2NUEA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.9-angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
220
Chain Sequence
b'KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 46-MER
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 68
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nueA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nueA02
3VYXA 3T1HE 2KHXA 2L3JA 2A11A 1IBLE 3P1XA 2QVWA 5CFFE 1GQEA 3O2RA 2FFLA 4X65E 1FJGE 4K0KE 1YYWA 4LF7E 1XNQE 1HNWE 4LF9E 4DUZE 4LFAE 1YYOA 2NA2A 4DR4E 4DR7E 5BR8E 2UXDE 2DB2A 2B7VA 2GSLA 3N3WA 1ZBTA 1JFZA 1X48A 4AQYE 4JV5E 1X47A 4NXME 1FKAE 2IHR1 2LRSA 2LJHA 2UUAE 2F4VE 2UXCE 1XMQE 2RTXA 3C4BA 2L3CA 2JY9A 2DIXA 2RS7A 1N34E 1HNXE 2LTRA 2B3TB 4JYAE 4DV4E 4JI3E 1U61A 2B7TA 1N32E 1J5EE 2L2KB 2EZ6A 4DR2E 4NXNE 2UU9E 3HTXA 4KHPE 4B3SE 4GKJE 3ADJA 2DMYA 4X62E 2LUPB 4B3TE 4DV1E 1WHQA 3C4TA 4YHHE 4WFTA 4DR3E 4JI4E 2LBSB 4X8WA 2JVAA 1STUA 1I4SA 1PKPA 4JI8E 1X49A 2NUFA 2YT4A 3VYYA 4LF8E 5LMUE 1I94E 3ADLA 4B3RE 4GKKE 4DR1E 2N3HA 1N36E 1DI2A 1YZ9A 4X64E 2LUQA 4DV3E 3LLHA 1XNRE 1RC5A 1XMOE 1HR0E 1T4NA 3O2RB 4LF6E 4DV0E 4LF4E 1RQ0A 2NUEA 4DV5E 4B3ME 4DR6E 4JI5E 2L2NA 2L33A 4X66E 4DV6E 1T4LB 1RC7A 2EB1A 2MDRA 3ADIA 1HNZE 2NUGA 4DV2E 4LF5E 4OX9E 4YY3E 4DV7E 2UUCE 1UILA 4WYQB 3RV0A 2CPNA 4OUNA 3J7Yp 1IBKE 4DR5E 3RV1A 1QU6A 1O0WA 2ZM6E 4LFBE 2UXBE 3OTOE 2L2MA 2RSMA 2E5LE 2RS6A 5IWAE 2LTSA 3T1YE 2UUBE 4LFCE 1N33E 1J26A 1YYKA 2HHHE 4JI1E 4JI2E 4M2ZA 4DUYE 2VQFE 1IBME 4JI6E 1T4OA 2N3GA 4OOGC 4DKKA 4M30A 2VQEE 3ADGA 1WHNA 4JI7E 4JI0E 1UHZA 5LMNE 1EKZA
chains in the Genus database with same CATH superfamily
3T1HE 1N3GA 2L3JA 1PJSA 1GQEA 3HQ1A 4X65E 4O24A 1EH8A 4MLVA 2YPNA 3MSWA 5KL4A 4LF9E 2GPIA 4LFAE 2L6MA 4LTYA 4DR4E 2ELZA 2B7VA 5A6JA 2EN6A 2CTDA 4NXME 2IHR1 1A1HA 4Q28A 2LRSA 1Z1BA 4R2PA 2A25A 5A6AA 5FLXC 4GZNC 2L3CA 2JY9A 1EH6A 2DIXA 3RMPA 4NHRA 4DV4E 3HPZA 2YSPA 2BBGA 1BB8A 1J5EE 2EQ0A 2EZ6A 2UU9E 2FGGA 2EPXA 3KZZA 1A1KA 1GTKA 4KHPE 4B3SE 5AE2A 2E1MA 3J80C 2V83A 4ZYEA 2YTOA 2V85A 4L8NA 2H36X 4DR3E 4JI4E 1X49A 3IWDA 2NUFA 4LF8E 1DI2A 4DR1E 1N36E 2MKNA 1YZ9A 2EL5A 4R8OA 2ODRD 2NABA 1RC5A 4LF6E 4WSGA 4LF4E 1RQ0A 1RMDA 5AC5A 1MGTA 4DR6E 4JI5E 2EPOA 3IWBA 4ZYHA 1F2IG 2EPZA 1L4SA 2MDGA 2UUCE 1UILA 2CPNA 3THOB 2EQ1A 2D9HA 4LFBE 2M4IA 2LJUA 3OTOE 3UK3C 1WJPA 2RS6A 1N33E 3TQMA 2J7JA 2EMXA 2JR1A 1YUJA 2VQFE 4F54A 3KWRA 4O5GA 2YTEA 4WX9A 5A6BA 4M30A 2HC5A 3DJWA 2V88A 1A1JA 4F2JC 2EWLA 4F9AB 1WRJA 1P47A 1EKZA 3VYXA 2KHXA 4HTGA 3BIDA 2QVWA 3C6MA 3EPHA 4F6MA 2M1SA 1SR9A 2Q8UA 4WXCA 2ENCA 3AUZA 2EM5A 1B69A 2K4VA 2LMZA 4MLQA 1DQ3A 1YYOA 2NA2A 3KZYA 2UXDE 2YSOA 1AAYA 3N3WA 4AQYE 1AH5A 5ADZA 4JV5E 4WPYA 2R1FA 3EPKA 1X47A 2HGHA 4BC9A 2LJHA 4KZSA 2F4VE 2UXCE 1GZ6A 2EMIA 1XMQE 2YTGA 2EMBA 2YTIA 3EPJA 4R2SA 1N34E 2LO3A 1G2FC 1X6FA 4JI3E 2V87A 1N32E 4RHBB 2L2KB 2RSIA 1A1GA 5LLQA 3ADJA 1NEIA 2DMYA 4X62E 3J7AG 5KL2A 2LUPB 3F6HA 2EMWA 2EJ4A 4YHHE 2EOYA 4WFTA 2EPKX 3JU0A 4GEQB 4BBYA 1ZTDA 4X8WA 4J8ZA 1STUA 2YTQA 1PKPA 2KOUA 1A1FA 1I94E 4GKKE 2N3HA 4X64E 4WSPA 2EOJA 3QG5C 4M0VA 2LVHA 2EOXA 4DV3E 1XNRE 2BB8A 1BBGA 2YZTA 3O2RB 4DV0E 2JOBA 2EMAA 2EL6A 3ZOQB 4DMIA 4DV5E 2EMCA 4DV6E 1RC7A 2EOQA 1JK1A 2EM2A 2EMYA 2VE7C 2N8XA 2YTPA 1HNZE 3ADIA 2EOFA 4DV2E 4OX9E 3F6GA 3BF2A 4WYQB 2LT7A 1IBKE 1KJKA 2EN1A 3VK6A 1O0WA 2YWQA 2ZM6E 5KL3A 2ENAA 4R2EA 1UN6B 2CT1A 5IWAE 3T1YE 2UUBE 3K6QA 1PJTA 4BMJA 4M2ZA 4F9BB 4JI6E 2I9IA 2F8BA 4OOGC 2L8TA 4M9VC 4DKKA 2FV4B 2VQEE 4FK5C 4F9CB 1DGCA 4JI7E 1YFHA 4L5NC 2M9AA 1X6EA 1YPNA 2EOOA 4R2QA 4NZVA 2EMKA 3H09A 2EP3A 2JYAA 5AE1A 2YU5A 5CFFE 1WXRA 3O2RA 2FFLA 2V86A 2EM3A 4K0KE 2WBSA 2KONA 4LF7E 2EM6A 1HNWE 1X5WA 5DNYA 4DUZE 4WXDA 2DB2A 4BCAA 2L92A 2YRHA 2VRDA 3ECRA 5AASA 1T38A 1FKAE 2EN4A 4BS9A 5A2QC 1X3CA 3M99B 2YTNA 4IJDA 4HEIA 4KWYA 4N4RB 2YTFA 3L00A 2B3TB 4JYAE 2ELYA 2B7TA 4R2RA 2EM8A 5AE3A 2EMFA 2MC6A 4DR2E 1X6HA 2EQ3A 5KL7A 3HTXA 4Q35B 2CSHA 2EPLX 1ZAAC 1A1LA 4GKJE 5A69A 2EOZA 3JTZA 2RPCA 2JOXA 3HXLA 4B3TE 1ZR9A 4DV1E 2WBUA 2JXPA 5A6BD 2LBSB 1ZU1A 2LCEA 4I8OA 1I4SA 2EMHA 3BGHA 4JI8E 2PRTA 2YT4A 3VYYA 4B3RE 5LMUE 3ADLA 1TF6A 1UBDC 4TUGA 2LUQA 2EN3A 1G2DC 1SFEA 1XMOE 1T4NA 3HPSA 2DRPA 1KYQA 2JP9A 4B3ME 1A1IA 4IS1C 2L2NA 1T4LB 4O4KA 2EMLA 1MEYC 2EM9A 1T39A 5TSEA 2DGCA 4LF5E 4DV7E 1EH7A 2DLKA 3RV0A 4OUNA 2M7QA 1JK2A 4DR5E 1TF3A 2EN7A 2EM0A 1PJQA 2HJJA 2UXBE 2RSMA 2JPAA 2MC5A 2LTSA 4LFCE 5A6KA 1J26A 2JWOA 3EQ1A 2HHHE 2R76A 2YU8A 3J81C 4DUYE 4R2AA 1T4OA 2ADRA 2EL4A 4P7DA 3DF6A 3AV0A 4R2DA 4BHBA 4JI0E 5LMNE 4R2CA 2A11A 1IBLE 2WCC3 3P1XA 1YSAC 2EORA 1FJGE 2ENHA 2YTJA 1YYWA 2K7IA 2ODRC 1XNQE 1PDAA 3JAMC 2EMZA 2GHFA 4ZYGA 1YUIA 2LE2A 2YRMA 2EPMX 2EE8A 4DR7E 5BR8E 1NCSA 5F3WA 2EOHA 2GSLA 1ZBTA 2DLQA 1JFZA 1X48A 2EPRA 5KL6A 3LMLA 3THNA 2EPAA 4X9JA 2G7HA 4F6NA 2WBTA 2EM7A 2UUAE 4BHCA 2RTXA 3C4BA 2EOSA 2RS7A 1HNXE 3EPLA 2EOMA 2EOEA 2LTRA 1U61A 3MHHC 1TN9A 4O43A 4NXNE 3OMLA 3C6KA 3MHSC 2I13A 5AC4A 5IT9C 1WHQA 3C4TA 4TUIA 3IWCA 2V89A 2JVAA 2DMIA 2VF1A 2EPPA 2EPNA 5KL5A 2FTXB 5T6JA 2EMGA 4RH8A 3LLHA 1HR0E 2DSYA 4R03A 4ZYDA 2YRKA 1IMUA 2NUEA 2V8QB 3FIGA 2L33A 2YTDA 4X66E 2LV2A 3BBGA 2EB1A 2EPCA 2MDRA 2RQLA 2EM4A 2NUGA 2GLIA 5IV8B 4YY3E 2EOIA 3J7Yp 1BBOA 2EN8A 2EPUA 1IQSA 3RV1A 1QU6A 4BC7A 2WZOA 2L2MA 2E5LE 2MKDA 1YYKA 2EN2A 4JI1E 4JI2E 3VHTB 4LU9A 1IBME 2N3GA 2E72A 5IXMB 5LL6R 2B9DA 3ADGA 1LLMC 1WHNA 1ZBQA 1IQOA 1UHZA 1QNTA 4P78A
chains in the Genus database with same CATH topology
3H09A 3VYXA 3T1HE 2KHXA 2L3JA 4B3RE 2A11A 1IBLE 5AE1A 3P1XA 2QVWA 5CFFE 1GQEA 3HQ1A 3O2RA 1WXRA 2FFLA 2M1SA 4X65E 1SR9A 1FJGE 2V86A 4K0KE 1YYWA 2KONA 3AUZA 2ODRC 4LF7E 1XNQE 3MSWA 3JAMC 1HNWE 2K4VA 2LMZA 4LF9E 5DNYA 4DUZE 2L6MA 4LFAE 2LE2A 1DQ3A 1YYOA 2NA2A 4LTYA 4DR4E 4DR7E 5BR8E 2UXDE 4BCAA 2DB2A 2B7VA 2GSLA 3N3WA 1ZBTA 2L92A 5F3WA 1JFZA 1X48A 4AQYE 5ADZA 4JV5E 5AASA 3LMLA 4WPYA 1X47A 2G7HA 4NXME 1FKAE 2IHR1 4BC9A 4Q28A 4BS9A 2LRSA 2LJHA 4KZSA 5A2QC 2UUAE 5FLXC 2F4VE 2UXCE 1GZ6A 1XMQE 2RTXA 3C4BA 2L3CA 2JY9A 2DIXA 2RS7A 1N34E 3RMPA 1HNXE 2LTRA 2B3TB 4JYAE 4DV4E 4JI3E 1U61A 2B7TA 3HPZA 2V87A 1N32E 1J5EE 2L2KB 2EZ6A 5AE3A 2MC6A 4DR2E 4NXNE 2UU9E 2FGGA 3HTXA 4KHPE 3OMLA 4B3SE 4GKJE 3ADJA 5AE2A 2DMYA 4X62E 2E1MA 3J7AG 2LUPB 3J80C 2V83A 3JTZA 3F6HA 2JOXA 3HXLA 5IT9C 4B3TE 2V85A 1WHQA 3C4TA 4L8NA 2H36X 4YHHE 4BBYA 4WFTA 4TUIA 3JU0A 4GEQB 4DR3E 4JI4E 3IWCA 4X8WA 4J8ZA 2V89A 2JVAA 2LBSB 1STUA 1I4SA 1PKPA 2KOUA 1X49A 3IWDA 4I8OA 2NUFA 2VF1A 2YT4A 4JI8E 5LMUE 3VYYA 1I94E 4LF8E 3ADLA 4DR1E 2N3HA 1N36E 4GKKE 1YZ9A 2FTXB 5T6JA 4X64E 4TUGA 4R8OA 4WSPA 4M0VA 2LUQA 2ODRD 3LLHA 4DV3E 1XNRE 1RC5A 1XMOE 1HR0E 1T4NA 2DSYA 3O2RB 2YZTA 4R03A 4LF6E 3HPSA 4DV0E 2JOBA 4LF4E 1RQ0A 3ZOQB 4DMIA 2NUEA 2V8QB 4DV5E 4B3ME 1DI2A 4DR6E 3FIGA 4JI5E 2L2NA 2L33A 3IWBA 4X66E 4DV6E 1T4LB 1RC7A 2EB1A 2MDRA 2VE7C 3ADIA 1HNZE 2NUGA 4DV2E 4LF5E 4OX9E 3F6GA 4YY3E 4DV7E 2UUCE 1UILA 4WYQB 3RV0A 2CPNA 4OUNA 2M7QA 3J7Yp 1IBKE 4DR5E 3VK6A 3RV1A 1QU6A 1O0WA 4BC7A 2ZM6E 4LFBE 2WZOA 2UXBE 2M4IA 3OTOE 2L2MA 2RSMA 2E5LE 2MC5A 2RS6A 5IWAE 2LTSA 3T1YE 2UUBE 4LFCE 1N33E 1J26A 3K6QA 2JWOA 1YYKA 2HHHE 4JI1E 4BMJA 4JI2E 2JR1A 3J81C 4M2ZA 4F9BB 4DUYE 4DV1E 2VQFE 4LU9A 1IBME 4F54A 4JI6E 1T4OA 2N3GA 3KWRA 2F8BA 4OOGC 2L8TA 4P7DA 3DF6A 4DKKA 3AV0A 2FV4B 5LL6R 4M30A 3DJWA 2VQEE 2B9DA 3ADGA 2V88A 4F9CB 1WHNA 1ZBQA 4JI7E 2EWLA 1UHZA 4L5NC 4F9AB 5LMNE 4JI0E 1EKZA 4P78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYX A;  3T1H E;  2KHX A;  2L3J A;  2A11 A;  1IBL E;  3P1X A;  2QVW A;  5CFF E;  1GQE A;  3O2R A;  2FFL A;  4X65 E;  1FJG E;  4K0K E;  1YYW A;  4LF7 E;  1XNQ E;  1HNW E;  4LF9 E;  4DUZ E;  4LFA E;  1YYO A;  2NA2 A;  4DR4 E;  4DR7 E;  5BR8 E;  2UXD E;  2DB2 A;  2B7V A;  2GSL A;  3N3W A;  1ZBT A;  1JFZ A;  1X48 A;  4AQY E;  4JV5 E;  1X47 A;  4NXM E;  1FKA E;  2IHR 1;  2LRS A;  2LJH A;  2UUA E;  2F4V E;  2UXC E;  1XMQ E;  2RTX A;  3C4B A;  2L3C A;  2JY9 A;  2DIX A;  2RS7 A;  1N34 E;  1HNX E;  2LTR A;  2B3T B;  4JYA E;  4DV4 E;  4JI3 E;  1U61 A;  2B7T A;  1N32 E;  1J5E E;  2L2K B;  2EZ6 A;  4DR2 E;  4NXN E;  2UU9 E;  3HTX A;  4KHP E;  4B3S E;  4GKJ E;  3ADJ A;  2DMY A;  4X62 E;  2LUP B;  4B3T E;  4DV1 E;  1WHQ A;  3C4T A;  4YHH E;  4WFT A;  4DR3 E;  4JI4 E;  2LBS B;  4X8W A;  2JVA A;  1STU A;  1I4S A;  1PKP A;  4JI8 E;  1X49 A;  2NUF A;  2YT4 A;  3VYY A;  4LF8 E;  5LMU E;  1I94 E;  3ADL A;  4B3R E;  4GKK E;  4DR1 E;  2N3H A;  1N36 E;  1DI2 A;  1YZ9 A;  4X64 E;  2LUQ A;  4DV3 E;  3LLH A;  1XNR E;  1RC5 A;  1XMO E;  1HR0 E;  1T4N A;  3O2R B;  4LF6 E;  4DV0 E;  4LF4 E;  1RQ0 A;  2NUE A;  4DV5 E;  4B3M E;  4DR6 E;  4JI5 E;  2L2N A;  2L33 A;  4X66 E;  4DV6 E;  1T4L B;  1RC7 A;  2EB1 A;  2MDR A;  3ADI A;  1HNZ E;  2NUG A;  4DV2 E;  4LF5 E;  4OX9 E;  4YY3 E;  4DV7 E;  2UUC E;  1UIL A;  4WYQ B;  3RV0 A;  2CPN A;  4OUN A;  3J7Y p;  1IBK E;  4DR5 E;  3RV1 A;  1QU6 A;  1O0W A;  2ZM6 E;  4LFB E;  2UXB E;  3OTO E;  2L2M A;  2RSM A;  2E5L E;  2RS6 A;  5IWA E;  2LTS A;  3T1Y E;  2UUB E;  4LFC E;  1N33 E;  1J26 A;  1YYK A;  2HHH E;  4JI1 E;  4JI2 E;  4M2Z A;  4DUY E;  2VQF E;  1IBM E;  4JI6 E;  1T4O A;  2N3G A;  4OOG C;  4DKK A;  4M30 A;  2VQE E;  3ADG A;  1WHN A;  4JI7 E;  4JI0 E;  1UHZ A;  5LMN E;  1EKZ A; 
#chains in the Genus database with same CATH topology
 3T1H E;  1N3G A;  2L3J A;  1PJS A;  1GQE A;  3HQ1 A;  4X65 E;  4O24 A;  1EH8 A;  4MLV A;  2YPN A;  3MSW A;  5KL4 A;  4LF9 E;  2GPI A;  4LFA E;  2L6M A;  4LTY A;  4DR4 E;  2ELZ A;  2B7V A;  5A6J A;  2EN6 A;  2CTD A;  4NXM E;  2IHR 1;  1A1H A;  4Q28 A;  2LRS A;  1Z1B A;  4R2P A;  2A25 A;  5A6A A;  5FLX C;  4GZN C;  2L3C A;  2JY9 A;  1EH6 A;  2DIX A;  3RMP A;  4NHR A;  4DV4 E;  3HPZ A;  2YSP A;  2BBG A;  1BB8 A;  1J5E E;  2EQ0 A;  2EZ6 A;  2UU9 E;  2FGG A;  2EPX A;  3KZZ A;  1A1K A;  1GTK A;  4KHP E;  4B3S E;  5AE2 A;  2E1M A;  3J80 C;  2V83 A;  4ZYE A;  2YTO A;  2V85 A;  4L8N A;  2H36 X;  4DR3 E;  4JI4 E;  1X49 A;  3IWD A;  2NUF A;  4LF8 E;  1DI2 A;  4DR1 E;  1N36 E;  2MKN A;  1YZ9 A;  2EL5 A;  4R8O A;  2ODR D;  2NAB A;  1RC5 A;  4LF6 E;  4WSG A;  4LF4 E;  1RQ0 A;  1RMD A;  5AC5 A;  1MGT A;  4DR6 E;  4JI5 E;  2EPO A;  3IWB A;  4ZYH A;  1F2I G;  2EPZ A;  1L4S A;  2MDG A;  2UUC E;  1UIL A;  2CPN A;  3THO B;  2EQ1 A;  2D9H A;  4LFB E;  2M4I A;  2LJU A;  3OTO E;  3UK3 C;  1WJP A;  2RS6 A;  1N33 E;  3TQM A;  2J7J A;  2EMX A;  2JR1 A;  1YUJ A;  2VQF E;  4F54 A;  3KWR A;  4O5G A;  2YTE A;  4WX9 A;  5A6B A;  4M30 A;  2HC5 A;  3DJW A;  2V88 A;  1A1J A;  4F2J C;  2EWL A;  4F9A B;  1WRJ A;  1P47 A;  1EKZ A;  3VYX A;  2KHX A;  4HTG A;  3BID A;  2QVW A;  3C6M A;  3EPH A;  4F6M A;  2M1S A;  1SR9 A;  2Q8U A;  4WXC A;  2ENC A;  3AUZ A;  2EM5 A;  1B69 A;  2K4V A;  2LMZ A;  4MLQ A;  1DQ3 A;  1YYO A;  2NA2 A;  3KZY A;  2UXD E;  2YSO A;  1AAY A;  3N3W A;  4AQY E;  1AH5 A;  5ADZ A;  4JV5 E;  4WPY A;  2R1F A;  3EPK A;  1X47 A;  2HGH A;  4BC9 A;  2LJH A;  4KZS A;  2F4V E;  2UXC E;  1GZ6 A;  2EMI A;  1XMQ E;  2YTG A;  2EMB A;  2YTI A;  3EPJ A;  4R2S A;  1N34 E;  2LO3 A;  1G2F C;  1X6F A;  4JI3 E;  2V87 A;  1N32 E;  4RHB B;  2L2K B;  2RSI A;  1A1G A;  5LLQ A;  3ADJ A;  1NEI A;  2DMY A;  4X62 E;  3J7A G;  5KL2 A;  2LUP B;  3F6H A;  2EMW A;  2EJ4 A;  4YHH E;  2EOY A;  4WFT A;  2EPK X;  3JU0 A;  4GEQ B;  4BBY A;  1ZTD A;  4X8W A;  4J8Z A;  1STU A;  2YTQ A;  1PKP A;  2KOU A;  1A1F A;  1I94 E;  4GKK E;  2N3H A;  4X64 E;  4WSP A;  2EOJ A;  3QG5 C;  4M0V A;  2LVH A;  2EOX A;  4DV3 E;  1XNR E;  2BB8 A;  1BBG A;  2YZT A;  3O2R B;  4DV0 E;  2JOB A;  2EMA A;  2EL6 A;  3ZOQ B;  4DMI A;  4DV5 E;  2EMC A;  4DV6 E;  1RC7 A;  2EOQ A;  1JK1 A;  2EM2 A;  2EMY A;  2VE7 C;  2N8X A;  2YTP A;  1HNZ E;  3ADI A;  2EOF A;  4DV2 E;  4OX9 E;  3F6G A;  3BF2 A;  4WYQ B;  2LT7 A;  1IBK E;  1KJK A;  2EN1 A;  3VK6 A;  1O0W A;  2YWQ A;  2ZM6 E;  5KL3 A;  2ENA A;  4R2E A;  1UN6 B;  2CT1 A;  5IWA E;  3T1Y E;  2UUB E;  3K6Q A;  1PJT A;  4BMJ A;  4M2Z A;  4F9B B;  4JI6 E;  2I9I A;  2F8B A;  4OOG C;  2L8T A;  4M9V C;  4DKK A;  2FV4 B;  2VQE E;  4FK5 C;  4F9C B;  1DGC A;  4JI7 E;  1YFH A;  4L5N C;  2M9A A;  1X6E A;  1YPN A;  2EOO A;  4R2Q A;  4NZV A;  2EMK A;  3H09 A;  2EP3 A;  2JYA A;  5AE1 A;  2YU5 A;  5CFF E;  1WXR A;  3O2R A;  2FFL A;  2V86 A;  2EM3 A;  4K0K E;  2WBS A;  2KON A;  4LF7 E;  2EM6 A;  1HNW E;  1X5W A;  5DNY A;  4DUZ E;  4WXD A;  2DB2 A;  4BCA A;  2L92 A;  2YRH A;  2VRD A;  3ECR A;  5AAS A;  1T38 A;  1FKA E;  2EN4 A;  4BS9 A;  5A2Q C;  1X3C A;  3M99 B;  2YTN A;  4IJD A;  4HEI A;  4KWY A;  4N4R B;  2YTF A;  3L00 A;  2B3T B;  4JYA E;  2ELY A;  2B7T A;  4R2R A;  2EM8 A;  5AE3 A;  2EMF A;  2MC6 A;  4DR2 E;  1X6H A;  2EQ3 A;  5KL7 A;  3HTX A;  4Q35 B;  2CSH A;  2EPL X;  1ZAA C;  1A1L A;  4GKJ E;  5A69 A;  2EOZ A;  3JTZ A;  2RPC A;  2JOX A;  3HXL A;  4B3T E;  1ZR9 A;  4DV1 E;  2WBU A;  2JXP A;  5A6B D;  2LBS B;  1ZU1 A;  2LCE A;  4I8O A;  1I4S A;  2EMH A;  3BGH A;  4JI8 E;  2PRT A;  2YT4 A;  3VYY A;  4B3R E;  5LMU E;  3ADL A;  1TF6 A;  1UBD C;  4TUG A;  2LUQ A;  2EN3 A;  1G2D C;  1SFE A;  1XMO E;  1T4N A;  3HPS A;  2DRP A;  1KYQ A;  2JP9 A;  4B3M E;  1A1I A;  4IS1 C;  2L2N A;  1T4L B;  4O4K A;  2EML A;  1MEY C;  2EM9 A;  1T39 A;  5TSE A;  2DGC A;  4LF5 E;  4DV7 E;  1EH7 A;  2DLK A;  3RV0 A;  4OUN A;  2M7Q A;  1JK2 A;  4DR5 E;  1TF3 A;  2EN7 A;  2EM0 A;  1PJQ A;  2HJJ A;  2UXB E;  2RSM A;  2JPA A;  2MC5 A;  2LTS A;  4LFC E;  5A6K A;  1J26 A;  2JWO A;  3EQ1 A;  2HHH E;  2R76 A;  2YU8 A;  3J81 C;  4DUY E;  4R2A A;  1T4O A;  2ADR A;  2EL4 A;  4P7D A;  3DF6 A;  3AV0 A;  4R2D A;  4BHB A;  4JI0 E;  5LMN E;  4R2C A;  2A11 A;  1IBL E;  2WCC 3;  3P1X A;  1YSA C;  2EOR A;  1FJG E;  2ENH A;  2YTJ A;  1YYW A;  2K7I A;  2ODR C;  1XNQ E;  1PDA A;  3JAM C;  2EMZ A;  2GHF A;  4ZYG A;  1YUI A;  2LE2 A;  2YRM A;  2EPM X;  2EE8 A;  4DR7 E;  5BR8 E;  1NCS A;  5F3W A;  2EOH A;  2GSL A;  1ZBT A;  2DLQ A;  1JFZ A;  1X48 A;  2EPR A;  5KL6 A;  3LML A;  3THN A;  2EPA A;  4X9J A;  2G7H A;  4F6N A;  2WBT A;  2EM7 A;  2UUA E;  4BHC A;  2RTX A;  3C4B A;  2EOS A;  2RS7 A;  1HNX E;  3EPL A;  2EOM A;  2EOE A;  2LTR A;  1U61 A;  3MHH C;  1TN9 A;  4O43 A;  4NXN E;  3OML A;  3C6K A;  3MHS C;  2I13 A;  5AC4 A;  5IT9 C;  1WHQ A;  3C4T A;  4TUI A;  3IWC A;  2V89 A;  2JVA A;  2DMI A;  2VF1 A;  2EPP A;  2EPN A;  5KL5 A;  2FTX B;  5T6J A;  2EMG A;  4RH8 A;  3LLH A;  1HR0 E;  2DSY A;  4R03 A;  4ZYD A;  2YRK A;  1IMU A;  2NUE A;  2V8Q B;  3FIG A;  2L33 A;  2YTD A;  4X66 E;  2LV2 A;  3BBG A;  2EB1 A;  2EPC A;  2MDR A;  2RQL A;  2EM4 A;  2NUG A;  2GLI A;  5IV8 B;  4YY3 E;  2EOI A;  3J7Y p;  1BBO A;  2EN8 A;  2EPU A;  1IQS A;  3RV1 A;  1QU6 A;  4BC7 A;  2WZO A;  2L2M A;  2E5L E;  2MKD A;  1YYK A;  2EN2 A;  4JI1 E;  4JI2 E;  3VHT B;  4LU9 A;  1IBM E;  2N3G A;  2E72 A;  5IXM B;  5LL6 R;  2B9D A;  3ADG A;  1LLM C;  1WHN A;  1ZBQ A;  1IQO A;  1UHZ A;  1QNT A;  4P78 A; 
#chains in the Genus database with same CATH homology
 3H09 A;  3VYX A;  3T1H E;  2KHX A;  2L3J A;  4B3R E;  2A11 A;  1IBL E;  5AE1 A;  3P1X A;  2QVW A;  5CFF E;  1GQE A;  3HQ1 A;  3O2R A;  1WXR A;  2FFL A;  2M1S A;  4X65 E;  1SR9 A;  1FJG E;  2V86 A;  4K0K E;  1YYW A;  2KON A;  3AUZ A;  2ODR C;  4LF7 E;  1XNQ E;  3MSW A;  3JAM C;  1HNW E;  2K4V A;  2LMZ A;  4LF9 E;  5DNY A;  4DUZ E;  2L6M A;  4LFA E;  2LE2 A;  1DQ3 A;  1YYO A;  2NA2 A;  4LTY A;  4DR4 E;  4DR7 E;  5BR8 E;  2UXD E;  4BCA A;  2DB2 A;  2B7V A;  2GSL A;  3N3W A;  1ZBT A;  2L92 A;  5F3W A;  1JFZ A;  1X48 A;  4AQY E;  5ADZ A;  4JV5 E;  5AAS A;  3LML A;  4WPY A;  1X47 A;  2G7H A;  4NXM E;  1FKA E;  2IHR 1;  4BC9 A;  4Q28 A;  4BS9 A;  2LRS A;  2LJH A;  4KZS A;  5A2Q C;  2UUA E;  5FLX C;  2F4V E;  2UXC E;  1GZ6 A;  1XMQ E;  2RTX A;  3C4B A;  2L3C A;  2JY9 A;  2DIX A;  2RS7 A;  1N34 E;  3RMP A;  1HNX E;  2LTR A;  2B3T B;  4JYA E;  4DV4 E;  4JI3 E;  1U61 A;  2B7T A;  3HPZ A;  2V87 A;  1N32 E;  1J5E E;  2L2K B;  2EZ6 A;  5AE3 A;  2MC6 A;  4DR2 E;  4NXN E;  2UU9 E;  2FGG A;  3HTX A;  4KHP E;  3OML A;  4B3S E;  4GKJ E;  3ADJ A;  5AE2 A;  2DMY A;  4X62 E;  2E1M A;  3J7A G;  2LUP B;  3J80 C;  2V83 A;  3JTZ A;  3F6H A;  2JOX A;  3HXL A;  5IT9 C;  4B3T E;  2V85 A;  1WHQ A;  3C4T A;  4L8N A;  2H36 X;  4YHH E;  4BBY A;  4WFT A;  4TUI A;  3JU0 A;  4GEQ B;  4DR3 E;  4JI4 E;  3IWC A;  4X8W A;  4J8Z A;  2V89 A;  2JVA A;  2LBS B;  1STU A;  1I4S A;  1PKP A;  2KOU A;  1X49 A;  3IWD A;  4I8O A;  2NUF A;  2VF1 A;  2YT4 A;  4JI8 E;  5LMU E;  3VYY A;  1I94 E;  4LF8 E;  3ADL A;  4DR1 E;  2N3H A;  1N36 E;  4GKK E;  1YZ9 A;  2FTX B;  5T6J A;  4X64 E;  4TUG A;  4R8O A;  4WSP A;  4M0V A;  2LUQ A;  2ODR D;  3LLH A;  4DV3 E;  1XNR E;  1RC5 A;  1XMO E;  1HR0 E;  1T4N A;  2DSY A;  3O2R B;  2YZT A;  4R03 A;  4LF6 E;  3HPS A;  4DV0 E;  2JOB A;  4LF4 E;  1RQ0 A;  3ZOQ B;  4DMI A;  2NUE A;  2V8Q B;  4DV5 E;  4B3M E;  1DI2 A;  4DR6 E;  3FIG A;  4JI5 E;  2L2N A;  2L33 A;  3IWB A;  4X66 E;  4DV6 E;  1T4L B;  1RC7 A;  2EB1 A;  2MDR A;  2VE7 C;  3ADI A;  1HNZ E;  2NUG A;  4DV2 E;  4LF5 E;  4OX9 E;  3F6G A;  4YY3 E;  4DV7 E;  2UUC E;  1UIL A;  4WYQ B;  3RV0 A;  2CPN A;  4OUN A;  2M7Q A;  3J7Y p;  1IBK E;  4DR5 E;  3VK6 A;  3RV1 A;  1QU6 A;  1O0W A;  4BC7 A;  2ZM6 E;  4LFB E;  2WZO A;  2UXB E;  2M4I A;  3OTO E;  2L2M A;  2RSM A;  2E5L E;  2MC5 A;  2RS6 A;  5IWA E;  2LTS A;  3T1Y E;  2UUB E;  4LFC E;  1N33 E;  1J26 A;  3K6Q A;  2JWO A;  1YYK A;  2HHH E;  4JI1 E;  4BMJ A;  4JI2 E;  2JR1 A;  3J81 C;  4M2Z A;  4F9B B;  4DUY E;  4DV1 E;  2VQF E;  4LU9 A;  1IBM E;  4F54 A;  4JI6 E;  1T4O A;  2N3G A;  3KWR A;  2F8B A;  4OOG C;  2L8T A;  4P7D A;  3DF6 A;  4DKK A;  3AV0 A;  2FV4 B;  5LL6 R;  4M30 A;  3DJW A;  2VQE E;  2B9D A;  3ADG A;  2V88 A;  4F9C B;  1WHN A;  1ZBQ A;  4JI7 E;  2EWL A;  1UHZ A;  4L5N C;  4F9A B;  5LMN E;  4JI0 E;  1EKZ A;  4P78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...