2NUEA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.9-angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords 46-MER
total genus 68
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nueA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nueA02
1RQ0A 2RS6A 2NUFA 4DUYE 1X47A 2LTRA 2F4VE 3O2RA 1STUA 1XNRE 2B7VA 2L3CA 4M30A 2RS7A 4LF6E 4OX9E 2DIXA 4B3ME 4GKKE 4DKKA 2L2KB 4X66E 1GQEA 1JFZA 4LF7E 1WHQA 4LFCE 2NUGA 4X62E 3T1YE 3VYXA 2IHR1 4JI7E 4LF8E 4B3SE 1FJGE 3P1XA 2B3TB 2NUEA 2JVAA 4DR1E 2UXBE 4DV5E 4JI0E 2GSLA 2EB1A 4JI6E 1N36E 3C4TA 4NXME 1HNWE 3RV1A 3J7Yp 2ZM6E 1FKAE 3T1HE 4DR3E 4LFAE 5LMUE 2N3GA 2DB2A 5CFFE 4DV3E 3OTOE 4LF5E 2JY9A 4JI8E 2LBSB 1T4OA 1X49A 1T4LB 1RC5A 1UILA 4DUZE 1EKZA 1DI2A 4X64E 3VYYA 2VQEE 1HR0E 3ADJA 4LFBE 4NXNE 4JI1E 1I4SA 2RTXA 1X48A 4DR6E 1ZBTA 1U61A 2LRSA 2UUBE 2L3JA 4YY3E 3ADGA 4DV7E 2NA2A 4DV2E 3RV0A 2RSMA 1XMQE 4LF4E 4JI3E 1YYOA 4B3TE 3ADIA 3O2RB 1YYWA 1WHNA 2UU9E 4AQYE 2UXCE 1UHZA 1YZ9A 1PKPA 4DV0E 1HNXE 2QVWA 2LJHA 1HNZE 1I94E 1IBME 2A11A 1N32E 1J5EE 1RC7A 4X8WA 4DR2E 4DR7E 4DR4E 4K0KE 4M2ZA 3ADLA 4JYAE 2EZ6A 2CPNA 5BR8E 1YYKA 4JI5E 4KHPE 4OUNA 2KHXA 1J26A 4WYQB 1IBLE 2LUPB 4B3RE 2LTSA 1T4NA 4WFTA 2UUAE 1QU6A 4LF9E 4GKJE 2N3HA 4DV6E 2UXDE 1XNQE 2YT4A 2L2MA 2UUCE 1N34E 1IBKE 4JV5E 2MDRA 4YHHE 1XMOE 2HHHE 2DMYA 4DV1E 4JI2E 2VQFE 3LLHA 4JI4E 2L2NA 4DV4E 2B7TA 1O0WA 3N3WA 3HTXA 2E5LE 2LUQA 3C4BA 4DR5E 4X65E 2L33A 1N33E 5LMNE 2FFLA 5IWAE 4OOGC
chains in the Genus database with same CATH superfamily
2RS6A 1WJPA 3BGHA 3K6QA 1XNRE 4WSGA 4M30A 2RS7A 5A69A 1ZAAC 2L2KB 1JFZA 5A6BA 4X62E 1WXRA 1TF3A 2YTQA 2YTIA 3J80C 1Z1BA 1F2IG 4JI0E 2LT7A 2EM6A 5ADZA 2N8XA 2YU5A 4R2CA 1DQ3A 4BC9A 2FTXB 4DR3E 1SFEA 2YTFA 4WXCA 1YFHA 4R03A 2DSYA 4LF5E 2JY9A 4NZVA 1SR9A 1T4OA 1X49A 1T4LB 1RC5A 3ADJA 2EPKX 2CTDA 2ENHA 1GTKA 1X48A 4YY3E 4ZYEA 2EMBA 3JU0A 5AE2A 5DNYA 3LMLA 1XMQE 4LF4E 1YYOA 3BBGA 4F6NA 2J7JA 3DJWA 4HEIA 1X3CA 4GZNC 1YZ9A 2LVHA 2EM3A 5A6BD 2EM2A 1N32E 5TSEA 2D9HA 2ODRC 1IQSA 2EQ1A 4X8WA 1ZBQA 4LU9A 2EOMA 2V85A 4K0KE 2V89A 4R2DA 2G7HA 1YSAC 5BR8E 4IS1C 3JTZA 4BMJA 4JI5E 1J26A 1A1KA 1IBLE 1A1GA 2BBGA 1AH5A 2LTSA 1EH8A 2E72A 1BBOA 1PJSA 2N3HA 2UXDE 1XNQE 4O43A 1KJKA 2L2MA 2UUCE 1G2DC 2EPOA 5KL6A 4YHHE 4JV5E 3TQMA 2HHHE 2EQ3A 2VQFE 2RSIA 2EE8A 2EOJA 2L2NA 4NHRA 2DLKA 1G2FC 4R2PA 5IXMB 2Q8UA 3N3WA 4FK5C 4IJDA 2LUQA 3C4BA 4X65E 5AASA 2V87A 2DMIA 2EOYA 2EN3A 2MKDA 1RQ0A 2EMWA 1P47A 4F9AB 2F4VE 1STUA 2K7IA 1NCSA 5KL4A 1A1LA 3MHSC 2K4VA 1AAYA 2DIXA 4OX9E 4DKKA 1KYQA 2VRDA 1GQEA 4L5NC 4LF7E 4LFCE 1WHQA 2YTNA 1LLMC 1ZU1A 4MLQA 3VYXA 5LLQA 5AE1A 4ZYDA 4B3SE 2B3TB 2JPAA 1EH7A 2ENCA 2EPXA 2EQ0A 4R2RA 2UXBE 2ENAA 4Q28A 2WBUA 2GSLA 2EB1A 2GPIA 5KL3A 2ODRD 4NXME 3EQ1A 2ZM6E 4F9CB 2YTPA 1YPNA 4BS9A 2M9AA 3T1HE 2EMKA 4LFAE 2KONA 4F2JC 5CFFE 2LE2A 4DV3E 4MLVA 3OTOE 4JI8E 2LBSB 3EPHA 2BB8A 3BF2A 4R2AA 2V88A 4X64E 3VYYA 2EORA 2L8TA 2VQEE 4LFBE 4NXNE 1I4SA 2RTXA 2EOIA 3UK3C 1T38A 2RQLA 1ZBTA 1U61A 2EPNA 2LJUA 3BIDA 4P78A 4KWYA 2RSMA 2V83A 2EOFA 3O2RB 2ELYA 1TF6A 2UXCE 2UU9E 1UHZA 2EJ4A 1PKPA 2QVWA 2A11A 4HTGA 1J5EE 4TUGA 3J7AG 4R2EA 3ZOQB 2CT1A 3C6MA 4DR4E 3ADLA 2YSPA 2VF1A 2KHXA 2V86A 2WCC3 3EPLA 2YRKA 4LTYA 1T4NA 4WFTA 2EN2A 4GKJE 4I8OA 2YZTA 4DV6E 2EOHA 2EPRA 5AC4A 2EMAA 5A2QC 4JI4E 2JYAA 2E1MA 2EWLA 4DV4E 2EP3A 4BHCA 4F9BB 3HXLA 2EOOA 2YTDA 2WBSA 2LV2A 2E5LE 4DR5E 2EN6A 3AV0A 2EPAA 1PJTA 2HJJA 1N33E 1A1FA 2JWOA 2JOXA 2NUFA 2ELZA 2MC5A 1X47A 2MKNA 1GZ6A 4O24A 4R2SA 2B7VA 2L3CA 4LF6E 4B3ME 4GKKE 4X66E 2YTOA 2V8QB 2NUGA 5IT9C 2JP9A 1IQOA 4ZYHA 4M0VA 2IHR1 4LF8E 3P1XA 2JVAA 4DR1E 4M9VC 3C4TA 2WZOA 5KL2A 3RV1A 4GEQB 1FKAE 4F54A 2EPPA 4BCAA 5A6AA 3IWBA 2PRTA 2EL6A 4O4KA 2N3GA 5LMUE 2EMHA 1X6HA 2R76A 1EH6A 1L4SA 1PDAA 2DB2A 2YTEA 2B9DA 4ZYGA 2EMGA 4WPYA 2L92A 2YRHA 2YSOA 1UILA 4KZSA 4DUZE 1EKZA 2EPMX 3IWDA 1DI2A 3F6HA 4WSPA 2EM8A 2EOEA 5T6JA 3KWRA 2EPZA 4BHBA 1IMUA 2LRSA 2EM9A 2UUBE 3ADGA 2NA2A 2YTJA 3J81C 3RV0A 3ADIA 2EM4A 4N4RB 1A1JA 3THNA 3H09A 1YYWA 1WHNA 2R1FA 3ECRA 4WXDA 2JR1A 5LL6R 2L6MA 1HNXE 2EN8A 2HGHA 1HNZE 1IBME 3IWCA 2EMXA 2JXPA 2EPCA 1RC7A 4DR2E 4JYAE 2ADRA 2CPNA 4X9JA 3QG5C 1YYKA 4KHPE 4OUNA 2EM5A 5AC5A 2EL4A 1MGTA 2EOXA 2A25A 5A6JA 1QU6A 2YWQA 5KL7A 4LF9E 2EN4A 2LCEA 1T39A 1B69A 2YT4A 1BB8A 1N34E 1IBKE 1XMOE 2YU8A 3VK6A 2DMYA 1QNTA 2YTGA 4DV1E 1TN9A 3RMPA 1UBDC 2RPCA 2F8BA 2FV4B 2EMIA 4L8NA 1O0WA 5AE3A 3HTXA 4R2QA 2EN1A 2EMCA 2L33A 5LMNE 3C6KA 2FFLA 5IWAE 4DV0E 2WBTA 4OOGC 4DUYE 2LTRA 2MC6A 2H36X 3O2RA 4P7DA 2CSHA 2EPUA 3MSWA 2LO3A 1UN6B 1RMDA 2GHFA 3OMLA 2YPNA 4O5GA 3T1YE 3DF6A 4JI7E 5F3WA 4TUIA 1FJGE 2NUEA 2FGGA 1WRJA 4DV5E 5FLXC 4JI6E 1N36E 1HNWE 3J7Yp 4BBYA 4WX9A 4DMIA 2EPLX 3EPKA 1MEYC 4R8OA 1YUJA 2VE7C 3KZYA 1HR0E 2GLIA 2MDGA 2EMZA 2DGCA 4JI1E 1X6EA 2EN7A 3L00A 3VHTB 4DR6E 2EOQA 2M1SA 2L3JA 4DV7E 1X5WA 4DV2E 2EMLA 2M7QA 3AUZA 4JI3E 4B3TE 4Q35B 4AQYE 5A6KA 3EPJA 2DLQA 2KOUA 2JOBA 2LJHA 1YUIA 1I94E 1BBGA 2DRPA 4F6MA 1ZR9A 2EOSA 4RH8A 3KZZA 2LMZA 2M4IA 5IV8B 4DR7E 2I9IA 1NEIA 4M2ZA 4J8ZA 2EZ6A 3HPSA 5KL5A 1DGCA 1PJQA 2YRMA 4WYQB 3M99B 2LUPB 4B3RE 1N3GA 2HC5A 2UUAE 1JK1A 3FIGA 3HPZA 4BC7A 2EM0A 4RHBB 2MDRA 3F6GA 4JI2E 3THOB 3LLHA 2EOZA 2I13A 3JAMC 1ZTDA 1A1IA 1JK2A 2B7TA 2EMFA 1X6FA 3HQ1A 2EL5A 2EMYA 2NABA 2EM7A 3MHHC 1A1HA
chains in the Genus database with same CATH topology
1RQ0A 2RS6A 2NUFA 4DUYE 2MC5A 1X47A 2LTRA 2MC6A 3K6QA 4F9AB 2H36X 3O2RA 1GZ6A 1STUA 4P7DA 1XNRE 2F4VE 2B7VA 2L3CA 4M30A 2RS7A 2K4VA 3MSWA 2DIXA 4B3ME 4LF6E 4DKKA 2L2KB 4OX9E 4X66E 1GQEA 4L5NC 1JFZA 4LF7E 1WHQA 2V8QB 3OMLA 2NUGA 5IT9C 4LFCE 4X62E 3T1YE 1WXRA 3DF6A 4M0VA 3VYXA 2IHR1 4JI7E 5F3WA 4LF8E 5AE1A 4B3SE 4TUIA 1FJGE 3P1XA 2B3TB 3J80C 2NUEA 2FGGA 2JVAA 4Q28A 4DV5E 4DR1E 4JI0E 5FLXC 2GSLA 2EB1A 4JI6E 1N36E 2ODRD 3C4TA 2WZOA 5ADZA 4NXME 1HNWE 3RV1A 4GKKE 4GEQB 3J7Yp 2ZM6E 4F9CB 1FKAE 4F54A 1DQ3A 4BC9A 4BCAA 4BS9A 3T1HE 2FTXB 3IWBA 4BBYA 4DR3E 4LFAE 5LMUE 2N3GA 2KONA 4DMIA 2DB2A 4R03A 2B9DA 2LE2A 2DSYA 5CFFE 4DV3E 3OTOE 4LF5E 2JY9A 4JI8E 2LBSB 1SR9A 1T4OA 1X49A 4R8OA 1T4LB 4WPYA 2L92A 1RC5A 1UILA 4KZSA 4DUZE 1EKZA 2VE7C 3IWDA 2V88A 1DI2A 3F6HA 4X64E 4WSPA 2L8TA 2VQEE 3VYYA 3ADJA 1HR0E 4NXNE 4LFBE 5T6JA 4JI1E 1I4SA 2RTXA 3KWRA 1X48A 4DR6E 1ZBTA 1U61A 2LRSA 2M1SA 2UUBE 4P78A 4YY3E 3ADGA 2L3JA 4DV7E 2NA2A 4DV2E 3JU0A 5AE2A 3J81C 5DNYA 3RV0A 2RSMA 2V83A 2M7QA 3LMLA 3AUZA 1XMQE 1YYOA 4B3TE 4JI3E 4LF4E 3ADIA 3O2RB 3H09A 1YYWA 1WHNA 3DJWA 4AQYE 2UU9E 1UHZA 2UXCE 2JR1A 1YZ9A 2KOUA 5LL6R 1PKPA 2L6MA 2JOBA 4DV0E 1HNXE 2QVWA 2LJHA 1HNZE 1I94E 1IBME 2A11A 1N32E 3IWCA 1J5EE 4TUGA 2ODRC 3J7AG 1RC7A 4X8WA 1ZBQA 2LMZA 4LU9A 4DR2E 2M4IA 2V85A 3ZOQB 4DR7E 4DR4E 4K0KE 4M2ZA 2V89A 3ADLA 4J8ZA 2G7HA 4JYAE 2EZ6A 2CPNA 2VF1A 3HPSA 5BR8E 1YYKA 3JTZA 4BMJA 4OUNA 2KHXA 4JI5E 2V86A 4WYQB 4KHPE 1J26A 1IBLE 2LUPB 4B3RE 4LTYA 2LTSA 1T4NA 4WFTA 2UUAE 1QU6A 4LF9E 2UXBE 4GKJE 3FIGA 2N3HA 4I8OA 2YZTA 3HPZA 4BC7A 4DV6E 2YT4A 1XNQE 2UXDE 2L2MA 2UUCE 1N34E 1IBKE 4JV5E 2MDRA 4YHHE 1XMOE 3F6GA 3VK6A 2DMYA 2HHHE 5A2QC 4DV1E 2VQFE 3RMPA 4JI2E 3LLHA 3JAMC 4JI4E 2F8BA 2E1MA 2EWLA 2L2NA 4DV4E 2B7TA 2FV4B 3HQ1A 4F9BB 3HXLA 4L8NA 1O0WA 3N3WA 5AE3A 3HTXA 2E5LE 2LUQA 3C4BA 4DR5E 4X65E 2L33A 4OOGC 3AV0A 5AASA 2V87A 5LMNE 1N33E 2JWOA 2FFLA 5IWAE 2JOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQ0 A;  2RS6 A;  2NUF A;  4DUY E;  1X47 A;  2LTR A;  2F4V E;  3O2R A;  1STU A;  1XNR E;  2B7V A;  2L3C A;  4M30 A;  2RS7 A;  4LF6 E;  4OX9 E;  2DIX A;  4B3M E;  4GKK E;  4DKK A;  2L2K B;  4X66 E;  1GQE A;  1JFZ A;  4LF7 E;  1WHQ A;  4LFC E;  2NUG A;  4X62 E;  3T1Y E;  3VYX A;  2IHR 1;  4JI7 E;  4LF8 E;  4B3S E;  1FJG E;  3P1X A;  2B3T B;  2NUE A;  2JVA A;  4DR1 E;  2UXB E;  4DV5 E;  4JI0 E;  2GSL A;  2EB1 A;  4JI6 E;  1N36 E;  3C4T A;  4NXM E;  1HNW E;  3RV1 A;  3J7Y p;  2ZM6 E;  1FKA E;  3T1H E;  4DR3 E;  4LFA E;  5LMU E;  2N3G A;  2DB2 A;  5CFF E;  4DV3 E;  3OTO E;  4LF5 E;  2JY9 A;  4JI8 E;  2LBS B;  1T4O A;  1X49 A;  1T4L B;  1RC5 A;  1UIL A;  4DUZ E;  1EKZ A;  1DI2 A;  4X64 E;  3VYY A;  2VQE E;  1HR0 E;  3ADJ A;  4LFB E;  4NXN E;  4JI1 E;  1I4S A;  2RTX A;  1X48 A;  4DR6 E;  1ZBT A;  1U61 A;  2LRS A;  2UUB E;  2L3J A;  4YY3 E;  3ADG A;  4DV7 E;  2NA2 A;  4DV2 E;  3RV0 A;  2RSM A;  1XMQ E;  4LF4 E;  4JI3 E;  1YYO A;  4B3T E;  3ADI A;  3O2R B;  1YYW A;  1WHN A;  2UU9 E;  4AQY E;  2UXC E;  1UHZ A;  1YZ9 A;  1PKP A;  4DV0 E;  1HNX E;  2QVW A;  2LJH A;  1HNZ E;  1I94 E;  1IBM E;  2A11 A;  1N32 E;  1J5E E;  1RC7 A;  4X8W A;  4DR2 E;  4DR7 E;  4DR4 E;  4K0K E;  4M2Z A;  3ADL A;  4JYA E;  2EZ6 A;  2CPN A;  5BR8 E;  1YYK A;  4JI5 E;  4KHP E;  4OUN A;  2KHX A;  1J26 A;  4WYQ B;  1IBL E;  2LUP B;  4B3R E;  2LTS A;  1T4N A;  4WFT A;  2UUA E;  1QU6 A;  4LF9 E;  4GKJ E;  2N3H A;  4DV6 E;  2UXD E;  1XNQ E;  2YT4 A;  2L2M A;  2UUC E;  1N34 E;  1IBK E;  4JV5 E;  2MDR A;  4YHH E;  1XMO E;  2HHH E;  2DMY A;  4DV1 E;  4JI2 E;  2VQF E;  3LLH A;  4JI4 E;  2L2N A;  4DV4 E;  2B7T A;  1O0W A;  3N3W A;  3HTX A;  2E5L E;  2LUQ A;  3C4B A;  4DR5 E;  4X65 E;  2L33 A;  1N33 E;  5LMN E;  2FFL A;  5IWA E;  4OOG C; 
#chains in the Genus database with same CATH topology
 2RS6 A;  1WJP A;  3BGH A;  3K6Q A;  1XNR E;  4WSG A;  4M30 A;  2RS7 A;  5A69 A;  1ZAA C;  2L2K B;  1JFZ A;  5A6B A;  4X62 E;  1WXR A;  1TF3 A;  2YTQ A;  2YTI A;  3J80 C;  1Z1B A;  1F2I G;  4JI0 E;  2LT7 A;  2EM6 A;  5ADZ A;  2N8X A;  2YU5 A;  4R2C A;  1DQ3 A;  4BC9 A;  2FTX B;  4DR3 E;  1SFE A;  2YTF A;  4WXC A;  1YFH A;  4R03 A;  2DSY A;  4LF5 E;  2JY9 A;  4NZV A;  1SR9 A;  1T4O A;  1X49 A;  1T4L B;  1RC5 A;  3ADJ A;  2EPK X;  2CTD A;  2ENH A;  1GTK A;  1X48 A;  4YY3 E;  4ZYE A;  2EMB A;  3JU0 A;  5AE2 A;  5DNY A;  3LML A;  1XMQ E;  4LF4 E;  1YYO A;  3BBG A;  4F6N A;  2J7J A;  3DJW A;  4HEI A;  1X3C A;  4GZN C;  1YZ9 A;  2LVH A;  2EM3 A;  5A6B D;  2EM2 A;  1N32 E;  5TSE A;  2D9H A;  2ODR C;  1IQS A;  2EQ1 A;  4X8W A;  1ZBQ A;  4LU9 A;  2EOM A;  2V85 A;  4K0K E;  2V89 A;  4R2D A;  2G7H A;  1YSA C;  5BR8 E;  4IS1 C;  3JTZ A;  4BMJ A;  4JI5 E;  1J26 A;  1A1K A;  1IBL E;  1A1G A;  2BBG A;  1AH5 A;  2LTS A;  1EH8 A;  2E72 A;  1BBO A;  1PJS A;  2N3H A;  2UXD E;  1XNQ E;  4O43 A;  1KJK A;  2L2M A;  2UUC E;  1G2D C;  2EPO A;  5KL6 A;  4YHH E;  4JV5 E;  3TQM A;  2HHH E;  2EQ3 A;  2VQF E;  2RSI A;  2EE8 A;  2EOJ A;  2L2N A;  4NHR A;  2DLK A;  1G2F C;  4R2P A;  5IXM B;  2Q8U A;  3N3W A;  4FK5 C;  4IJD A;  2LUQ A;  3C4B A;  4X65 E;  5AAS A;  2V87 A;  2DMI A;  2EOY A;  2EN3 A;  2MKD A;  1RQ0 A;  2EMW A;  1P47 A;  4F9A B;  2F4V E;  1STU A;  2K7I A;  1NCS A;  5KL4 A;  1A1L A;  3MHS C;  2K4V A;  1AAY A;  2DIX A;  4OX9 E;  4DKK A;  1KYQ A;  2VRD A;  1GQE A;  4L5N C;  4LF7 E;  4LFC E;  1WHQ A;  2YTN A;  1LLM C;  1ZU1 A;  4MLQ A;  3VYX A;  5LLQ A;  5AE1 A;  4ZYD A;  4B3S E;  2B3T B;  2JPA A;  1EH7 A;  2ENC A;  2EPX A;  2EQ0 A;  4R2R A;  2UXB E;  2ENA A;  4Q28 A;  2WBU A;  2GSL A;  2EB1 A;  2GPI A;  5KL3 A;  2ODR D;  4NXM E;  3EQ1 A;  2ZM6 E;  4F9C B;  2YTP A;  1YPN A;  4BS9 A;  2M9A A;  3T1H E;  2EMK A;  4LFA E;  2KON A;  4F2J C;  5CFF E;  2LE2 A;  4DV3 E;  4MLV A;  3OTO E;  4JI8 E;  2LBS B;  3EPH A;  2BB8 A;  3BF2 A;  4R2A A;  2V88 A;  4X64 E;  3VYY A;  2EOR A;  2L8T A;  2VQE E;  4LFB E;  4NXN E;  1I4S A;  2RTX A;  2EOI A;  3UK3 C;  1T38 A;  2RQL A;  1ZBT A;  1U61 A;  2EPN A;  2LJU A;  3BID A;  4P78 A;  4KWY A;  2RSM A;  2V83 A;  2EOF A;  3O2R B;  2ELY A;  1TF6 A;  2UXC E;  2UU9 E;  1UHZ A;  2EJ4 A;  1PKP A;  2QVW A;  2A11 A;  4HTG A;  1J5E E;  4TUG A;  3J7A G;  4R2E A;  3ZOQ B;  2CT1 A;  3C6M A;  4DR4 E;  3ADL A;  2YSP A;  2VF1 A;  2KHX A;  2V86 A;  2WCC 3;  3EPL A;  2YRK A;  4LTY A;  1T4N A;  4WFT A;  2EN2 A;  4GKJ E;  4I8O A;  2YZT A;  4DV6 E;  2EOH A;  2EPR A;  5AC4 A;  2EMA A;  5A2Q C;  4JI4 E;  2JYA A;  2E1M A;  2EWL A;  4DV4 E;  2EP3 A;  4BHC A;  4F9B B;  3HXL A;  2EOO A;  2YTD A;  2WBS A;  2LV2 A;  2E5L E;  4DR5 E;  2EN6 A;  3AV0 A;  2EPA A;  1PJT A;  2HJJ A;  1N33 E;  1A1F A;  2JWO A;  2JOX A;  2NUF A;  2ELZ A;  2MC5 A;  1X47 A;  2MKN A;  1GZ6 A;  4O24 A;  4R2S A;  2B7V A;  2L3C A;  4LF6 E;  4B3M E;  4GKK E;  4X66 E;  2YTO A;  2V8Q B;  2NUG A;  5IT9 C;  2JP9 A;  1IQO A;  4ZYH A;  4M0V A;  2IHR 1;  4LF8 E;  3P1X A;  2JVA A;  4DR1 E;  4M9V C;  3C4T A;  2WZO A;  5KL2 A;  3RV1 A;  4GEQ B;  1FKA E;  4F54 A;  2EPP A;  4BCA A;  5A6A A;  3IWB A;  2PRT A;  2EL6 A;  4O4K A;  2N3G A;  5LMU E;  2EMH A;  1X6H A;  2R76 A;  1EH6 A;  1L4S A;  1PDA A;  2DB2 A;  2YTE A;  2B9D A;  4ZYG A;  2EMG A;  4WPY A;  2L92 A;  2YRH A;  2YSO A;  1UIL A;  4KZS A;  4DUZ E;  1EKZ A;  2EPM X;  3IWD A;  1DI2 A;  3F6H A;  4WSP A;  2EM8 A;  2EOE A;  5T6J A;  3KWR A;  2EPZ A;  4BHB A;  1IMU A;  2LRS A;  2EM9 A;  2UUB E;  3ADG A;  2NA2 A;  2YTJ A;  3J81 C;  3RV0 A;  3ADI A;  2EM4 A;  4N4R B;  1A1J A;  3THN A;  3H09 A;  1YYW A;  1WHN A;  2R1F A;  3ECR A;  4WXD A;  2JR1 A;  5LL6 R;  2L6M A;  1HNX E;  2EN8 A;  2HGH A;  1HNZ E;  1IBM E;  3IWC A;  2EMX A;  2JXP A;  2EPC A;  1RC7 A;  4DR2 E;  4JYA E;  2ADR A;  2CPN A;  4X9J A;  3QG5 C;  1YYK A;  4KHP E;  4OUN A;  2EM5 A;  5AC5 A;  2EL4 A;  1MGT A;  2EOX A;  2A25 A;  5A6J A;  1QU6 A;  2YWQ A;  5KL7 A;  4LF9 E;  2EN4 A;  2LCE A;  1T39 A;  1B69 A;  2YT4 A;  1BB8 A;  1N34 E;  1IBK E;  1XMO E;  2YU8 A;  3VK6 A;  2DMY A;  1QNT A;  2YTG A;  4DV1 E;  1TN9 A;  3RMP A;  1UBD C;  2RPC A;  2F8B A;  2FV4 B;  2EMI A;  4L8N A;  1O0W A;  5AE3 A;  3HTX A;  4R2Q A;  2EN1 A;  2EMC A;  2L33 A;  5LMN E;  3C6K A;  2FFL A;  5IWA E;  4DV0 E;  2WBT A;  4OOG C;  4DUY E;  2LTR A;  2MC6 A;  2H36 X;  3O2R A;  4P7D A;  2CSH A;  2EPU A;  3MSW A;  2LO3 A;  1UN6 B;  1RMD A;  2GHF A;  3OML A;  2YPN A;  4O5G A;  3T1Y E;  3DF6 A;  4JI7 E;  5F3W A;  4TUI A;  1FJG E;  2NUE A;  2FGG A;  1WRJ A;  4DV5 E;  5FLX C;  4JI6 E;  1N36 E;  1HNW E;  3J7Y p;  4BBY A;  4WX9 A;  4DMI A;  2EPL X;  3EPK A;  1MEY C;  4R8O A;  1YUJ A;  2VE7 C;  3KZY A;  1HR0 E;  2GLI A;  2MDG A;  2EMZ A;  2DGC A;  4JI1 E;  1X6E A;  2EN7 A;  3L00 A;  3VHT B;  4DR6 E;  2EOQ A;  2M1S A;  2L3J A;  4DV7 E;  1X5W A;  4DV2 E;  2EML A;  2M7Q A;  3AUZ A;  4JI3 E;  4B3T E;  4Q35 B;  4AQY E;  5A6K A;  3EPJ A;  2DLQ A;  2KOU A;  2JOB A;  2LJH A;  1YUI A;  1I94 E;  1BBG A;  2DRP A;  4F6M A;  1ZR9 A;  2EOS A;  4RH8 A;  3KZZ A;  2LMZ A;  2M4I A;  5IV8 B;  4DR7 E;  2I9I A;  1NEI A;  4M2Z A;  4J8Z A;  2EZ6 A;  3HPS A;  5KL5 A;  1DGC A;  1PJQ A;  2YRM A;  4WYQ B;  3M99 B;  2LUP B;  4B3R E;  1N3G A;  2HC5 A;  2UUA E;  1JK1 A;  3FIG A;  3HPZ A;  4BC7 A;  2EM0 A;  4RHB B;  2MDR A;  3F6G A;  4JI2 E;  3THO B;  3LLH A;  2EOZ A;  2I13 A;  3JAM C;  1ZTD A;  1A1I A;  1JK2 A;  2B7T A;  2EMF A;  1X6F A;  3HQ1 A;  2EL5 A;  2EMY A;  2NAB A;  2EM7 A;  3MHH C;  1A1H A; 
#chains in the Genus database with same CATH homology
 1RQ0 A;  2RS6 A;  2NUF A;  4DUY E;  2MC5 A;  1X47 A;  2LTR A;  2MC6 A;  3K6Q A;  4F9A B;  2H36 X;  3O2R A;  1GZ6 A;  1STU A;  4P7D A;  1XNR E;  2F4V E;  2B7V A;  2L3C A;  4M30 A;  2RS7 A;  2K4V A;  3MSW A;  2DIX A;  4B3M E;  4LF6 E;  4DKK A;  2L2K B;  4OX9 E;  4X66 E;  1GQE A;  4L5N C;  1JFZ A;  4LF7 E;  1WHQ A;  2V8Q B;  3OML A;  2NUG A;  5IT9 C;  4LFC E;  4X62 E;  3T1Y E;  1WXR A;  3DF6 A;  4M0V A;  3VYX A;  2IHR 1;  4JI7 E;  5F3W A;  4LF8 E;  5AE1 A;  4B3S E;  4TUI A;  1FJG E;  3P1X A;  2B3T B;  3J80 C;  2NUE A;  2FGG A;  2JVA A;  4Q28 A;  4DV5 E;  4DR1 E;  4JI0 E;  5FLX C;  2GSL A;  2EB1 A;  4JI6 E;  1N36 E;  2ODR D;  3C4T A;  2WZO A;  5ADZ A;  4NXM E;  1HNW E;  3RV1 A;  4GKK E;  4GEQ B;  3J7Y p;  2ZM6 E;  4F9C B;  1FKA E;  4F54 A;  1DQ3 A;  4BC9 A;  4BCA A;  4BS9 A;  3T1H E;  2FTX B;  3IWB A;  4BBY A;  4DR3 E;  4LFA E;  5LMU E;  2N3G A;  2KON A;  4DMI A;  2DB2 A;  4R03 A;  2B9D A;  2LE2 A;  2DSY A;  5CFF E;  4DV3 E;  3OTO E;  4LF5 E;  2JY9 A;  4JI8 E;  2LBS B;  1SR9 A;  1T4O A;  1X49 A;  4R8O A;  1T4L B;  4WPY A;  2L92 A;  1RC5 A;  1UIL A;  4KZS A;  4DUZ E;  1EKZ A;  2VE7 C;  3IWD A;  2V88 A;  1DI2 A;  3F6H A;  4X64 E;  4WSP A;  2L8T A;  2VQE E;  3VYY A;  3ADJ A;  1HR0 E;  4NXN E;  4LFB E;  5T6J A;  4JI1 E;  1I4S A;  2RTX A;  3KWR A;  1X48 A;  4DR6 E;  1ZBT A;  1U61 A;  2LRS A;  2M1S A;  2UUB E;  4P78 A;  4YY3 E;  3ADG A;  2L3J A;  4DV7 E;  2NA2 A;  4DV2 E;  3JU0 A;  5AE2 A;  3J81 C;  5DNY A;  3RV0 A;  2RSM A;  2V83 A;  2M7Q A;  3LML A;  3AUZ A;  1XMQ E;  1YYO A;  4B3T E;  4JI3 E;  4LF4 E;  3ADI A;  3O2R B;  3H09 A;  1YYW A;  1WHN A;  3DJW A;  4AQY E;  2UU9 E;  1UHZ A;  2UXC E;  2JR1 A;  1YZ9 A;  2KOU A;  5LL6 R;  1PKP A;  2L6M A;  2JOB A;  4DV0 E;  1HNX E;  2QVW A;  2LJH A;  1HNZ E;  1I94 E;  1IBM E;  2A11 A;  1N32 E;  3IWC A;  1J5E E;  4TUG A;  2ODR C;  3J7A G;  1RC7 A;  4X8W A;  1ZBQ A;  2LMZ A;  4LU9 A;  4DR2 E;  2M4I A;  2V85 A;  3ZOQ B;  4DR7 E;  4DR4 E;  4K0K E;  4M2Z A;  2V89 A;  3ADL A;  4J8Z A;  2G7H A;  4JYA E;  2EZ6 A;  2CPN A;  2VF1 A;  3HPS A;  5BR8 E;  1YYK A;  3JTZ A;  4BMJ A;  4OUN A;  2KHX A;  4JI5 E;  2V86 A;  4WYQ B;  4KHP E;  1J26 A;  1IBL E;  2LUP B;  4B3R E;  4LTY A;  2LTS A;  1T4N A;  4WFT A;  2UUA E;  1QU6 A;  4LF9 E;  2UXB E;  4GKJ E;  3FIG A;  2N3H A;  4I8O A;  2YZT A;  3HPZ A;  4BC7 A;  4DV6 E;  2YT4 A;  1XNQ E;  2UXD E;  2L2M A;  2UUC E;  1N34 E;  1IBK E;  4JV5 E;  2MDR A;  4YHH E;  1XMO E;  3F6G A;  3VK6 A;  2DMY A;  2HHH E;  5A2Q C;  4DV1 E;  2VQF E;  3RMP A;  4JI2 E;  3LLH A;  3JAM C;  4JI4 E;  2F8B A;  2E1M A;  2EWL A;  2L2N A;  4DV4 E;  2B7T A;  2FV4 B;  3HQ1 A;  4F9B B;  3HXL A;  4L8N A;  1O0W A;  3N3W A;  5AE3 A;  3HTX A;  2E5L E;  2LUQ A;  3C4B A;  4DR5 E;  4X65 E;  2L33 A;  4OOG C;  3AV0 A;  5AAS A;  2V87 A;  5LMN E;  1N33 E;  2JWO A;  2FFL A;  5IWA E;  2JOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...