9TA 4IWNA 4BJHB 4K6FA 4H17A 4RIEA 4EKYA 2VYFA 2W37A 3FGNA 1CJMA 4Q9LA 5T4FA 3H5VA 1UIMA 1U2GC 1I10A 3MLBA 1OAOC 4NCNA 5T6MA 4Y2XA 4DV2B 4WKPA 5EZQA 5GQSA 5HJ7A 5IVPA 3ZI0A 2AX3A 4D3XA 3ZDCA 1IEWA 5D3KA 3GELA 1JXOA 1W46A 1Y9ZA 3WNCA 3HJAA 4ARUA 3EULA 1IM8A 4CMGA 1XRNA 1QIIA 5KSOA 1ESNA 1BW9B 3L7MA 2GM4A 1WVMA 3R3WA 2EGGA 2HMUA 4YI5A 1HMPA 2GK7A 1N1EA 1K75A 4JI3B 3BJMA 3BSYA 1E18A 5B2FA 1G59A 2AEFA 2PTHA 1DG3A 4IJ5A 4TT3A 1N5LA 5DLPA 2EJBA 4XCVA 4MEBA 5IRCD 1JECA 4BQOA 1JPUA 3MJ4A 3G5LA 4ZRMA 2CYBA 3WZ2A 2GRAA 3QSGA 5F4ZA 2DBZA 3ZW9A 3QG1A 3OWHA 3CRQA 3T3GA 4LRTB 5CT6A 3HBNA 5LIRA 3TUJC 4J1TA 1QORA 1GYQA 1V8ZA 2BFFA 2H5IA 4N01A 3BVPA 4TOIA 4BUZA 2PQMA 4YYEA 2R00A 3VNUA 2XCIA 1UUFA 4UAUA 2F1IA 1JHQA 3I4CA 2IKSA 2P69A 1EGVB 2P3OA 3C39A 3KQTA 4II7A 4JXKA 4Y6PA 3HEBA 4XLZA 4YASA 1ML4A 1VLMA 4QGAA 4YJGA 5EZ6B 5J2UF 3BYZA 3UKOA 4EJFA 2G4VA 2PUVA 4OF4A 3ID6C 1PK7A 5DZSA 4HC4A 2GK6A 1BTOA 3PB3A 3ILYA 5I7OA 3GPDG 1CS0B 5TQVA 3UMRA 1LBSA 5JJCA 4FFLA 4L0MA 5LYYA 3V4ZA 2RHMA 1NR7A 2ZB8A 3DJFA 1PEYA 4XEUA 5T67A 3KTOA 2OYSA 2WAYA 4PBSA 3UHFA 3Q11A 3SR3A 4CF5A 3UC9A 3GZJA 4CT5A 3SKVA 4MRAA 3UFXA 3QOYA 2Q5HA 2C0PA 2R96A 1EFUA 1UDBA 3I1YA 4ZEMA 4E2WA 1BDMA 1Z6ZA 1J8VA 2OM6A 2BF7A 4Z8YA 1QIMA 3FCAA 2FNAA 3EXIA 4LXGA 1V95A 1V8OA 4XSGA 3Q9SA 2ZJ6A 1O6CA 3RV3A 4KR2A 3O4GA 2QPLA 3H18A 1F2VA 2WHPB 4AWAA 3A4NA 4JQOA 4CEIA 2VPZA 2ZANA 1LX6A 3A4VA 4ZOAA 4FYVA 1QZZA 4NFSA 2F9MA 3O8LA 2Y4OA 2XDQA 4R3UC 4DT1B 3T5AA 2ZUTA 1R8JA 4HAIA 1OYYA 4YJDA 4UXIA 4NECA 5EKDA 2ZAYA 1SKYE 1ILWA 2A7XA 3C87A 2YR0A 3A4LA 1S3FA 2V54A 4KDFA 5J9FA 3KETA 2HRQA 1XHEA 3CEAA 4HLUC 1POXA 1RKUA 1WIWA 4MSUA 2KWIA 2ZT5A 4PX2A 2AFIE 3PC7A 3IEVA 4CETA 2M6SA 2CV0A 3GPBA 1DU4A 4FONA 4ZPJA 3BXGA 3VYTB 2QW8A 1JQEA 3DV9A 3AETA 4DHEA 3GNLA 3AZQA 1QIHA 1NJFA 1W5TA 3OSUA 3K96A 3FPSA 5C1PA 3AH8A 5JS2A 3LUPA 4AFNA 1YTLA 4FKMA 1Q3KA 3NKLA 4YCCA 1L7PA 2AI3A 3TYXA 4ESVA 3ITKA 5TX7A 5HBGA 5H9WA 2C61A 4WCFA 4KVAA 3MYRA 3PHBE 4B81A 1X7XA 4HEHA 1LC0A 2E7ZA 1TKRA 2Y66A 4MS1B 4OHFA 2B37A 1UMDA 2RHOA 5GMOA 3OTGA 2ZJ2A 4AAYA 4EENA 4R8VA 1MB2A 2OESA 2QTZA 3BAFA 4D99A 5AK5A 4QNMA 1R8SA 1GARA 2CJPA 2FTKE 1ISJA 4MV4A 4PYQA 5DF1A 1E5VA 1U8ZA 3DBVO 4GYYA 1USWA 4I4CA 3RYFB 3ZHTA 1ONOA 4KFRA 1QTIA 3CB2A 3TZHA 1R3DA 2XQKA 1GU0A 2OBYA 4DR7B 1K8XB 1C9DB 1Q0RA 3X1DA 2DR0A 2AD5A 2CUNA 4IFBA 4PCUA 4K6CA 3WAKA 1QSGA 4MKGA 3INGA 3N75A 5D84A 3GRRA 3MJSA 4V03A 4DR3B 1RAFA 3KE8A 1FTYA 2FPXA 2BKLA 2G7ZA 2X77A 3DWIA 3QEMB 5CNIA 3RC1A 2C4VA 4HNVA 2Q8PA 3D54D 1L8AA 3OJWA 3FR7A 3K0CA 3RS2A 1E9DA 2G09A 5IYZB 3F9CA 2P6MA 4P33A 2C5HA 1D9XA 4RC9A 1LRLA 3SBDA 5CAEB 4ZANA 2IH2A 1J99A 2HA0A 4UBJA 1Z5UA 2PS9A 1E60A 4ZD6A 4U7JA 2EKDA 3GJRA 3SLGA 3JD2A 5E4TA 1XKTA 1JILA 2OGZA 4O2AF 2C8LA 4C7VA 3CEPB 3DE2X 4HLUA 3ZGVA 5C7IO 1Y5MA 1Y5NA 1P73A 2D1TA 2IYSA 4AXXA 2JIDA 4GR4A 1IHDA 2QMOA 3FPEA 4UHJA 1RYNA 2AJDA 5JXWA 3B3AA 3E4DA 3EJ6A 5IDVA 2ZI7A 4LY3A 1EQ2A 1IM5A 4U1RA 1I4LD 3MVEA 3IV6A 3OY2A 3QUCA 2H4ZA 2EBUA 4RK6A 1YH3A 5AI4A 1X80B 5FJIA 2WP0A 4MKHA 3VR4A 1NW3A 2WVGA 1PEAA 3MIZA 2QMYA 3ODPA 3V48A 3HJFA 1JJVA 4KBFA 1EAYA 4V0OA 1UMBB 2E49A 3NORA 5SZHB 1Y7TA 4JK3A 3VJMA 2PN1A 4DWVA 2ZZNA 2HJHA 2WINI 1B8PA 1U7XA 3ZV6A 5A4MS 1JSXA 4MIKA 3ADDA 3BICA 2BELA 5DGDA 1N2CE 2O7QA 3FMOB 3L1KA 3CRVA 1EE9A 2R1UA 2Y1LA 3RHTA 3SXPA 2CT8A 4BGDA 4M9RA 4BQFA 3FTFA 1JA0A 2J5XA 1DWOA 2A4KA 2I22A 2P75A 1RRFA 1R4NB 3R4VA 4HDRA 2VJLA 4K9NA 1U5AA 4PZYA 4RKEA 3CVJA 1GAEO 5G0VA 1TTPB 4N8SA 1T1RA 4BFWA 4RHFA 1UKYA 4FJ0A 3EC1A 2CDNA 4FP9A 1EVQA 3ZQJA 3MPUA 4D56A 3RJ9A 4NCIA 2EQAA 4G65A 1RJEA 4YJFA 2J3KA 3N2EA 2OV3A 5A4IS 3ANLA 3DNFA 3E7PA 4YDRA 3LA8A 4PZDA 3QFHA 4AJEA 4LNUB 5AIAA 3PWTA 3ABZA 3GLIB 3T7AA 3QI2A 4DJFC 2H4HA 1PFKA 1RLMA 3MOSA 3PC6A 5CK5A 3NWPA 4H1VA 2UZ1B 4KGDA 5HFJA 4JC0A 5TT1A 3AYXB 2CBXA 4GOXA 2P27A 1G8HA 2JASA 2PZAA 4DCJA 3GUHA 5J2UB 1WCIA 1XCPA 1CJVC 2ZIFA 2JJ1D 4ITUA 2WU1A 5LYJA 3ZZNA 5FL7D 5FOWA 2SNIE 3WYAA 2HRCA 2GCOA 2K87A 3KIPA 2ES4A 1KJ8A 2YWFA 2L18A 3HI4A 3OT4A 5AH0A 1I4EB 1XP8A 1DXHA 2GN6A 2HIMA 1KH1A 1R0RE 4HEA6 4H1WA 4Y2TA 1W29A 2ZI5A 3I9V1 2D54A 4CFSA 5BR1A 1HQYE 4F3TA 1YRLA 3IX7A 2QI9C 1KR5A 3NAMA 3JYOA 5CTAA 4ZAVA 3UPDA 1QFZA 5DNYB 1YRWA 1GXSB 1LV8A 4GR9A 4B35A 4BMCA 4URUR 2G8LA 1H0RA 1WCYA 3CZQA 2HV8A 1GO2A 4NZZA 1ZD5A 4OREX 5FR1A 1BYUA 2MHCA 1XD2B 3ELYA 2X8AA 3AR8A 4Y3UA 1DQRA 2PFGA 5IAJA 4DRXA 1TW2A 4FGUA 1NNI1 4YJ3B 1QG0A 1P81A 1T6BY 1POWA 3B5EA 4G0XA 3HZHA 2VXOA 4U2BA 5JCOA 3TSWA 1IE3A 2WF7A 3ZD6A 1EI9A 1F06A 1JZQA 3KRTA 3FCEA 1GQQA 5H7XA 3ESQA 4YUYA 1GKUB 4F4IA 3B85A 1U04A 3TCXB 1FIUA 4X3PA 3UJ6A 1AKMA 4WIAA 1GTVA 4HDMB 1ZH2A 3AJAA 2AW5A 2IUYA 4RBNA 3A26A 4YLEA 3VHRA 1JEQB 4MMZB 4RS3A 2FOLA 3K0AB 3M3DA 1XJCA 1V6AA 2J5RA 2JD1A 4KXVA 2CL7X 3W2HA 2EFHB 2O5EA 4N6OA 1JFVA 3JQQA 3OVMA 4L5BA 2X5KO 4TXNA 3ROQA 1NXSA 2QLTA 2NZUG 1T3TA 2C2KA 4L6AA 1PV1A 2IYQA 3GN1A 4O4HA 4QBTA 3SQMA 3WKAA 4BC1A 3WGIA 2HT1A 1M1ZA 4B80A 5IEJA 5LBIA 3HYCA 5L6LB 1EXDA 5ER9A 3M6AA 1Y1LA 1G21A 2BMFA 4A03A 4FFDA 2IEAA 1B2RA 2QAJA 2R44A 2BEVA 2QL6A 3HM2A 5JMWA 2OCXA 2J5BA 2XUQA 4Q3BA 1OYOA 2H52A 5CTJA 2ODBA 3MFQA 2PL9A 3ZCRA 4A0QA 5HRUA 2EW2A 2ZSHA 3R7LA 4OHXA 1Z73A 2A33A 1EVJA 2ZI9A 4MUAA 4GOKA 4KQKA 5K0LA 3WIBA 1TYAE 3KSUA 3IBGA 1ISPA 1WZCA 4RNDB 5EZYB 5G3ZA 3U17A 1PI3A 4U0JA 2BFBA 2ZDGA 5DDIP 1JHZA 3RRFA 3W4KA 1ML3A 1MORA 2NO1A 2GERA 2J32A 1X74A 4JT8A 1MC4A 4BECA 3MWEB 3SWWA 5HGXA 4NNPA 1L7BA 1U28A 2R6ZA 4I66A 2R1VB 1JFSA 2VDMB 2YJ6A 1X1AA 3EX7C 4G89A 1SCQA 1V8DA 4C5BA 2GCPA 2JDID 1AQ6A 3I2FA 2SCUB 4L8LA 4B31A 3PIRA 3WLFA 1J8QA 1Z2NX 2H3HA 3IAS1 2REBA 4IX1A 3A36A 3GQBB 5K3FB 1IOVA 2J45A 4M1YA 5FNVF 1M6HA 3DUWA 3F3SA 2AL7A 2ACKA 1KEEB 2IYFA 1M66A 5IHPA 4HNAA 1A97A 1IMJA 1XQ1A 2GPBA 2IP4A 1I2MA 3V32A 4F5ZA 1PK8A 5AFSA 2XLBA 5H16A 4KOEC 4AULA 2ODEA 3LF2A 1A9SA 1F8YA 4BFZA 2C2OA 3ESCA 2GEVA 4IAOA 2QTHA 1HGXA 3OWXA 1N0HA 2H4FA 2DUUA 1BWPA 3LSTA 2JIMA 2BGWA 2D13A 3PWZA 3VSEA 1XHFA 2WHPA 1XPOA 1Z82A 4AMVA 4J9UE 3GLVA 5I45A 3CLSD 4EFDA 3UH1A 3JYPA 1EUYA 2C42A 3L6BA 4TTTS 3KT6A 1A9PA 1TQ8A 2JNWA 2ZSJA 3GFQA 1DAOA 5DOVA 2JCXA 3OF2A 3HDYA 3MCTA 1LK5A 2VAMA 2MYTA 1F5NA 1VZ3A 4G41A 5DCWA 5GVRA 5CA1B 4DIEA 4E1BA 3WK9A 4AQ7A 1T3ZA 1BU8A 3RIHA 1K89A 1IWOA 2ZE8A 4XM0A 2HOQA 5F2NA 3I6QA 4IIGA 1JIJA 2H17A 1P6XA 1C7IA 4KAJA 5CJPA 1J2JA 3OCXA 1QZTA 4M36A 4HQOA 2H6EA 3U56A 4HX9A 5AVRA 5BWCA 2PRYA 3IPAA 1S3IA 4P2BA 4A5SA 4CM5A 2JH8A 2UUCB 1O95D 3KP1A 4WN9B 2ZUCA 5DTMA 1JDJA 2NAPA 3IBSA 4I1OA 1CG6A 1P2BA 4ITRC 1M0SA 3NEPX 3DBRA 4JL6A 4LRWA 4S2UA 1HDXA 3RTCA 1LJUA 3KB1A 2EP8A 3N8DA 3U1VA 3AHDA 4J0CA 1QHXA 3Q3EA 4EPYA 4R4JA 2IW1A 1NSYA 3HKEA 4YUXA 3I72A 1ULAA 3K09A 3QVLA 4YMTA 1ISFA 1TM1E 4GE0A 2ZS8A 1D1TA 5CR9A 3FI9A 4UNQA 2UVPA 5KNBD 5EINA 4LHEA 2WUDA