2NUAA

C123av mutant of e. coli succinyl-coa synthetase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNVPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 104
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nuaA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nuaA01
4F45A 5CAEB 2J6IA 2B0JA 2HDHA 3GRKA 4DIFA 3UFXA 3NT2A 3ZWMA 2PD6A 4EBFA 1ZUD1 3D7LA 1B0AA 3PWKA 5EQDA 3I23A 4CPDA 4BGUA 1LLUA 2GNAA 1ID1A 1UXIA 1YQGA 4UEKA 5K0ZA 5L53A 3IP3A 4N5NA 4JP3A 1V9LA 4QXMA 5FI3A 3WJAA 2R00C 4CLOB 3AU8A 2DAPA 3PQDA 4NBWA 4GH5A 2P9EA 3Q9NA 2W90A 4Q3AA 3UCFA 3U0BA 3LU1A 3UICA 1ZMTA 5JY6A 4D3FA 2X0NA 2YHUA 3JYLA 4A2CA 1E5QA 4WECA 2X5KO 1D1SA 1R37A 3Q11A 3ULKA 1ONPA 2RHRA 1NPDA 2GRAA 1T2AA 1VL8A 4IDCA 5ICSA 4CM1A 2NADA 1B2LA 1F06A 3RJ9A 4BNJA 3PP8A 3QQPA 2PGJA 3PLRA 3BA1A 4R69A 3ASVA 2OL4A 3GT0A 4I9UA 4NPCA 5BNTA 1ZXLA 5DP2A 1PS0A 3NKLA 2RBEA 4MVJH 2EJWA 4Z3DA 4E6PA 1J4AA 3ZHBA 4EITA 4B4WA 1NP3A 2RH8A 5JSFA 3OIGA 3UVEA 4BO8A 2B36A 3RQSA 4HUJA 4DRYA 4CV2A 4OIMA 4ROSA 2BFOA 3DXFA 4WLUA 1H9AA 1MX3A 1PS8A 4P22A 4PLGA 3ZWCA 2CFCA 4B4VA 3GDFA 1GUYA 3RKUA 4GGOA 1U3WA 1HLDA 1PGPA 4IDGA 3KEOA 4CM9A 2BFAA 3K5PA 4KUHA 3OM9A 3OIDA 3NT5A 4Z9YA 3ZZNA 3JQ7B 4BV9A 1E5LA 2AXQA 4K6FA 2B69A 1DFGA 3A4VA 2OBNA 2FPIB 2X9GA 6ADHA 1MC4A 3GPIA 4OM8A 2Y93A 1ZMOA 1QYWA 3IAHA 2JAPA 4BS9A 4NR0A 5CPFA 3HFSA 4CLOA 3LT2A 1WMBA 3DMYA 2JCXA 4WLFA 4K28A 3OF2A 4LCEA 3K2EA 3UH1A 5KVSA 5C7OO 4YACA 4CUKA 5TGDA 3HJAA 4MP3A 2HMVA 1E1KA 4BO3A 2EIHA 3PWZA 4FW8A 4MIOA 4RF4A 2IZZA 1M6WA 1E3LA 4PZEA 2VOJA 4YQZA 1F0YA 4CLRB 2O2YA 1F12A 2X0RA 2DC1A 3GHHA 4IJKA 2PGDA 3TZKA 4O1MA 4DLLA 2IZ0A 3DEYX 1RPNA 1C1XB 4M55A 4XQCA 1HEUA 4PZCA 1DLIA 1QKIA 2OMEA 1LXCA 4UVGA 2O3RA 4MVJE 5ADHA 3NYWA 4J1TA 1MFZA 4IM7A 3VVCA 3SLGA 1KETA 4ALKA 4CMHA 3F1KA 2ZB3A 4BO5A 1YKFA 2XOXA 1UZMA 3E1KA 4QT0A 4L0QA 4FJ0A 4O6VA 3U49A 2JD0A 3D64A 2DLDA 5FF9A 3WNQA 2NVUB 5EIOA 3GGGA 1BXZA 3JQGA 1BMDA 4NIMA 2WE8A 2ILTA 1UXGA 1ULUA 2CVOA 2R6JA 3HN2A 1C0KA 2BELA 3I6QA 2GZ2A 2PZJA 1BSVA 3V2GA 1MXFA 2C20A 2HMWA 1I30A 1LDEA 3ZWOA 1R12A 1ONNA 1I3LA 3WQSB 1YGYA 1P1HA 5JCJD 4RVFA 4Q3DA 2O3TA 2XF8A 3H9GA 3NEPX 3V2HA 1AHHA 3WMWA 2ZKLA 2X1HA 3DZJA 4QSMA 4AJHA 3ZHZA 3TSCA 1LUAA 1AXEA 2BLLA 1GPDG 3IDSA 2CSUA 1I10A 4GVXA 5DOZA 2AEJA 2AE2A 2RAFA 4ND4A 1DJNA 1QYVA 1CJCA 1A4UA 1O89A 2QQ5A 1B3RA 3JQGB 2D5AA 1YXMA 2E49A 2JFGA 3EGOA 4OSOA 5F5LA 4MKXA 2PR2A 4M8SA 1UZNA 3E18A 3ICPA 4NJOA 1E7SA 4ND1A 3U9LA 1SZJG 4PLCA 5T8KC 1P44A 1O94A 4CLHA 5DT9A 1SMKA 2I66A 4QTZA 1K89A 2X9VA 1CEQA 4J2HA 5A9RA 4IS3A 3ANLA 3AY3A 1EUDA 1ML3A 4KOAA 5C3MA 4JBGA 3TZCA 3FTPA 1OFGA 1PQWA 4F6CA 1YOVA 2VUSA 1YJQA 2BI8A 2VQ3A 1PGOA 3B1FA 2GN9A 3CPSA 3DBLA 3AJRA 1GY8A 2I5PO 2VHYA 1SPXA 4HV4A 3DMTA 1OBFO 2DTEA 3RC1A 1YDWA 2FZWA 3WQRA 4BOYA 3I9NA 4U0JA 2O3UA 1QRRA 2AQ8A 4BNVA 1H94A 3JQEA 4Y9DA 5AVOA 4BO4A 1E6EA 4J16A 4UVDA 2O7SA 4DLBA 3WBBA 1I01A 4AJ2A 3I83A 4G81A 2EJVA 2F1KA 5JFOA 1I2BA 2Y1OA 4GKVA 3GA0A 5FWNA 1VLLA 4RVHA 3GMSA 1IHYA 1YBMA 4FFOA 4NBRA 4XCVA 4YYZA 1R4MB 3GVXA 4RVGA 5AOVA 3FF4A 2YUTA 2J3IA 3DC2A 4DREA 2JJYA 1GQQA 1PZHA 3RU9A 4BMVA 1XDWA 4MJLA 5JDCA 3MZ0A 4JBHA 2PD3A 4IUYA 4YT8A 3ZWPA 5JDIA 3DWFA 4RVUA 4RZHA 4FIZA 4PLZA 1LQUA 3JQ9C 1CETA 4UUMA 3GHYA 4LN1A 4AJLA 4RQTA 2X5JO 4BV8A 5JC1A 2VYVD 1PZGA 1CDOA 2CMDA 5KJCA 2X0IA 5G0WA 5ER9A 5HA5A 5KKCA 2AHRA 2FP4B 3WR5A 5A5EA 1BHSA 3DONA 4IQ8A 4MVJF 5ILGA 3AM5A 3PJGA 4U6SA 4LMRA 1CQIB 3H5RA 3DZHA 1XU9A 1M2WA 1UDAA 4I9NA 3CEAA 3DBLB 3LDHA 1WDMA 3AUUA 1A27A 2UUOA 5KOIA 3AOEA 3BMOB 4N5MA 4RZIA 5B12A 4TRNA 3WSVA 1MB4A 4M89A 4R9RA 1H6DA 4NFHA 4IQ0A 2YW9A 2DTXA 3U5TA 2DBQA 1GFSA 1T1RA 1A72A 3LF1A 1HDOA 4IJVA 2ZTMA 2CDBA 4Z6KA 1A5ZA 1E1MA 5DNAA 4CM4A 2VWGA 3WIDA 1NQAO 1V0JA 3VPGA 3C1OA 1NWCA 1T2EA 4CM3A 3ZDFA 1EQ2A 4E2XA 3LT0A 1NVGA 1U2DA 4WLOA 1CQIA 3RCBA 4TZTA 4HNHA 3I3OA 3RUAA 1SO8A 3GNSA 2BKAA 2EGHA 4YJHA 3WDSA 5T57A 4D79A 3S2IA 3I4CA 1LTHR 4U5QA 3SC6A 2BGKA 1A7KA 1PJBA 2FPGB 5BNIA 3WGOA 3GR6A 1FDTA 5GZ1A 1ZK2A 4ND2A 2FR8A 1Z82A 2Z1MA 4KTVE 1U5CA 1WPQA 3TJRA 4PVDA 2D0IA 2HLPA 2V6MA 4OSPA 3E5RA 3IS3A 4MKRA 5CP8A 3W4IA 1E7WA 3DAGA 4HADA 3KTDA 4UAGA 1ADCA 4FDAA 2H5LA 3JD1A 4BB6A 3LVFO 3ZNPA 3LT4A 4XGKA 1GCUA 3GNTA 5L3ZA 1I8TA 4D43A 4EYEA 5IXYA 5I8WA 1SOVA 1P0CA 2IDZA 3P2OA 3TN7A 1KS9A 1F8GA 1DIGA 1LRKA 4WLEA 1V8BA 5I9MA 3L4SO 5IXSA 4GKBA 3TZQA 4O5OA 3I9KA 2NQTA 4KUGA 5LC1A 3IP1A 1BVUA 1DIRA 2J5KA 3QWAA 1LC0A 1HYGA 3TOXA 4GGPA 3D5TA 1QG6A 2WWRA 5BNFA 4J1SA 1J5PA 1Y5RA 3ENKA 4ID9A 1NPYA 2GLXA 4FB5A 2GO1A 1Y6JA 3GAFA 2R2GA 4NI5A 2VT3A 3SXPA 2YY7A 5JO0A 2Q45A 5DULA 1LBEA 4PCVA 4L4XA 2FOIA 1AHIA 4S1VA 2YQ5A 3FSRA 1BDBA 2VTEA 2ZTLA 4XGIA 4CLRA 3ONFA 2BFPA 3IQDB 2G5CA 1HDCA 3COSA 5IZ4A 3V8BA 2B37A 3GAZA 3H9EO 5BR7A 2FSVA 3BTSA 2X8LA 2P9GA 2CVQA 3GZ4A 4J7XA 1R0LA 3EDMA 2VNAA 5CPBA 1IPEA 2X4GA 4JROA 1SEVA 2VTDA 4G5HA 3ZWNA 4OO3A 2GN4A 4CMAA 5L4LA 3KSDO 5AYVA 4GI2A 3PZRA 2Y1EA 3VZRA 2WE7A 1O6ZA 5ENVA 4OQYA 1R6DA 2VNSA 3A28A 4IINA 4B3HA 5IN5A 4BNTA 4DBVO 4R16A 3I52A 3PJFA 4MVJP 1NTOA 2F00A 4R01A 4TRJA 1DRUA 4DYVA 4E5MA 1SCUB 4EEZA 4Z3KA 5JAIA 1T4DA 3F46A 3I4FA 1XGKA 1JWAB 5HBRA 3DL2A 4XRRA 1NYTA 1R4NB 3QRWA 3FNEA 3UFXB 3H5AA 1LX6A 4W82A 5F3RA 4BGVA 1P1IA 5G4LA 4PLYA 3UXYA 1YBVA 1LLQA 1WDLA 2EEZA 1HTBA 1GAEO 1GPJA 1SNYA 3EUWA 4EDFA 5IJZA 3UOGA 5JAQA 2PY6A 4CMJA 3KETA 5T5QA 3CUKA 4FPXA 1N2SA 3D3EA 4FFRA 4IMRA 3AW9A 5IN4A 4XD2A 2J5RA 1V6AA 4ZQGA 4BUCA 2WD8A 2NNLD 2CZCA 5U1PA 4BNHA 1LSSA 2AQIA 1K6JA 1HZJA 2AG8A 2UV8A 4GWGA 1PR3A 3KZVA 5CEFA 1EUZA 4CMEA 4F46A 3SLKA 5G0TA 1G6KA 3FNHA 1P33A 1Q7BA 4OXNA 5C7IO 1R0SA 4CV3A 2ET6A 1TT7A 5DF1A 4ZQEA 5TS3A 3RJ5A 4N18A 3F1LA 4DXHA 3NTRA 3U4IA 1TVEA 4I8XA 5KJ1A 3LF2A 1N7GA 3NDJA 2GGSA 4IZHA 4TVBA 4DPMA 3UF0A 4Q3NA 1WXDA 3WYCA 5LDHA 1E3EA 1U3UA 4C4OA 2YZ7A 3NTOA 4EEXA 3IMFA 3DZBA 2X5OA 1NVMB 4RQUA 1XYGA 1V3VA 3KYDB 1UZLA 1IZ9A 5CDUA 1KVQA 4GSKA 2RCYA 4I1IA 4IDBA 5MGBA 1XIVA 4ILKA 1ZZEA 5U4QA 2B4QA 4ZRMA 3HDJA 3E03A 3S2EA 1Z74A 1JA9A 4GMFA 1SB8A 4J90A 4E21A 4TROA 3C85A 1WZEA 2GF2A 4I5EA 2X23A 3G1TA 4NDNE 4LRTB 3ZU2A 1P77A 1X7GA 3JYPA 3U4HA 2VZ0A 2VYND 4L75A 3UN1A 2C2YA 5ES3A 4ALMA 4D44A 5IDXA 5F1KA 2Y1CA 1Y8QB 5TNXA 2HMTA 2BGMA 4J7UA 3UAGA 1E3IA 5EMHA 4B7UA 1M76A 3WLEA 5T67A 3R3JA 1EK5A 1NVTA 1HYHA 4MVJA 5A9SA 4DVJA 4OKIA 3WIEA 4JK3A 1QR6A 4NK5A 1NNUA 2EP7A 3EK2A 5EQFA 2VWQA 4BO7A 1LI4A 4XR9A 1RYEA 3KEQA 4NHEA 5DCYA 1HSOA 1TT5A 3RBZA 4H3VA 3ORFA 2LDXA 3BTVA 3QWHA 4AICA 3PXXA 2OHXA 1V3UA 4N54A 2PA3A 1NQ5A 2NU6B 4UEOA 3NUGA 5F1OA 4ZRNA 1LDBA 2I65A 3P7MA 3TZHA 4AJJA 4YVFA 1DC5A 1LLCA 5A4DA 1Q7CA 3OJEA 1EZ4A 2NU9A 4IIUA 5TT1A 3GH3A 3QLJA 1HWYA 5I7VA 5KNLA 3Q2IA 4ONEA 1KEWA 4YDRA 2O23A 2O48X 3QA9A 2P4HX 5DOVA 4C7KA 3KYBA 2XXBA 3B1KA 5BSEA 4E13A 4C7JA 3X2EA 1MFPA 3EVTA 3VH1A 3OJ0A 4R9SA 1WAMA 5K6AC 1DB3A 4FD3A 2Q4EA 5ENDA 4E12A 1C1DB 4DBZA 4R41A 1JLLB 2FHSA 2I67A 5DCWA 1EUDB 4HNGA 1LEHA 4DLAA 3SC4A 1KEPA 4J9UE 1EVJA 1B3BA 3FR7A 2XPCA 3QP9A 1EUCA 2E6UX 3DBHB 2CF6A 1SB9A 4CM7A 1J49A 2ZJ1A 4BNYA 4UVIA 3C1AA 2V6GA 4PRKA 3GNQA 1MG0A 1X7HA 2NSDA 3JQBC 5B37A 5TLSA 5TJHA 3FHLA 2HMUA 3KHUA 2ZTVA 3PJDA 3VTFA 4PLFA 4M49A 3ZW9A 1G1AA 4IY1A 4LISA 4J6FA 5KKAA 3K9QO 1OOEA 1Q0LA 4WLNA 1I33A 4CQMB 1DIAA 1E6UA 4R1NA 3ZHXA 4CUZA 3BHMA 2GASA 4FGSA 2FN7A 3F9IA 1X1EA 4R4JA 2W8ZA 1VL0A 4MVJI 4JCOA 3WB9A 3VDQA 1M67A 5A06A 1OI7A 1AN9A 2ZCUA 4HFNA 4NNJA 1GEGA 3SJUA 3DZIA 4LMPA 1MXHA 2H1SA 4RPLA 4F6LA 3R1IA 4BNNA 2Q46A 3F5SA 2I6TA 4WKGA 4BKQA 3C1TA 3VH3A 2OBYA 4TMFA 3HHPA 3CMMA 2AQHA 4AJOA 4WJZA 1P31A 1XU7A 4FOOA 1M66A 5KCZA 1JN0A 3DOOA 3PHHA 2NACA 2VHWA 2DPGA 1EUCB 1PU2A 1SEPA 3ZWWA 3ABIA 3L4BA 4RORA 3ZWYA 4YQYA 4HY3A 4XIYA 5AQ1A 2WYVA 3H9UA 5ILOA 1PZFA 3DTYA 1LNQA 1P1KA 3CE6A 3E9MA 3IC5A 4Y6PA 3VKUA 1ISHA 2VOEA 2Y1GA 4B7XA 1U4OA 3JQ7A 5ITVA 1E1NA 1PTJA 3BMOA 3KSZO 4G2NA 1QYDA 2J3JA 4Q9NA 5BQFA 1U7TA 1R4NA 4M1QA 4XB1A 5DCUA 1CIVA 3NJ4A 3VAZA 4CMIB 4B8WA 2QYSA 3I5MA 1UXJA 2VRCD 4BKRA 3NAQA 4YJFA 3L4BC 3WJ7A 2BI7A 4OMUA 3C7DB 4ALIA 3DFUA 4D3DA 1KBZA 1VKOA 5BSGA 1YQXA 2P5YA 1GUZA 4D42A 1NWHA 3F5QA 4CMKA 4EUFA 2I3GA 2C82A 4IDAA 3H5NA 4MINA 3E82A 3T4EA 5L40A 3PHJA 1KVSA 1YL7A 2GN6A 3RIHA 3MWEB 2VHZA 5L7YA 3L9WA 4TKLA 4LW8A 2C5EA 3ZN2A 4CODB 4J3FA 5TF4A 4W4TA 2PD4A 1PL8A 1U8XX 2O3JA 4J2OA 3S2GA 3A06A 4KQWA 2CDAA 2G82A 4I5FA 4ZA2A 2AG5A 3K31A 4FN4A 2VT2A 4QO7A 2QRLA 1IY8A 1NR7A 3KLPX 1ZBQA 5EPOA 4WPGA 3KO8A 3RU7A 1ZSYA 2C59A 1AE1A 3PRJA 1IL0A 1BTOA 4I5DA 1IHXA 3ONDA 2FPPB 3ZV3A 3HB4X 1QYCA 1FDVA 2OORA 2EKQA 1GR0A 2UAGA 3LSYA 4YAEA 5EINA 4CMBA 4ZQBA 2HRZA 6LDHA 3ZU3A 4RCVA 1TB4A 2X7HA 2RIRA 2YV3A 3E48A 3WS7A 4BMSA 3P2YA 4YXFA 3JQAD 4CMIA 2NM0A 1PR9A 5I7SA 3C7AA 3H9QA 1GADO 4J4HA 3GN2A 1H6BA 3QWBA 3AUTA 3DDNA 2G76A 1E3WB 3PFFA 4KMSA 4J4BA 3DMTC 5I7EA 1Z7EA 3FPCA 4KWHA 4ZGWA 5KIAA 2FZEA 3EAGA 3AWDA 1C14A 1YRLA 4GAEA 1I2ZA 1PS9A 2IRWA 3KYDA 1E7YA 4KZPA 1ENYA 3U09A 1QSGA 4I08A 3VZQA 1JW9B 1E92A 4N5LA 4RDHA 1EE9A 5K6AA 3DZKA 4FBGA 1SBYA 2EERA 1LJ8A 4CR7A 1DSSG 2C7VA 4K9DA 3BMNB 4XQ9A 3MJVA 4XX0B 3QY9A 3DZFA 3JQDA 4CUJA 4KDFA 4PLHA 3ZWBA 1CQJA 2GERA 3CIFA 5LCXA 1HYEA 2GZ3A 4E33A 5BSFA 3GZNA 3P19A 4HX5A 3BHIA 4AJ4A 4W9NC 1O0SA 3AFMA 3KYCB 4NQZA 3M1AA 2ZQYA 1XLTA 1HE4A 4BKUA 4WOJA 2WDZA 3V1TC 4DL9A 1PZEA 2C5AA 2JAHA 5A03A 3L07A 4GX0A 3V1YA 4BNGA 4JP2A 1Y8RB 4P4LA 2O3QA 4A03A 1E6WA 3GVHA 3NRCA 5DBIA 5H81A 4BGEA 5C5IA 3UKOA 2CDCA 4AJPA 4HWKA 2IYPA 4JIGA 1S7CA 3RWBA 2PKQP 2ZYGA 3PYLA 2DTDA 5TIIA 1UXHA 4IXWA 2WYWA 3QSGA 3QWIA 4HFJA 2OGUA 2DM6A 3M2PA 4B79A 1GD1O 4R1UA 5IDYA 2LDBA 2QIOA 1NFQA 4OQZA 4F3YA 2GUGA 2VRCA 1UR5A 3INRA 3ZCXA 3AOGA 4E0BA 1IPFA 2ZJ0A 1HRDA 1BWSA 4IGFA 4L73A 1XQ1A 1ARZA 4BO9A 4OKNA 4BKPA 1WZIA 1N7HA 5DBGA 4WNCA 3E9NA 4L74A 4XYMA 3KBOA 4GX5A 4HFRA 3QV1A 3PJEA 3GOHA 1PL6A 5CHEA 1PGQA 2CY0A 2VHVA 1DC3A 3DOCA 4YTEA 3HADA 4ZVVA 2Z1NA 2AEMA 3BMNA 3ROPA 3DOJA 4U0KA 4BO0A 1ZSNA 1XHLA 4UUOA 3VKVA 4GBJA 1XSEA 3ZH2A 2NU9B 4L4SA 1EQUA 4QECA 4XYBA 1RJWA 1DPGA 1HL3A 2VRBA 1DXYA 4GX2A 3FBGA 1C0LA 3D4PA 2HK7A 2PZMA 1NQTA 4NG5A 3M6IA 3KXDA 2XXJA 4MIYA 2YFQA 2A4KA 1D4FA 2YDXA 1ZIDA 3D0OA 3PEFA 5H82A 3EC7A 5JBIA 3VHRA 2B5WA 4W6ZA 4IDEA 3RFVA 4BNLA 1JU9A 3F47A 1D7OA 1R4MA 3INTA 3IUPA 3RBVA 4E2WA 4D7AA 1Q1NA 2O7QA 4YAGA 4FOSA 1D8AA 1U9JA 2C2XA 3DBHA 4OH1A 3PDUA 3LC1O 4YCAA 5JDCC 4A26A 1I32A 3TFOA 1UUFA 1PJ3A 4XR4A 3WQQA 5DN9A 4EW6A 1UP6A 1VJ0A 3U62A 3VTZA 2EW8A 3F6YA 4DWVA 4CV0A 4ZQFA 3WLFA 1DIHA 2I99A 1PJSA 1PJLA 1R16A 3FWNA 3MOIA 5L7TA 4RVDA 4LVUA 1R15A 4PG5A 3OMLA 3SJ7A 3OJFA 3KOUA 4J4TA 1YB5A 3H65A 5KJFA 1XELA 2DBZA 2CVZA 1MC5A 3GVIA 3AI3A 3MWDA 4PLVA 4E32A 1EVZA 4ZU3A 2GCGA 3WGYA 3I1JA 3PVZA 1EEHA 4E5YA 1P3DA 4MVJD 1Z6ZA 3DTTA 4INAA 3OQBA 3CMCO 2FY8A 1EVYA 5ICMA 2QHXA 3X2FA 3WFIA 3WXBA 4B4OA 1ZKMA 4YJGB 2HK9A 4RLHA 2PWZA 3HWRA 2OP0A 3ENNA 4PG8A 5JYEA 1A71A 2E48A 4RVSA 3M2TA 4JQCA 5FYDA 3GRPA 1D1TA 1B14A 2IEDA 2VYNA 3DAFA 5HS6A 3H2ZA 3BMCA 4NMHA 4PFJA 4ZHSA 1RM3A 3CZRA 3N74A 3UUWA 4RLSA 1GUFA 3FWZA 1QMGA 2P2SA 4ND3A 1T1SA 2PZKA 1NAHA 4XGNA 3V5NA 1MG5A 2NVBA 4MVJG 4FC6A 3ETDA 2TMDA 1KEUA 4QFCA 1MLDA 2RH4A 1N8KA 5COAA 1QYXA 1NHGA 4FFPA 4YT5A 3U3XA 4BB5A 5CAEA 1B26A 4WCFC 3NJ8A 4JLWA 3KRTA 1P1FA 4LK3A 3W8EA 1ISGA 3C8MA 4GPD1 4IGEA 4D3SA 1E0DA 4P8RA 1QP8A 1Y9EA 1ZXBA 1QLJA 2IXAA 4PVCA 4L76A 1A7AA 3SBOA 3Q0EA 4GL4A 5DDIP 5I9LA 2D4AA 1KEVA 3HFGA 4K6CA 3GDGA 1MUUA 2R00A 5B1YA 2NUAA 1YB4A 3RUCA 1CYDA 1P1RA 4IDDA 4EJ6A 3LC7O 4M54A 4PLTA 1W0CA 5H83A 4CQLA 4D45A 2D2IA 3ITKA 3VH2A 1PL7A 1YL5A 1M75A 4IPTA 4BO2A 4CV1A 2DT5A 4CM9D 1WW8A 2YQ4A 1BXGA 3O9ZA 3VPFA 3MWDB 4BMNA 3GLQA 4FQ8A 1G0OA 3JQCA 4FS3A 1XQ6A 4FFMA 3ZV4A 4XIJA 1LQTA 4CL3A 4DIBA 4YRDA 3WTCA 4NFYA 4ALLA 3HSKA 4KTTE 3BYZA 2EXXA 5JW6A 5B4UA 1EK6A 2VWPA 3O4RA 5JCJA 3GGPA 4E4YA 3PPIA 4WEQA 3AK4A 2ZTUA 3SEFA 1HDRA 2B4RO 3JYOA 1DO8A 3AU9A 1KC3A 2QZZA 1U1IA 1B8VA 2G17A 2POQX 3D4OA 2PH5A 2Y1FA 3AUAA 3BXXA 2FRDA 2OXIA 3BZUA 3JD4A 1UJMA 3E5MA 3E8XA 3KM0A 1NXQA 1F8FA 4U6QA 4UREA 4QUKA 3BAZA 1VSUA 1ZK3A 1GYRA 3OFSA 3O38A 1DBVO 4AJKA 1RWBA 2GZ1A 3QJ5A 3JQFC 1OC4A 1U7HA 5FI5A 1I0ZA 1TXGA 3WICA 1UAYA 4KUEA 1JAXA 1M6HA 2E4AA 3WMXA 1RYDA 4MOWA 2BD0A 3DFZA 5JCXA 4P4NA 3OQ1A 1ZFNA 2WMDA 4BO1A 1NFFA 2NTVA 4BNZA 1RM5A 3RFXA 2DBVO 3MJTA 4XYEA 4UULA 2ZCVA 2PFGA 3NDIA 2DUWA 3JQAA 4KP7A 2QYTA 2VHXA 3G17A 5JO9A 3PGXA 3RROA 1HDGO 5L95A 1LC3A 5G0SA 5DP1A 4J49A 2VYVA 3KUXA 4NBVA 4YBZA 3G0OA 3JSAA 4DMLA 4OHUA 2AA3A 4RPJA 1TEHA 3G3EA 5HS4A 4OJNA 2WTBA 1O9BA 3W4KA 1UXKA 2EHDA 2NQ8A 1HE2A 4K26A 2I76A 2IE0A 3TQHA 2GDZA 5IAAA 4LCJA 3WX0A 5G4KB 1Y8RA 3JYNA 3RI3A 1X15A 2O3SA 3GGOA 4HXYA 2VZ9A 1PJQA 4OGWA 1U4SA 4E5NA 1NPTO 1ENOA 4JJGA 3VDRA 3HDQA 2J3KA 3GVPA 3CKYA 3CXRA 4ESOA 5CEJA 1I3NA 4OYRA 1GYQA 4XWYA 2FP4A 3EZYA 3W6ZA 4IBOA 1I2CA 1YBAA 4NJMA 5JAMA 1NX6A 1YE3A 3C7CB 1JTVA 3TNLA 4IJUA 1ONOA 4PG7A 3I9MA 1LSOA 3ETEA 3OJOA 1UDCA 2BGLA 4YEDA 4DIOA 3IL2A 4R1TA 4AJEA 3K6JA 1VRWA 4RPGA 1QORA 3ITDA 4Z9XA 1KY4A 4XQGA 4YT4A 3ZU4A 4PZDA 2VUUA 1XEAA 3PQEA 1HXHA 4WCFA 4BHTA 5C7LO 4DPLA 1NBOA 2GR9A 2I3AA 3DHEA 4D0SA 2W2LA 2EKPA 1I24A 3WYEA 5CG1A 3H3FA 1CWUA 3LK7A 4II3A 1H2HA 4ALNA 1GL3A 3CINA 4OXYA 1E77A 4BQPA 4CM4B 2BH9A 4R51A 5JNLA 5IZCA 2EV9A 3WNVA 4DQVA 3VZSA 3EZLA 4CMEC 4FJ2A 3GY0A 1MP0A 2V65A 5CFZA 3MWEA 4WEOA 1V35A 3FTNA 5DZSA 5EERA 2TMGA 2C0CA 2PV7A 1ISFA 1GQYA 1XR3A 3GUCA 3QIVA 1TT5B 5GZ6A 3GEDA 2JCVA 1U3VA 4RO0A 4XA8A 1K2WA 1P0FA 2DU8A 1JLLA 3R0IA 1JKJA 2DPHA 3MJEA 3L77A 5I8ZA 2BRUA 3TZ6A 3JQAB 1VI2A 3K30A 3KV3O 1Y81A 4AJ1A 1EBFA 1XA0A 3AOEC 1UP4A 1W73A 5KVQA 3BTOA 1DRWA 3BMQA 3WBFA 2PGLA 1PQUA 3K2BA 3UGKA 3TRIA 3JQ8A 3T7CA 4WUVA 3JD3A 3H4VA 4Y8VA 4CLDA 2HU2A 4E30A 3WGIA 1T26A 1Z73A 3VPSA 4CMCA 4IIVA 1U5AA 3PHGA 4EZBA 4GX1A 3WGGA 2G0TA 3F4BA 2NV6A 2Q1SA 3OH8A 1FDSA 3GEMA 2C07A 4IDFA 5F1PA 1KC1A 1EFKA 1VM6A 1LSJA 4RDIA 1PX0A 4PGFA 3D4NA 3B70A 4D0RA 4WCFB 2FMUA 4LSWA 4Y67A 5K9ZA 1EMDA 1DHRA 2P91A 5G2OA 1MV8A 1JAYA 1JVBA 4L9RA 4A27A 5A02A 3VZPA 4R54A 3IIEA 1QV7A 1P9LA 3TL2A 4I5GA 3M1LA 1ZNQO 4L4RA 4NJMB 1O8CA 1DIBA 1NQOA 3ADPA 1P45A 2ZB7A 3GK3A 2WD7B 3Q6IA 1GZ3A 2D3TA 5IDQA 3PIDA 1ZW1A 4MKZA 1PSDA 4BKOA 3D3WB 5U9CA 2YV2A 3L6EA 3KYCA 4JBIA 1KERA 3INGA 4XJTA 1U3TA 4IJWA 3UCXA 2UDPA 5COQA 5THQA 1RM0A 4IZIA 2W4QA 4DQUA 1ZK0A 3K92A 4YAIA 4WK6A 1BW9B 3N58A 3RFTA 3AM3A 1YONA 3OQ6A 1ADGA 5T64A 1YH3A 3TPCA 3ZGYA 1DAPA 3ON5A 1YVEI 4Y98A 4UVHA 2J3HA 3K8ZA 3B6ZA 1IB6A 3U4DA 3SVTA 1ISIA 1FF9A 5JLAA 1A9YA 1E7RA 1YB1A 4OOFA 3QVWA 5JAZA 1IOLA 3H2SA 1T4BA 3RUIA 4YJHB 4RF5A 4TZKA 3G79A 4QEDA 1C1XA 1Y5MA 4JJFA 4DPKA 3R6DA 2W2LD 1PJCA 4J0FA 2Z95A 3WGHA 1C0IA 3RC2A 1JKJB 2HK8A 1NM5A 1PJ4A 2A92A 5IFLA 1YOVB 3GUYA 2VZ8A 1I3MA 3TL3A 2AQKA 1HLPA 4JNKA 1GCOA 3JQ6A 5AXBA 1VSVA 2AMFA 3KSUA 3DR3A 1O95A 2HQ1A 3MCVA 1PJ2A 1Y7TA 3GDOA 1AGNA 1E3JA 3FD8A 3IUSA 4KDEA 1ZEJA 4TRMA 1QXSA 2C7GA 1HF3A 3FN4A 2FPGA 4Z0PA 5JY1A 3TDKA 1YDEA 2PK3A 4ITUA 1DEHA 4E5KA 5IDWA 1ZH8A 4FJ1A 3VH4A 1J0XO 3MOGA 3CTMA 3DZGA 1JDJA 2ZYAA 3L6DA 5TT0A 1ADFA 1I36A 5MDHA 1AXGA 5KVCA 4BVAA 4QX6A 3DBRA 5A9SB 1H6AA 2E37A 5LDGA 3Q9UA 1C3VA 3S8MA 3OHSX 4URFA 3GG2A 4YAJA 4CQMD 3ZWVA 2CUKA 1SAYA 2A94A 2Q2QA 3HZZA 4YJFB 5EESA 5HTOA 1DHTA 4XDYA 4RV9A 4Q3CA 5A9TA 5THKA 4FFNA 1T24A 1PIWA 2QX7A 1UH5A 1K3TA 3HB5X 4W7HA 2X22A 4O0LA 4BO6A 3WGTA 1N1EA 1IULA 1BW9A 2YJZA 3W8DA 1KVRA 5DBFA 5I7FA 1DC6A 2CD9A 1E3WA 3PI7A 2QRKA 3IOYA 1HDZA 3RASA 3EHEA 1DLJA 1U8FO 4YRBA 5JDIC 3DB2A 3A9WA 4PRLA 4DUPA 3AI1A 3NGXA 1YWGO 1F14A 2BMAA 4YR9A 4RPHA 3NT4A 2NVWA 4XDZA 4AG3A 2NUAB 4RL6A 3G1UA 5B4VA 3GVCA 4P38A 4OOEA 1P74A 5KJ6A 3ANMA 4Z0TA 3FRJA 2Y05A 2Y1DA 3K96A 3HDYA 1FDWA 3HDHA 1A4IA 4ZICA 4W9NA 4NU6A 4GLOA 4ND5A 4BIIA 4CM8A 1HZZA 3ZHYA 2YV1A 2HMSA 4D46A 4FFLA 1U28A 5A04A 5F21A 4E5PA 4CR8A 3V1UA 5B4TA 2C54A 2Y0CA 3UW3A 5L45A 4H7PA 3U4CA 3HG7A 4CM6A 2JD1A 4A73A 2OFPA 5AXCA 5JS6A 4XX0A 4L8VA 1FDUA 2H9IA 4AJIA 3HN7A 4GWKA 5T6BA 3FCOA 3NX4A 4EGFA 3L0DA 1H6CA 4WOKA 3IJPA 1ZK1A 1R0KA 2NU7B 4B3JA 1L1FA 3FNFA 4OL9A 3TWOA 1HE5A 1HSZA 2B35A 4A0SA 3OA2A 4Q39A 2NTJA 1BXGB 3ICCA 4PG4A 4MO2A 5IZCC 5TRTA 5HRUA 3OA0A 3C24A 1C1DA 5JXWA 4KQXA 4E3ZA 3DO5A 4A7PA 2YHIA 2HSDA 1PJTA 5T8KA 8ADHA 2Q49A 3DHYA 4JN6B 1CRWG 1VPDA 2Y66A 3ST7A 1XG5A 4ALJA 1H2BA 3MJCA 1C0PA 2EG9A 4YAKA 1OAAA 3NGLA 3OSUA 3CH6A 1Y1PA 2A9FA 3I9LA 2E82A 7MDHA 2BHLA 4XRGA 4J91A 3KLMX 2OUIA 2V6BA 1X14A 4RPKA 4TRRA 1UP7A 3GEGA 5G0VA 1TA4A 2DVMA 3AFNA 3RAJA 3RUDA 4DMMA 3RSHA 1ZO8A 3PGJA 4U7WA 4LVCA 3PK0A 2SCUA 4NZ9A 3OP4A 3WTBA 4AFNA 3HNPA 2HJRA 2PH3A 1GDHA 1GTMA 3OICA 3L6OO 2P9CA 2I9PA 2PKRA 4H15A 5CDSA 2Q99A 4XJSA 3VC7A 5L51A 2Q1UA 1BVRA 1K0UA 4J7CA 3LT1A 3ZNQA 1YL6A 2VWHA 2JD2A 2QG4A 1K6XA 4JX8A 1NHWA 1XCBA 5A05A 3E6AA 1CF2O 3S1LA 2HKIA 2ZQZA 3ZW8A 1DFHA 3E9QA 3JQ8B 1K5HA 1OZAA 4O59O 3RKRA 1R66A 3F3SA 5L7WA 4A5OA 2IXBA 2WYUA 3WGQA 3O26A 1KIFA 1FK8A 2Q50A 2WD7A 1YJ8A 3JCZA 3QW2A 4JXKA 4R5MA 1JWBB 3L9XA 1Y8QA 1N5DA 3DHNA 3OJLA 3H3JA 3WWZA 4CM5A 1O5IA 2G1UA 3GF4A 3V2UA 2DFVA 1KY5A 4DQXA 4K1LA 1EFLA 2X0JA 1QV6A 3AY7A 4MP6A 4XYGA 1WDKA 4DC1A 2QW8A 4H16A 2B5VA 4IMPA 1H9BA 2UYYA 1X13A 3G49A 3GPDG 1A9ZA 3PHIA 4JJIA 3KB6A 1LLDA 4XYLA 1IE3A 1V3TA 2VN8A 3QVSA 4OAQA 3OIFA 5KTKA 3LLSA 3R3SA 4J1QA 3ZNOA 2EWMA 1VJ1A 1NFRA 2FPIA 4UEJA 3QVOA 2B4TO 2ZATA 3PIIA 1Z75A 2GN8A 5A1TA 1NR1A 1KOLA 1GYPA 1SC6A 3B1JA 5COBA 3GQVA 4MPDA 4HKTA 1LDGA 4HP8A 1B8PA 4CL8A 3GN1A 4X54A 1PWXA 4ZJUA 7ADHA 2IZ1A 5GMOA 1DDOA 2GSDA 3QWFA 2JL1A 5A3VA 3B20A 3O8QB 4AL4A 4Q3BA 4W7IA 4JGBA 5BSHA 3HUDA 3ASUA 3RD5A 1H5QA 2PTGA 3JTMA 4MVJM 1D3AA 4XKJA 1DAOA 3PFWO 2DQ4A 1EVIA 2D59A 3AY6A 4EUEA 1ORRA 5JPIA 4NK4A 3T7EA 5A3JA 4MP8A 3DQPA 4Z9FA 2J8ZA 3GG9A 4FR5A 1IUKA 4J9VA 3BIOA 4QQRA 3JD2A 5TJ9A 2BF7A 2JFHA 4CQMA 4DYDA 3GFGA 1YO6A 4EI2A 1EBUA 4R3WA 4U8GA 2Q3EA 1P1JA 2EP5A 4YJGA 2NTNA 4M86A 1XWFA 2NU6A 1S6YA 2IYOA 3ANNA 4IS2A 5BT9A 4BL5A 3LQFA 4CQLB 4GLLA 4PIVA 2IODA 4AJNA 2EW2A 1LA2A 1DJQA 4PLWA 2D5CA 3Q3CA 1OC2A 1TI7A 1BGVA 3H7AA 4BNXA 4YRAA 3H9JA 5TSDA 1DFIA 3WWYA 5L9AA 4XZ3A 3ETGA 2FR0A 3NTQA 1WWKA 2UUPA 3GZNB 3EMKA 2CF5A 1UDBA 4MIEA 2D1YA 4PN3A 1LDMA 3Q2KA 1X1TA 3QHAA 4WCDA 1ZJYA 2C29D 4XEHA 1HT0A 1WVGA 4E31A 5IG2A 2X58A 3RBXA 1BG6A 2P5UA 3S55A 1I3KA 2AW5A 3TFQA 2O4UX 3MTJA 4YA6A 2D8AA 1PWZA 3OECA 2V6FA 3C3XA 4B8ZA 1FMCA 1AUPA 1GU7A 1JQBA 2YDYA 4AVYA 4CM8B 5ITWA 4YB8A 1SCUA 3LZ6A 3ZV6A 1ZEMA 3MTGA 1ADBA 2AE1A 3DAPA 1JVSA 3PYXA 2Y67A 1W4ZA 1YS4A 2W98A 4MDHA 5JYDA 1IYZA 2Q1TA 4HFMA 2NU7A 3GMDA 3IKTA 2QZ9A 3JV7A 2BFMA 2UVDA 3HQ4O 2GD1O 3AI2A 3I9OA 4RF2A 1N9GB 2IEBA 2Q1WA 4I9HA 3MJ4A 4R1SA 4S3MA 4YT2A 1LRJA 3D5QA 1X0VA 5KWEA 1PEDA 3FBTA 1LRLA 2NLOA 4DA9A 3H8VA 3LC2O 4B3IA 1GQ2A 8LDHA 3I6IA 2EGGA 3DBRB 3K73O 2FWMX 4Y6RA 1EDOA 3RC7A 4EJ0A 1RM4A 2DFDA 4G65A 3GFBA 2XAAA 5JMPA 3CZMA 1LDNA 2PZLA 2Q2WA 3F4LA 3O8QA 4GSLA 3RUFA 1LU9A 2NWQA 2JHGA 1VJTA 2WEKA 3WYBA 2GPTA 2HCTA 2A35A 1N9GA 5IF3A 4BNIA 1EDZA 4R5HA 2JCYA 1VC2A 2DUUA 2X9NA 4OXKA 1G0NA 1K6IA 1KVUA 3WOHA 1F17A 2O50A 4IQGA 1B7GO 5TQVA 4YJDA 2ZYDA 1PGNA 4J0EA 5KJEA 4FCCA 2JFFA 5ER6A 1HKUA 3VOSA 3PZBA 1Q7GA 4J1NA 1Q2XA 3EVNA 4HBGA 3RUHA 4GVLA 1ISMA 3D3WA 3QVTA 2WJPA 1CQJB 2Y68A 3AM4A 1JKFA 4ZQHA 4B7CA 1DC4A 4E2YA 3WSWA 2P4QA 1FXSA 3W8FA 1B8UA 3SX2A 1OMOA 3UHAA 1LSUA 4TKMA 2OOSA 4P4GA 3ZWXA 2VUTA 4ZN6A 5AXAA 4FC7A 2FPPA 1HDXA 3IJRA 5KVVA 4II2A 3ROKA 4ZD6A 4KWIA 1TLTA 2FSSA 3JYQA 1ENZA 5G0UA 4BNUA 3PLNA 3A1NA 1HE3A 3MEQA 3VPXA 4W99A 1T25A 2YFHA 2P68A 3OBBA 2JHFA 1DOHA 4A10A 1ZJZA 1KYQA 4XB2A 3JQFA 5G4KA 5JMWA 4BNMA 1X0XA 3QVXA 3WGZA 3N7UA 3OEWA 2H63A 2O2SA 4LRSB 2HUNA 3FPLA 2QRJA 5F5NA 2Q4BA 4FSHA 1B16A 2V7PA 2VCYA 3MJSA 5GY7A 3RUEA 4UVEA 5JE8A 1E3SA 1QLHA 4PLPA 2ZB8A 1I5RA 4RF3A 4EJMA 2EKLA 1Q0HA 1ZCJA 1E1LA 1VE9A 4NH4A 5CDGA 1Y9AA 4WE3A 1H0KA 1IZ0A 2W2KB 3KVOA 2Y0EA 2H6EA 1VKNA 3ZI0A 3O03A 1L7EA 2DBRA 3EW7A 4NBUA 3GC6A 4XQEA 1CERA 2YYYA 1RKXA 3OEYA 4DC0A 3JD0A 9LDTA 4UUNA 3W6UA 1N92A 3ROMA 2HJSA 4NFSA 4BGIA 3ZV5A 3ADOA 3W1VA 2AEFA 1ISJA 3BHJA 3PQFA 3WFJA 1T2CA 2Z5LA 4EUHA 5CG2A 3JQ9A 2J5QA 1X7DA 2WSBA 3RVDA 1BXKA 5EN4A 3TOZA 1WNTA 4E2ZA 5FFFA 3BMQB 2ZB4A 2X6TA 2WM3A 3PTZA 3QE3A 1LDYA 2RHCA 4R3NA 1WMAA 1E7QA 5EJ2A 2CNBA 1BRMA 3BTUA 1W8DA 4CJXA 4CLXA 1ENPA 3STHA 1HDYA 3FNGA 3Q1LA 4TQGA 5C37A 5JC8A 1DRVA 2DKNA 4TWRA 4BNFA 3DBVO 3ROQA 5TC4A 4O63O 3WG9A 1FJHA 1ULSA 3FR8A 9LDBA 1EE2A 4B4UA 2ZK7A 3PHLA 2NU8B 2Y0DA 1GZ4A 4TVOA 4TSKA 4WGGA 1MA0A 3FI9A 5CDYA 5L4SA 5AXDA 1Z45A 1KVTA 1ZK4A 4WASA 1L7DA 3RC9A 5TX7A 1NAIA 1U2GA 2Q2VA 1YQDA 4WNIA 5CEEA 3AUSA 2YHIB 2GYYA 2FR1A 1UAGA 2PLAA 4LSMA 1ZSVA 3A14A 2NVUA 1GV1A 2X86A 3LYLA 4N7RA 4UUPA 3W4JA 3ZWAA 1JKIA 3H6KA 3EY4A 3CSDA 4QO8A 4NBTA 1N1GA 5L4NA 1T2DA 3LLVA 3PDJA 1J6UA 3VPHA 3JQBA 4J43A 3UCEA 1WLYA 4Z0HO 4BNKA 4D41A 3ZU5A 2NU8A 3D1LA 1B15A 4PG6A 5FEUA 4YPOA 1WP4A 2OO5A 2HO5A 3ONEA 4CMGA 1VL6A 4FGWA 2W2KA 1SOWA 4GQAA 3NDRA 3S2FA 5J23A 1GEEA 2HAEA 2PKQO 1T2FA 4QFDA 2OZPA 4WLVA 5GZ3A 4Y6SA 4CLEA 3PYMA 2ZIZA 4IXTA 1XKQA 1Q0QA 1PQPA 1ZVMA 5A5FA 1E7MA 1GZ6A 4DGSA 3PWSA 5I9NA 5EL0A 4CR6A 1Z7BA 3HE3A 1PGJA 5CDTA 1GV0A 4LGVA 4M87A 3IKVA 2EF1A 4YWJA 1HETA 4R68A 3ZNNA 3BMCB 2SCUB 2Y99A 4DTIA 3EYWA 3P5SA 2O4CA 3NV9A 5HM8A 2HRBA 1BDMA 1H93A 2OP1A 1W6UA 3T4XA 4BQRA 2PNFA 5HWSA 1NASA 4GMGA 4BNWA 2B83A 3VVBA 1MGOA 4NU5A 3TF5A 3OETA 4RJTA 4RGBA 3I9JA 4Q3EA 2JKVA
chains in the Genus database with same CATH superfamily
3BILA 3DCYA 4AZ0A 4F45A 5CAEB 3TBKA 1DKMA 1KZ1A 3QG1A 1JFFA 1RT9A 3GRKA 2GD2A 4DIFA 2CB0A 1JIXA 4MSUA 2YXBA 2AJ8A 2ISQA 1RKBA 4NE7A 5CGQB 1SCBA 3SM3A 3EPJA 2R4UA 1NE2A 2PD6A 3D7LA 3KR9A 3ZY4A 1CT9A 2NV2B 3I23A 2CBZA 3AONB 2RSLA 3TLJA 1YZKA 1C29B 1TM5E 1E2GA 1LLUA 3BUSA 4LY3A 5LSAA 1UXIA 1YQGA 5K0ZA 5L53A 1HNXB 2Q5OA 3IAS6 1VGVA 4QXMA 3ZV7A 1NURA 5FI3A 5HFNA 4HQRA 3UTCA 1K88A 3O9VA 4NBWA 1ULTA 1G9XA 2G5PA 2WJIA 3UTDA 2P1RA 3UMSA 5FAKA 1L1QA 4RSHA 1X92A 4C9BA 1FRNA 1UIRA 4O2RA 3TVYA 3ZR4B 2JJQA 4PF1A 3TL6A 1YGPA 2DH6A 2QQFA 4G1UC 1ZMTA 2AN9A 3L0BA 4FWBA 4PC1A 4UC0A 1QHYA 1XCJA 2IOFK 3JYLA 3ZDEA 4D3FA 2XZOA 3N2EA 1E5QA 3CONA 1VLVA 1K92A 3LWBA 1D1SA 1R37A 4WJKB 4MV7A 2NGRA 1QIKA 1T2AA 1ZICA 4CM1A 2PRKA 2ZUCA 1MQ8B 1F06A 2NADA 2OB1A 5IK2D 1LNSA 2A67A 3PLRA 3PUIA 3B82A 3FPSA 1I7NA 3PU6A 4R1QA 5F2EA 4MUFA 5DEIA 2Q5HA 3DJYA 3DNMA 4IV0A 3O7MA 2PRYA 5DP2A 4NV0A 5F2KA 3NKLA 4Z3DA 1J4AA 1VFNA 5ALEA 2W70A 4EITA 3KHKA 3NKVA 2B1GA 3UVEA 2ZPTX 4BO8A 3THYB 1GLGA 2OXFA 4DRYA 4DUGD 1XA4A 3PWTA 2Y9MB 4ZJPA 4RK1A 1AF7A 1H9AA 4YIHA 1PS8A 1U2DC 4WBNF 4PLGA 4B4VA 1PNVA 1E0KA 2MINA 4GGOA 1ZIYA 3AL0C 1CJVC 1XTTA 4IDGA 4QBIA 2BFAA 3K5PA 3O4JA 3Q41A 4O1HA 1NQUA 2CHEA 1O7JA 2H1IA 2PT5A 4FZ3A 1SQ6A 4HBZA 5IVDA 3HBFA 4B3RB 5KDOA 3WVNA 3VR5D 3T52A 3U3ZA 1E5LA 2FGJA 4BV9A 4OHFA 4J0HA 5DWVA 4XWAA 1U6IA 3KOWA 3QU9A 4ZEVA 2BGGA 4CF4A 3T1OA 2V0NA 5FV4A 4DR1B 6ADHA 3HR8A 3UOWA 1QVAA 2B82A 2QL6A 2ZR0A 2JA2A 2PBFA 3HVUA 5K0SA 2QUKA 2XE6A 3IAHA 3MTIA 2V5VA 2VG8A 1T5BA 3TKAA 1QE5A 3EVCA 3UG7A 5KYGA 1LWNA 1XDDA 2MYTA 2OHJA 2I4IA 3B7GA 1MX5A 3EISA 3TUJC 1GL9B 2KPOA 5FO1A 2JCXA 3K0KA 5BQ3A 4K28A 2FFRA 3AEZA 2XH8A 2VYFA 3A27A 3CGGA 3NTLA 4RJ2A 1VLHA 2W6JA 4YACA 3UH1A 3MK31 5TGDA 4MKFA 1A9XB 5JD4A 4CDRA 4NAUA 1E1KA 1EWKA 1QONA 1Q3TA 3J7TA 4EW1A 1CG6A 1TW2A 4MQ6A 5KQLA 4RF4A 5AVVA 1M6WA 1V95A 1EA5A 3STYA 1E3LA 1N1MA 2HYDA 5FUQA 2O2HA 3I5XA 1F0YA 1YR7A 3SC2B 1AGRA 4CLRB 2V5UA 3G85A 2GNOA 2H1FA 3ILSA 4Z9BA 2OESA 3CQ9A 5DTRA 5TARA 2IC5A 2NQ2C 4URWR 4JUBA 3W5UA 4DLLA 4RFVA 5IBPA 4RNDB 4UFPA 3ZY6A 3UMYA 5IJWA 1QKIA 2IF0A 3KAQA 3Q8LA 3L8DA 1YRYE 3T5MA 1S4MA 2VC2B 4LRQA 4W6QA 1BD3A 3VV2A 1LPOA 1OA1A 5B2EA 1TU4A 1JB9A 3DP9A 2CDRA 3NYWA 1I6MA 2IW3A 3DGEC 3EBOA 3OZUA 4IM7A 5HKLA 5BUCA 5FFNA 1KETA 2RHTA 2NPIA 4QASA 1DIOB 1J5EB 1UFKA 1TAHA 1C8LA 3IPXA 3P4XA 3U40A 2L17A 2RHOA 4PNZA 4MV0A 2P5TB 4QT0A 5ALQA 1XF1A 5K8IA 4FJ0A 4O6VA 2JD0A 4HQNA 4UBOA 2DLDA 4FSXA 2P6MA 3WNQA 2I3ZA 3OCUA 5FOVA 2JAXA 4RETA 3GGGA 2D74A 1J9GA 4G1EB 1P5FA 1N3IA 5IF9A 3PDHA 4AY2A 4GR9A 2W93A 3KE8A 5KYKA 2PZJA 4S04A 3V2GA 1WO8A 1MXFA 3A1TA 1G9SA 4KXYA 1S0UA 3AXTA 3HWWA 3L5KA 2AG6A 1QK3A 2IEGA 3E7WA 1I3LA 2I6QA 4L6CA 2C78A 2E87A 1P1HA 4GP6A 1N6PA 5DV9A 5J2TF 2O3TA 3RS3A 2PL5A 2PANA 4HMPA 4HZUB 3K6KA 4L16A 1H5NA 2VPXA 1OCEA 3KR2A 1EESA 1D6JA 3QFFA 2X1HA 5LYJF 4D0GA 1U0NA 3QIAA 1BS1A 2EFCB 5FUWA 2REQB 3DB1A 3EVBA 4GVXA 3ZYCA 4ASUA 5A0TA 2AEJA 3RYCA 2O8FA 2QVBA 1UCFA 4MWOA 2F3QA 2FW6A 2RAFA 4B47A 1G20A 4O2BF 5CNIA 1CJCA 3IHWA 3DLHA 4O29A 3T5DA 5LBIA 3IQEA 4QLBA 1AO0A 3GJZA 1A4UA 2QQ5A 2EQBA 3JQGB 1M2HA 1OPXA 4HI0E 4LDJA 2COKA 2PG3A 3PUXA 2E49A 3TLZA 5JAUA 4NYMR 1R1DA 5AIAA 2OCXA 5BNWA 2PR2A 2DPYA 4M53A 4EK9A 3A4TA 1UZNA 3EZ6A 2IS2A 2P2YA 1PR5A 2APJA 3ZOKA 4C0HA 2DY0A 1XPRA 4MW5A 2XMSA 1P44A 1GQOA 4FYIA 3QPWA 1JP7A 1EFTA 1NQXA 1E4EB 3ZHQA 4EG4A 4OMFG 3BK1A 4NOLA 1XF9A 2HA2A 2VCEA 3A1DA 4DLPA 3N0VA 4KOAA 4FFBA 4JBGA 5TMDA 3ETLA 3TZCA 1V26A 3IESA 1PQWA 4F6CA 3UMMA 1U99A 3C3DA 2XIJA 4TT3D 1Z08A 3CS3A 1BDJA 4GXTA 4RVOA 1QIJA 1ZLYA 3S6JA 1FYEA 3B1FA 4EY8A 4RXMA 1UQTA 5BW6B 3ADKA 2IELA 1NSFA 4J0IA 5KQGA 4DJDC 1G63A 3VRHA 5IXJA 4N9QA 5LXTB 2EYQA 4LBWA 2VEDA 2FZWA 3DWIA 4BOYA 5ICFA 1H8HD 3LX8A 1Z0IA 2JHCA 4JNCA 3L6CA 2AQ8A 1QAMA 3D4LA 4BO4A 1Q77A 4BVLA 1FZTA 4QGBA 2WHEA 1T4GA 1O95C 5C1DA 1PK8A 2EJVA 4GT1A 4O02B 1W19A 3PQ6A 4YN3A 1NDHA 1G20E 3LJKA 4ZPJA 4M1EA 3DEIA 4IQ4A 2IUFA 1JL3A 1KHTA 1RQRA 2F17A 2L69A 3CRW1 3A4YA 3ZUPA 1OLXA 1VB5A 3GMSA 4RVHA 5FWNA 3MTEA 4OQQA 4YYZA 3GVXA 3KAJA 3TMAA 5AOVA 5BRNA 3UWOA 2BH2A 4Q05A 3QYFA 4YH1A 1P2GA 1T6ZA 2EAUA 1CE8A 3NFRA 3VNBA 3MMPA 4L5CA 1XAGA 2JJYA 1OWPA 3RU9A 4UHFA 4EKNB 1G2PA 1BE1A 1SUDA 5CNKA 2ZRKA 3KZCA 3R0JA 3MOSA 4FMCB 1OH8A 1RJ9B 2GF0A 4NBSA 5BMVF 1U1DA 4G3XA 3HO1A 1Q5PA 1XZCA 2I33A 1NUPA 2PZAA 3TM4A 5JDIA 3VOAA 3S0JA 3HBAA 4P58A 5JWOA 3ZDRA 2PMBA 3RHTA 3VNQA 1KJ9A 1TC1A 2OGZA 2XA2A 5GV8A 4YDSA 1CETA 3TQFA 4QAJA 1PD0A 3RHZA 3WLPA 2GPBA 1HQCA 2YHAA 3A58B 4JUCA 2XTZA 4LN1A 4LZZA 3RTGA 3T7SA 3T9CA 2M32A 3TD9A 3VR5H 2X5JO 4DHWA 2ZCJA 2PBLA 5B55A 1GTSA 4ENWA 5JISA 1FFYA 3PGA1 1CDOA 2CMDA 4KN6A 2G0NA 1AO3A 4D5GA 1J8VA 2X0IA 3UMJA 3WA7A 5ER9A 1E69A 4D92A 3BWBA 2QRNA 3OQPA 3W78A 1QH8B 4KH1A 1XP8A 2X6RA 4OP2A 3AM5A 1MOZA 2HRQA 3SZLA 2PX6A 1SUAA 2G8LA 2ZSUA 3FNQA 4LMRA 4AZ0B 1MCZA 3W2EA 1O87A 3DZHA 3TR6A 1M2WA 4JHXA 2WWXA 1GG8A 3D6JA 3FRHA 3FDZB 3CX3A 1J0EA 3AOEA 5I45A 2ZYUX 5T4HA 4DCJA 1TJ5A 3N0XA 3NHBA 1KP3A 1MT0A 1U1CA 3TINA 2C8KA 1VE6A 4TRNA 5HRCA 2YV5A 3KQKA 4HH4A 1U8UA 3KIPA 1GRNA 5H70A 4WESB 3RJZA 2ZBPA 4KQKA 2DTXA 3VXKA 3I64A 3AUXA 2VHTA 2FN9A 3R4VA 1YRHA 2VAPA 1GFSA 2XX3A 3B9BA 1T1RA 2AK3A 5ECDA 3PQ2A 4KODA 2HXGA 3D8SA 4JV5B 1RACA 2I54A 3JW8A 3LF1A 4IJVA 4HEJA 4OLFA 1RCTE 4KR9A 1G66A 1MW8X 3CPJB 3ZHRA 2WJ6A 5JI3E 4TYWA 1E1MA 5JU6A 5CW2A 1U2TA 1ECBA 5J2TA 1V0JA 2ZLBA 2DPMA 2W2VA 3P94A 3C1OA 3RRBA 4CM3A 5MN6A 2UZ1A 2V3VA 1EINA 4E2XA 3LT0A 5CLIA 3H2BA 1W5BA 1CQIA 1CNFA 3I8OA 2GDJA 3KB8A 4PV7A 4TZTA 3GQBB 5ALHA 5FRDA 3WLKX 4HDMA 1N6OA 1SO8A 1NBEA 1YFZA 4LHWA 5KAMA 4NYJQ 5HNKA 1I4OA 3LNTA 3TNFA 1HNNA 1JA1A 4KBYA 4J3JA 1HGXA 2Y76A 1N2GA 3P2KA 5ECWA 1XRLA 3WDSA 2UZ4A 4OGFA 2QTLA 3S2IA 3SFZA 3A3KA 3FUWA 5PGMA 1XMIA 3CRZA 4CIYA 4U5QA 1P4SA 3SC6A 2V9CA 1A3CA 1FNNA 3BIXA 1Z0FA 1KOGA 3H19A 3EGDA 2FPGB 5BNIA 2XSZA 1DV1A 4HXGA 1ML4A 3DDZX 3OZXA 4L6IA 4TV8A 3DZCA 2FR8A 3PRHA 3DAOA 1HQDA 1H0RA 1H0HA 3TJRA 2D0IA 2HLPA 4OSPA 3E5RA 3QA3E 5E7IA 4JELA 5ALTA 1H1LA 3W4IA 3VJMA 5LN1A 3KTDA 4FDAA 2H5LA 3JD1A 1P0IA 1WXEA 1RPTA 1ICIA 3B53X 3LT4A 4BNTA 2Z04A 3GNTA 1PHRA 1QK5A 4EYEA 1NJSA 1W49A 5I8WA 4MQEA 1P0CA 9GPBA 3IH5A 1U0TA 1F8GA 1WDTA 5IXSA 5CJPA 4MDFA 1X8KA 4P53A 5EMNA 4O5OA 3GT3A 3WK9A 4KYVA 2NQTA 4KUGA 2IW1A 1BAPA 1IEQA 2J5KA 4M0DA 1XMOB 4ENSA 1QIIA 5KCMA 3JXEA 1HYGA 4GP9A 5LUAA 3CW8X 6REQB 1XEXA 5KHLB 4J1SA 4AYXA 2XOKA 2GLXA 2AZ4A 5C4GB 5GVSA 3KD3A 2RE8A 3U60B 1P7VA 1Z8NA 4NI5A 5F7OA 1DBQA 2V7UA 1DAFA 2YY7A 3RFFA 5JO0A 2GN1A 1RBMA 4K9SA 4YFVA 3U81A 4TGLA 2FOIA 5K05A 1AHIA 1JR3D 4JSYA 2VJLA 3L1UA 3MBKA 4L78A 2EJBA 4S1VA 4TXNA 4ZOAA 5FNVA 3RVNA 1O6BA 3TKLA 4ZDIA 1BDBA 2P40A 2VTEA 2ZTLA 5TXGA 2PMWB 3KPVA 1U1EA 1L5NA 5IZ4A 1D6SA 3H9EO 1ZN9A 1KZ9A 4HR7A 1XO1A 4PO1A 4DCSA 4KO1S 1OKKD 1JFSA 2R8XA 3AKEA 4HN2A 3ADDA 1G8FA 2CVQA 1WJGA 3HB0A 4J7XA 4EKEA 3QHQA 1AY0A 1NJ2A 1J23A 2X4GA 4G5HA 4YRTA 3FZEA 4INZA 4OO3A 1QGAA 1PJ8A 1PNQA 3QUCA 5FLEX 5L4LA 5AYVA 4B31A 1BCSA 3ESBA 2WA1A 3RS5A 1AKRA 3COJA 3U56A 3QU7A 4X3OA 3OKAA 2Y1EA 4H60A 5K6RA 1UBUS 1FQJA 2DZDA 2AC7A 2PWYA 2WE7A 1PZXA 4OQYA 1CPYA 3A28A 4JT9A 4ZCRA 2XHZA 3L1HA 2IPAB 4R16A 3I52A 1F8YA 2A5DA 1ZRMA 4MVJP 3HP4A 2XGGA 1HBJA 1NGSA 4DYVA 2HWKA 2NXJA 3M6WA 4AG5A 4Z3KA 5FLYA 1T4DA 3CLRC 3F46A 1QE3A 2VS1A 3QENA 4MUGA 5IVPA 4XRRA 3SVLA 1Y7PA 1NYTA 4J0KA 4B74A 3CVYA 4V3BA 3QRWA 1H3NA 4MS1A 3RSOA 4BZPA 3OZGA 5EE1A 3OQMA 3UFXB 5EWJA 1BHQ1 4W82A 1QG2A 4EFNA 1RJFA 5BW5A 1M0EA 2IS6A 5G4LA 4I46A 2AFHB 2FZVA 3UQZA 5AVWA 2C2MA 1CIJA 1FNDA 1W76A 1JQKA 3DKPA 3LUAA 3I05A 1WDLA 2EEZA 1RHQA 5DIFA 2PQ0A 1GAEO 2NZJA 3BGIA 2C7OA 2LE0A 3ZLUA 4EPYA 3UOGA 3AEUB 5IJZA 3KETA 4P4UA 2X42A 5JQGF 3ANXA 2H9AA 5AJXA 1CFJA 1GSOA 2FKAA 1RZ3A 2WIBA 5AICA 1MTZA 3TNJA 2C2ZA 3DFFA 5JRJA 4XD2A 1AKEA 4DHEA 1GWNA 5U1PA 1YDGA 2R8BA 2JLSA 1KI7A 2Y3IA 2Q0SA 2QTVA 3AUFA 1TVMA 4NYIR 1VHTA 4G97A 2ZE5A 4FNOA 4F46A 4WFKA 1ZC3A 2CCJA 3SLKA 4TKUB 3EF1A 2BTQA 2JK1A 4OP1A 3LSTA 4U6NA 4HX2A 1F7UA 4ZJZA 2QRQA 5JJIA 1TM2A 4CNBA 2ET6A 4A6XA 1TT7A 2G0AA 5DF1A 2WHPA 4K6MA 5CCBA 2W2MA 4DXHA 1THMA 2IHKA 3EQ7A 3G82C 4XSHA 4WN3A 1CSEE 2MYNA 3OTGA 3IBFA 4ISBA 4IOKA 4LIPD 1OAKA 2CLLB 2WVJA 4FYXA 4IZHA 4R05A 3C7TA 3VFDA 3AHFA 1WXDA 2VA8A 2ZULA 2WUFA 3C87A 1NF3A 5LDHA 2L2QA 1P0QA 2FN3A 1E3EA 3N0WA 4ZHQB 4C4OA 1OASA 2X14A 1JH9A 1MAAA 2X5OA 3Q10A 1NVMB 4YJ3A 5B36A 1QP4A 5TR9A 1NBHA 1UZLA 1IZ9A 1CJBA 4GPEA 3BG5A 2O8DB 4GSKA 1ZRSA 2FCAA 3K70D 4MI1A 3K0AB 4V3CA 3CKLA 1CUZA 1ZZEA 4ILKA 4FQ7A 4ZRMA 4AWAA 3CRVA 5AW3A 1CUWA 1JA9A 1Z74A 4EY6A 5KTOA 3HR7A 2B8WA 1QGOA 4IV5A 5BT9A 4JI4B 3I30X 2GF2A 2P67A 4RK6A 4C4PA 1E1DA 4NDNE 4QU5A 3WGNA 1HPLA 5DHQA 4TMYA 3U4HA 3C3AA 2ZPUA 1M2VA 2VYND 4L75A 2YXDA 3MSCA 2AL7A 1IMJA 3AL2A 4ALMA 2B94A 1GTVA 3PDCA 1SHLA 5F1KA 3SBDA 4EYQA 1G98A 3PGLA 2BGMA 4DC9A 2BCGY 4XVRA 2EKBA 1E3IA 1G60A 3OJWA 2D00A 2IWRA 3NPMA 2R48A 4R2KA 3ABRB 4WZZA 1UF9A 5JCOC 2GMWA 3U3RA 4DLRA 5A9SA 4ITRC 1YVUA 4OKIA 1RRGA 1XWWA 3WIEA 2HHAA 4CCSA 4JK3A 4FI3C 4U7FA 2ZJZA 2R751 3N05A 1S8AA 2WTMA 3FSEA 2EP7A 1K3FA 2ZQ5A 1E1CA 1Y98A 2D2VA 3N5KA 1ZOPA 2DOKA 3HUFA 4GLFA 4B3GA 4BWVA 4B40A 4CTJA 4N5IX 4ZK6A 1TT5A 4B73A 4H3VA 3HR4A 2LPMA 3ORFA 3WGVA 1MEEA 2LDXA 4OSEA 4AICA 1C4WA 4WXYB 1V3UA 5CM9C 5DTMA 1GNPA 4E6EA 4EA7A 2I65A 1SU6A 1N25A 1W96A 1J09A 1R0WA 2PJZA 1GOTA 1UJCA 4YVFA 4JHLA 1W36D 2G72A 2GCIA 5MN5A 1Q7CA 3OJEA 5TVGA 1E58A 4IIUA 4HH0A 2PEYA 4KLAA 5TT1A 3IEXA 3QLJA 3L7DA 1HWYA 1KS2A 3SHFA 2IVFA 2ZAOA 3OOJA 1K8YB 3LWZA 1L4GA 4ONEA 1CZRA 5KNLA 2VDLB 3LUKA 5EEHA 2W22A 4IR7A 3S8YA 2H4WA 5BR1A 3DCIA 1T2UA 2OO3A 3IAUA 3WRVA 3BGDA 3X2EA 2V9PA 3V4VB 1M2NA 2QP4A 3VH1A 2OCPA 4R9SA 1T0BA 2UXBB 2ZR7A 1JU4A 2PUCA 1DB3A 4HL6A 3HEBA 1CY6A 4D9JA 3FMGA 3P26A 1C1DB 2FX3A 2ZSJA 4DBZA 1U3GA 3ELDA 4R41A 1JLLB 4DVGA 2I67A 4CF7A 4EI9A 1C8KA 1SKQA 3SC4A 5TEVA 5A3QA 1P4JA 1BKSB 5BW8A 2HCFA 1KNQA 4J9UE 4ZAWA 3O8OA 1EVJA 5CD1A 4EZIA 1HTTA 3TW4A 2YVQA 4OAPA 1TEZA 3IMCA 3IQGX 5EJIA 3CYFA 4ZV4A 5FCDA 4UOZA 5JYDA 1BJRE 2IBTA 2AX3A 4M83A 1UXOA 3GLIE 1SB9A 1F6WA 1UBLS 4NEGA 1NUUA 3NTVA 4U5XA 3I62A 5K0LA 1GZUA 1W4BA 3HJUA 3MQ2A 4UVIA 2H4YA 4PRKA 2EC5A 4FFVA 4QXPA 1MG0A 1A1SA 1V6CA 1CV2A 3JQBC 3M89A 5B37A 3F6EX 3OQNA 2HMUA 1HMYA 3KHUA 3R3XA 1P81A 1IJFA 4TLDA 2F7SA 4LJSA 3ENVA 2CHQA 5FXMA 3GP5A 2RH5A 2R7LA 3EOBI 3I6MA 3IDQA 3F6SA 3OM1A 2BONA 4FX2A 4UNQA 3IEIA 1E6UA 1DO2A 2G71A 1T5SA 1NVDA 2I6FA 3ZE9A 3PICA 2GASA 2JATA 4FGSA 2FN7A 5CFLA 2IXTA 4OMDA 2AIRA 1SKAA 3ZHVA 2GVZC 2HX1A 2OHFA 3U17A 3QLVA 1VL0A 4MVJI 4HS4A 2C5LA 3ER8A 1M8KA 2D5IA 5A06A 4NNJA 2ZCUA 4HFNA 4LC9A 2GEDA 1BWPA 1IZ8A 1GEGA 3ZJYA 3OZEA 1IZ7A 3SJUA 3DZIA 3ZXUB 4Q9JA 2XF2A 4K03A 3HYLA 4F11A 4YUYA 1W5FA 3I1IA 1Y3HA 2Z58A 4K9QA 1A97A 2PX5A 2ZE6A 3IQHX 4KOEC 4U9HS 3EN0A 3NO4A 1T5LA 4BNNA 2Q46A 3C5EA 3CLTC 1U80A 3IYLW 4MQEB 2CV0A 1PI3A 5A6SB 4BUZA 1H2EA 1IWOA 3FX2A 1X1DA 3T6KA 1CB0A 4H4EA 3LY8A 2H85A 5F1YA 4ME6A 5DYGA 3HU2A 4MYCA 4FOOA 5KYUA 1M66A 3MWKA 5KCZA 4C7OA 3PHHA 2NACA 2VHWA 1FMJA 2DPGA 1PU2A 5TQ0A 2ZAYA 3L4BA 3ZWYA 1XN4A 3IR5A 5SY6A 2YOGA 1B74A 1MVLA 1R6AA 4HY3A 4JBWA 4Y1RB 3THYA 1SCAA 3N86A 4Y6PA 3I12A 3E9MA 2FXVA 1HTWA 3VKUA 2IYEA 2GA8A 1SQGA 2VOEA 3A6DA 4PZZA 3FYHA 4UUAA 1CU1A 1NI4A 3BMOA 3JSXA 3BAFA 4L3VA 1BA3A 3L8YA 5EAIA 5EE9A 5MGNA 2J3JA 1K75A 2I4MA 3OEED 3EZ9A 3EBPA 2BHTA 3HI4A 4GZ6A 4M1QA 4TMTA 3ZWQA 5B7NA 3HP7A 3EGXA 4CMIB 4Q02A 4D9CA 1BJKA 4B8WA 2QYSA 3B38A 3I5MA 3SX4A 3T4PA 3GEHA 2DGDA 1L1EA 4OMUA 4ALIA 1Z6YA 4C2BA 1JHXA 1KBZA 1VKOA 4M9QA 1XZNA 1WV1A 1UWLA 2HOQA 2P5YA 1GUZA 5IP5A 4C1BA 4D42A 4CMKA 4MUEA 2I3GA 4EUFA 4IDAA 3W5SA 3H5NA 4YMSA 3E82A 2WP0A 5L40A 1NBIA 2BFBB 3LQ1A 3EASA 3HO8A 3IVRA 4WZBE 5KSZA 3OOHA 2VHZA 5UKDA 1BOOA 2P90A 2VHUA 2R7MA 1QVZA 1ZL2A 3GLGE 3ZN2A 2B3DA 2H31A 1P2VA 3IEKA 4J3FA 4HATA 3OI7A 3DFKA 4R1PA 4Q3KA 2PGAA 3RYHB 1U8XX 4J2OA 4K9OA 3S2GA 4LE0A 1M2EA 3A06A 4LQ4A 4RKEA 4KQWA 5K3AA 2PYZA 4I5FA 3QKWA 1A8PA 1IJBA 2AG5A 2BDUA 2GZDA 1TK3A 4FN4A 2QUAA 4MGEA 5EWJB 4RLFA 2EX4A 2NPFA 1KJZA 1AGXA 3SU8A 5IWCA 5KB3A 3U61B 5FEMA 4LMAA 3AYZB 3TIXB 3QVLA 1ZBQA 1TZBA 4UM9D 4DCGA 1WY7A 4ZCTA 3B9PA 3OWXA 5IVKA 4M22A 3DF7A 4GOJA 1AE1A 5HIKA 4QDZA 1G8GA 2IYVA 3OUTA 3SR0A 4UCFA 4DA0A 2FPPB 3VU3A 3Q5GA 4KXLA 1E1RD 1QYCA 3AHJA 4TLLB 5ENZA 1SVKA 2OORA 1EDEA 2OQVA 4M7RA 1D4AA 3LSYA 1UMBB 1RQNA 4YAEA 1DG9A 3HCPA 2J0QA 2HF8A 5BMOA 3DR5A 5KNDH 3KVNA 4F9EA 3IBCA 4L5AA 3WKDA 1C1HA 2X7HA 2YV3A 3CW2A 4BTEA 1N2BA 1XVUA 3GP3A 4ZYZA 3P2YA 4YXFA 4D96A 1JSCA 1QQ6A 1JR4A 1G8JA 4X6LA 2AGVA 3AEKA 3AV3A 5DH9A 4PHHA 1GADO 4MJ3A 4C6HA 3TX6A 3R5FA 4CVNA 1NQWA 3J80A 3I2FA 3QWBA 3IV7A 1E3WB 1NYRA 1TEXA 1MQ9A 2X77A 4KMSA 3UANA 5F51A 1XLWA 2P6OA 3DMTC 1TVKB 2UVPB 2IGBA 1KYXA 1UWKA 3DKIA 5IH3A 3UA4A 3EA0A 2JRLA 4EPWA 2IRWA 5I9IA 3MUNA 1E7YA 1ENYA 1L4EA 2IE8A 3JRXA 1KAGA 4I08A 1QIGA 4DSAA 1QVVA 1QYRA 1PTKA 1EFAA 1FMLA 1BWQA 1EE9A 2C94A 3JARB 1A5BB 2N0SA 3DZKA 1SBYA 1LJ8A 2ZUTA 5LQSA 1K06A 2GS9A 3T0IA 1KAHA 2HBZA 7REQA 4PHFA 2C7VA 2Y6VA 2PZEA 1VPVA 2ZU6A 4GZ5A 1VI6A 1ISRA 4K9DA 5FWXA 4QC2A 3HVRA 5ESDA 3MJVA 1BXRA 2ERYA 2G9ZA 3DZFA 3LM8A 3X1MA 4PLHA 1NLZA 1CQJA 3ZW7A 2I9KA 2FR8C 2GZ3A 2VZLA 1CB7A 2X8JA 1QIHA 1DS6A 2GZSA 3BHIA 2FI1A 4H4CA 5KNCH 3AFMA 1JDBB 3M1AA 1AQ6A 5EKXA 3L2OB 3H16A 2XTNA 1TCAA 5KTMA 2ZPAA 2HADA 2IV2X 4ZDKA 4YXWD 1J22A 2A14A 1QF7A 3FJ1A 3JZFA 4UXHA 2DSNA 1PZEA 2B34A 5B3KA 3WLMA 3L07A 4GX0A 4UDNA 3KB2A 4P4LA 2P1ZA 4EPVA 4BGEA 1F2UA 3P97A 1Z9BA 3WGUA 1E9EA 2CDCA 3R8XA 4KPGA 2M2IA 1UMDB 2IYPA 2HRRA 2CNNA 4FQ5A 4HWKA 4KLRA 3HA2A 4UQPA 1M2FA 3CISA 4ESEA 4IXWA 2WYWA 2Z4TA 5HCIA 1DJMA 2GBFA 1BJTA 1NXSA 3C6XA 2PFKA 4BP9A 4LNHA 2NZYA 5JCPA 1N2CE 2ZRCA 1T0JB 1U11A 2FKNA 3I72A 2Q5FA 2OGUA 1JHOA 2DM6A 3BE4A 1GD1O 1QZUA 2PKWA 2JIMA 3D2BA 4ZCQA 2RGXA 3FYSA 1WSBA 2FMHA 1OU4A 4OQZA 5FPYA 1OGJA 4PAGA 5IM5A 4RA9A 5K99A 3INRA 3IVCA 4RCZA 3ZCXA 1G19A 4KR6A 2BSAA 2VXCA 2ZJ0A 1HRDA 3EAQA 3AESA 4LDRA 4EA6A 4R0MA 1KTIA 1ORVA 4PC3A 4BVJA 3U2QA 3A6KA 5DBGA 4EG1A 2PXCA 4WNCA 5IU6A 4L74A 2GAOA 4NZPA 2XJ4A 5B64A 3BDAA 3QV1A 7GPBA 3R9XA 3FOEC 2FWJA 1PGQA 5AW5A 1IONA 4QOFA 3JATA 3W6PA 4XX1A 4CKXA 2FX2A 2WWVD 3OZAA 2KI5A 4YTEA 3HADA 4D0LB 4ZXFA 1PKXA 5I4CA 3ROPA 3C8HA 4U0KA 4YCCA 1SUBA 3JALB 1SC4A 5ES4B 3VKVA 3AF6A 3T1YB 4ZAFA 1IHUA 4TTSA 5FP0A 3EUAA 3IVXA 1P91A 4L4SA 1KDYA 1CUVA 4QECA 3UPDA 1FU8A 2VUIB 3SSNA 5F3DA 3ZJVA 1DX4A 1HL3A 1BYUA 2ZIUB 1GLNA 3AETB 3CEJA 3CWCA 1DXYA 4DQLA 4XB6B 2IYLD 5IFKA 5JMTA 5JROA 3UPUA 4YV2A 2IA5A 1SXJA 2Z09A 1EM6A 1RAEA 1UBJS 1IN5A 4DLWA 4ER7A 1XRRA 3AEQA 5H7XA 2RG1A 4MIYA 4PAWA 1D4FA 1S2IA 1I4DD 1ZIDA 3EC7A 3MGCA 2J3EA 2WAOA 4FX5A 1R4MA 3IUPA 4KLCA 3MGBA 3RRXA 3B3FA 3B89A 3BM5A 4Q21A 3VTKA 1AQJA 4YAGA 3BFJA 2PR7A 3AUYA 2C2XA 3ZIDA 2VFAA 3PDUA 3LC1O 4OH1A 4YRQA 1CS4C 2NN3C 5DK6A 1MOSA 4QPNA 2AFIA 3FZYA 1S8OA 2G5TA 5IABA 2ZWPA 3DUFA 4EW6A 2AMYA 1UP6A 1VA4A 4IXDA 1VJ0A 1Q6YA 3TTSA 1N7IA 3O2NA 4IVPA 1BU5A 1YQEA 2N46A 2DHRA 3IAXA 3KZOA 2Z8XA 3T7RA 4QELA 3R7NA 3VJLA 2I99A 1PJLA 4FE7A 4AKTA 4BLVA 5L7TA 5BOSA 1JIVA 4PZYA 3O1JC 1OZGA 1EH5A 1FP4A 1M9NA 3K1YA 4J6EA 2AX4A 3TG2A 2EHJA 3UA3A 4W1QA 3KOUA 4Y7DA 3VM6A 4RSRA 2W2OA 1WXQA 1E2HA 1RLJA 4GIBA 2ZYHA 1ESCA 4AQ7A 4W8GA 3G2KA 4W8HA 1FVXA 3WGYA 3RLFA 3PVZA 4HCJA 3UWSA 3ROTA 1P3DA 3PXBA 3PL1A 1K8XB 4WNAB 1U0LA 3HN6A 3MINA 3I5AA 4MWCA 1V5EA 1N5LA 1TLFA 4O25A 1E6LA 1CUEA 2OC9A 2WVAA 1XNGA 3DM9B 3HXPA 2INGX 4X94A 4ZVLA 3AEXA 3V2IA 4ML3A 1RWXA 1SBIA 3HWRA 4LUCA 3JQPA 2GLTA 2V8OA 3P2EA 4AECA 4PG8A 2LRHA 5KNBA 4RVSA 3M2TA 3AVPA 1KWKA 3HYTA 3W05A 2XT0A 2FETA 3SC3A 4CN9A 4OTZA 1LW7A 3BMCA 1G3MA 4KAAA 1RM3A 1X6VA 1Z29A 3TI7A 2FUG1 2R8ZA 4KQEA 1KDZA 5KSPA 4LBVA 2YWXA 3GB9A 1QO7A 3LVRE 5IAGA 4TYMA 5IASA 2PZKA 2QM3A 1LBIA 2WIAA 1XZLA 3NVAA 4O5AA 3V5NA 4FSDA 1L5WA 2TMDA 4JJ7A 4NOKA 1JU3A 2AFIE 4TX1A 2ZSHA 2JVIA 5COAA 4YT5A 5FAXA 1JPVA 4WZ6A 3U3XA 5LJLA 1B26A 4WCFC 5FHRA 5A4JA 5CAEA 3UGQA 4JLWA 2AYYA 4EHDA 3KRTA 4TLMB 3PUVA 1ISGA 4CQNA 4GPD1 4IGEA 4P8RA 2FPKA 2H1VA 3V48A 5I3CA 3CNBA 2XWBF 2LKCA 3SJCA 4Q1DA 4RM3A 4CEHA 3LE8A 3P2MA 3A05A 1E2UA 2YOHA 4FZJA 5I9LA 1I4WA 5AOBA 4L07A 4D26A 4EQ6B 2R00A 5JVDF 2P6RA 2B61A 2B20A 4QJ3A 5JADA 2WF8A 4OJKA 1CYDA 1FFBA 2FSPA 4PR3A 1VKRA 4UU7A 3TSZA 4M54A 1SM4A 3IGFA 3IBTA 3ESZA 1N6LA 3OT1B 1W0CA 3CNHA 3W6OA 1VP3A 5C5CA 2D2IA 3ITKA 1V47A 3KDSE 4JUFA 4P93A 3I58A 1EJ2A 1OYYA 2R6HA 4IPTA 1I1QB 3HRIA 2UZ3A 5FO0A 3W5IA 4RWZA 3G5LA 3NONA 4PNPA 1ZN7A 4DDWA 5TMBA 2W11A 1YZGA 3IP5A 1WMEA 3LWNA 1G0OA 4FQ8A 3AILA 2WQZA 1BVHA 2A30A 2QRGA 2Q3CA 5IH7A 2CLOB 3AJ9A 4ALLA 4BKMA 5JZBA 4KTTE 4G5YA 4HEQA 5DM4A 1XEWX 4BFLA 5AVSA 1EK6A 5JZSA 1J00A 2HSGA 4U63A 5J4YA 1WF6A 1USUA 3GYGA 2BGUA 4WEQA 2W6ID 1PT8A 3CRMA 2MSNA 1H4SA 2J85A 2IHVA 3QEMB 2ZXEA 4JH0A 3BCRA 2BGJA 4UAVA 5D5HA 3LCMA 1LQ2A 3QKRB 5CK4A 4CW7A 1KC3A 5LJIA 2RARA 4KXNA 4KXXA 3ZS8A 1EPUA 2X9QA 4OUDB 1N0UA 3BZUA 1I4TD 1K8RA 3B1YA 2CCKA 3CR8A 3JD4A 3OLYA 4JASB 4NMXB 4BMDA 4F92B 2ISCA 2O20A 1MF7A 1VMEA 3ECSA 1IUOA 1WVIA 3MTDA 4QUKA 1ZI9A 3HHEA 4I8IA 4UU8A 3BSYA 5EHGA 3KQLA 1RLTA 4LECA 3SNHA 3BRQA 1RWBA 3VC1A 3I92A 3QJ5A 1PG5A 1KEKA 1EXMA 1U7HA 2OCGA 1GPKA 1X8LA 4PE5B 4TTVA 2JIBA 1D7AA 1KDRA 4C4SA 3TQOA 2CJWB 5DTJA 1FFDA 4HYTA 1C9EA 1Z83A 1P72A 3GCDA 2OE2A 3ELBA 3MT8A 3MLEA 4LJ8A 4B6QA 4O4JF 1CJTC 5HF9A 4TL6A 4FCTA 1ZIOA 2IYYA 2N47A 1RYDA 3WMXA 4HEHA 4C29A 4FE3A 4MOWA 2BD0A 3EARA 2F59A 2HZBA 3DMDA 5JSKA 3WL4A 4BLUA 4RTMA 3PG5A 5EHZA 1VKJA 3DG9A 3E4CA 4EFKA 4Q4HA 1FUEA 3DDHA 1BIFA 3L7BA 2WMDA 4R0NA 4BO1A 1NFFA 4MR7A 3L18A 2EIXA 1XD2B 4A2WA 1KAQA 3BE6A 2WM2A 1RM5A 3MGKA 1SK8A 3MJTA 1DJPA 5J59A 1GILA 2PFGA 1NXOA 3DLTA 3WRWA 4P7JA 4B09A 4Y18A 3OFNA 5ANRB 2AKEA 2VHXA 3C6MA 1NUSA 3ESRA 3G17A 1QLWA 3L7AA 1HDGO 1S3IA 1LC3A 4ZOBA 5JO9A 1PV1A 1ZVVA 4RKYA 4RD6A 3F97A 4E7OA 1K4YA 4AO6A 4EFDA 4HEA6 1KHHA 4OHUA 3SK0A 4GF5A 4RPJA 2XVZA 4E1AA 4P0PB 4X1KA 1I1OA 1YACA 3DEKA 3LGSA 1V7ZA 1X77A 1O9BA 2D5LA 1PE0A 3C6YA 1RBYA 4UU1A 2EHDA 1II8B 3RTCA 1U3CA 4UBJA 5E9JA 4LYEA 3W1WA 2I76A 2AR0A 2JGKA 3V4OA 2R6R1 4QREA 1XOIA 4ZEWA 2QKYA 5ALIA 2UYQA 3I2GA 5G4KB 5KINB 4G84A 1QCDA 1N5RA 2H1WA 3KCQA 3LA8A 3TTTA 2O3SA 4HWSA 2X4IA 1PNTA 3GUZA 3FTCA 1TPZA 1KEEA 2PUGA 4QUGA 4JCCA 3SS9X 3L7JA 5JUWA 1E64A 1RRFA 1NDQA 1KO8A 3Q4GA 4EY5A 4LJLA 1LJLA 2AK2A 3F7NA 1CZHA 3D3JA 5CEJA 4DUGA 4OYRA 3EZYA 2ZBRA 5HFJA 4AO7A 4IBOA 1I2CA 2WT8A 3R75A 3C7CB 4EARA 2QMUA 3NWJA 4PG7A 2O19A 1TLLA 4TSFA 2A1IA 1O95D 3IL2A 3FY4A 1O0BA 4R1TA 4AJEA 5E4TA 3CH5A 4I9FA 4RPGA 4OX9Y 2P7HA 1U2PA 2RGNC 3MM4A 3MS2A 4QTTB 3KDPA 4JXJA 1XCPA 4MR9A 1KY4A 2LCFA 3QM1A 4RY0A 4Z9XA 3OE7D 3OAAA 2B6HA 4PZDA 4A0GA 1U8EA 4E09A 1XEAA 3UUEA 4Y2XA 5EJEA 1KL7A 4LFAB 1AKVA 1Q83A 4BHTA 1A2QA 1NBOA 2I3AA 3RGGA 3WP1B 1G18A 1XNRB 3EJWA 3A31A 3N0RA 4EB6B 4EG7A 4XD7A 2FSUA 3I6BA 2EKPA 1I24A 4GZLA 3KJGA 3LBFA 4QWWA 3V8PA 4X8LA 5DM60 1VG0B 2C9BA 3H3FA 4TMKA 5KYYB 2PUAA 3CINA 3L46A 4Y1FA 1E77A 2AXEA 2O2JA 3DW1X 1ZR2A 4QOHA 4UM9B 1FP2A 3VZSA 3E2MA 4FJ2A 4GM0A 5D87A 3HPRA 1NV8A 4JVMA 4WEOA 1V35A 3FTNA 1DVRA 5DZSA 4GYJA 5EERA 2PV7A 1XA3A 1GQYA 4MEAA 5GP1A 3K9GA 2K5UA 1GA1A 1WZNA 4RO0A 4L2IB