2NUEA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.9-angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 46-MER
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 68
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nueA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nueA02
4M2ZA 2L2NA 1N34E 2GSLA 4LF5E 1N32E 4OOGC 2UUAE 4X64E 4JI6E 1RC7A 1XNQE 4NXNE 3P1XA 1XNRE 4B3RE 2HHHE 1T4LB 1HR0E 4LF4E 2RS7A 4B3ME 2UXCE 1O0WA 4DUZE 2EZ6A 1X48A 2UUCE 1RQ0A 1IBKE 1HNZE 4OX9E 2DB2A 4JI0E 4DV6E 1IBLE 4DV5E 4X65E 1GQEA 1UILA 1I94E 3RV1A 4JI5E 2MDRA 1HNWE 4DR4E 2NA2A 2F4VE 2L2MA 3VYYA 4K0KE 4X62E 4YY3E 3ADGA 3VYXA 1DI2A 4KHPE 2LTSA 2B3TB 1I4SA 3T1HE 3O2RB 4DR6E 2A11A 4WYQB 5LMUE 2LUQA 1FKAE 4NXME 4DV3E 1YYWA 1N33E 5CFFE 2RTXA 1YYOA 3LLHA 2QVWA 1N36E 4DV2E 1UHZA 4LFAE 3RV0A 1RC5A 2CPNA 2UUBE 2KHXA 2LTRA 4DKKA 2RS6A 4DR2E 4JI4E 2N3GA 4YHHE 4AQYE 1FJGE 1JFZA 2NUEA 2RSMA 2UU9E 2IHR1 5LMNE 4GKKE 2VQFE 1XMQE 2NUFA 1QU6A 2UXDE 3ADJA 2LUPB 4M30A 2N3HA 1XMOE 4GKJE 4DUYE 1EKZA 2JY9A 4X8WA 4LF6E 4JYAE 4LF9E 4JI3E 1J26A 4LFBE 2EB1A 4WFTA 4DR3E 1IBME 1ZBTA 2DMYA 2YT4A 5BR8E 3ADIA 2FFLA 2E5LE 2JVAA 1PKPA 2DIXA 4DR5E 3T1YE 2L3JA 1WHQA 2NUGA 1T4NA 1YZ9A 2L3CA 3C4TA 4X66E 2VQEE 4DV1E 4B3TE 3HTXA 4JI8E 1STUA 4DV7E 3C4BA 2B7VA 2LRSA 4B3SE 4DR7E 2LBSB 5IWAE 4OUNA 4JI7E 3OTOE 2LJHA 1WHNA 2UXBE 4DR1E 4LF8E 4DV0E 1X49A 4LF7E 3J7Yp 1HNXE 4JV5E 1X47A 2ZM6E 4DV4E 1J5EE 2B7TA 4JI1E 1U61A 4JI2E 2L33A 4LFCE 1YYKA 2L2KB 3ADLA 1T4OA 3N3WA 3O2RA
chains in the Genus database with same CATH superfamily
4LF5E 5KL4A 2UUAE 1XNQE 3J81C 2V85A 4P78A 4NXNE 4B3RE 1PJQA 4WXCA 2HJJA 2EM7A 3OMLA 2M7QA 3VHTB 2D9HA 4DUZE 2UUCE 1RQ0A 2EPZA 4DV6E 2VRDA 2MDGA 3RV1A 1ZBQA 1DQ3A 2EPLX 5FLXC 1HNWE 4DR4E 2F4VE 2L2MA 2LVHA 3ADGA 2YTJA 1NEIA 3HPSA 2EL4A 4R2RA 2EPCA 1YFHA 2WBTA 4F9CB 2B3TB 2YRHA 4DR6E 1MEYC 5T6JA 4WYQB 2CT1A 4KZSA 2KONA 2N8XA 3LLHA 2QVWA 3BIDA 4R2EA 1N36E 2EOOA 5A2QC 2YTDA 4R2QA 5F3WA 2VF1A 2N3GA 4YHHE 3J7AG 1JFZA 5AE2A 4R03A 2EPPA 4Q35B 2NUFA 1QU6A 5LL6R 1QNTA 4M30A 1PJTA 1F2IG 2JP9A 2EJ4A 4F2JC 4HEIA 2EQ0A 1EKZA 2DGCA 5IT9C 2JWOA 5IXMB 4JYAE 2ODRD 4LF9E 2EOZA 2EM4A 2EN2A 4RH8A 1ZU1A 2MKNA 4I8OA 1PDAA 2FFLA 5AE1A 2JVAA 2DIXA 1L4SA 3T1YE 1WHQA 4TUIA 3HTXA 2YU8A 2B9DA 2L8TA 3MSWA 1UN6B 2YRKA 2E72A 3THNA 1TF6A 2LMZA 4BCAA 4OUNA 4JI7E 2UXBE 2WBUA 1YUIA 2EOHA 2M9AA 3RMPA 3DF6A 2JYAA 1BB8A 4LFCE 2ENHA 1T4OA 2EE8A 3N3WA 2DLKA 1LLMC 3IWCA 3O2RA 2EOIA 3JTZA 2GSLA 2EORA 2EPOA 4F54A 4X64E 2KOUA 1RC7A 4F9AB 1XNRE 5LLQA 4BBYA 2HHHE 1T4LB 3MHHC 3IWDA 4B3ME 4WXDA 2RQLA 2EZ6A 2EMYA 5KL7A 4M9VC 1N3GA 5A6KA 2JOBA 1IBLE 4X65E 4IJDA 5IV8B 1UILA 1I94E 4JI5E 2MDRA 2A25A 1ZAAC 2Q8UA 2K7IA 3AV0A 4J8ZA 4YY3E 1T38A 2EN1A 2YU5A 1DI2A 2BB8A 2LTSA 2EM0A 3T1HE 2YTNA 4RHBB 1G2FC 5LMUE 2EN3A 4NXME 4DV3E 2R76A 5CFFE 1YYOA 4LFAE 4DV2E 3EPLA 3RV0A 2CPNA 2GLIA 2UUBE 2KHXA 2EMCA 4BHBA 2RS6A 4DKKA 1FJGE 2NUEA 2UU9E 5LMNE 5KL6A 2EMWA 4HTGA 3J80C 2VQFE 3EPJA 3JU0A 2YTOA 4DMIA 3LMLA 2YSOA 4O43A 1UBDC 3ADJA 1A1LA 3ECRA 2YTEA 4GKJE 2EM3A 4X8WA 3TQMA 1A1IA 3KZZA 4LF6E 4BMJA 2EMHA 3AUZA 2H36X 4F6NA 1ZBTA 2DMYA 2YT4A 2WCC3 5BR8E 3ADIA 1PKPA 1X3CA 2NUGA 1T4NA 3HPZA 2VQEE 1GZ6A 3KWRA 4WX9A 4R2CA 2LRSA 3F6HA 2LBSB 2I13A 2LJUA 2EOFA 3THOB 1X5WA 2LJHA 3C6MA 1WHNA 3L00A 2V87A 4GZNC 2EPRA 4O5GA 3EPKA 4R8OA 2DRPA 4DV0E 4LF8E 2DLQA 2L92A 3J7Yp 1IMUA 4JV5E 1DGCA 4JI2E 4P7DA 5AC4A 1PJSA 2EM9A 2ODRC 2RSIA 4FK5C 2EM6A 2EQ1A 2EMBA 1N32E 4OOGC 3HXLA 2ADRA 2EM8A 3P1XA 2YSPA 2JPAA 2LCEA 2EMGA 2RS7A 1X6FA 3DJWA 2UXCE 2M4IA 1O0WA 4MLVA 1X48A 4M0VA 1IBKE 1EH8A 2WZOA 5A6AA 4JI0E 2EM5A 5A6BD 3FIGA 2EPAA 5KL2A 1GTKA 2NA2A 2EL5A 4LU9A 3VYYA 4K0KE 2DSYA 2ENAA 2LV2A 3VYXA 4KHPE 4IS1C 3O2RB 2YWQA 1ZTDA 5DNYA 1BBGA 3IWBA 2EOEA 2CTDA 2DMIA 2BBGA 2F8BA 2EOXA 1G2DC 3VK6A 1N33E 2EOSA 2EMKA 2EPUA 2G7HA 2EOYA 4MLQA 1UHZA 4F6MA 1RC5A 1NCSA 5AC5A 2CSHA 4JI4E 2PRTA 4AQYE 5KL5A 2EP3A 2IHR1 2EN4A 4NZVA 2EN8A 2E1MA 4GKKE 3K6QA 2JR1A 3M99B 2YTIA 3HQ1A 2UXDE 1A1GA 2YZTA 2V88A 4X9JA 1XMOE 2YTGA 2GPIA 1P47A 4F9BB 2EM2A 4R2SA 4Q28A 3BF2A 1AAYA 4JI3E 1J26A 4LFBE 2MC6A 2EB1A 2MC5A 4WFTA 4DR3E 1JK1A 1AH5A 1WRJA 2EN7A 2I9IA 2E5LE 1RMDA 4DR5E 4LTYA 4NHRA 2HC5A 1YZ9A 4B3TE 1YPNA 4X66E 4DV1E 4DV7E 3C4BA 4DR7E 4TUGA 5IWAE 4O24A 3KZYA 1MGTA 5A69A 1B69A 1SR9A 4BC7A 1A1KA 4DR1E 1X49A 2EOJA 1HNXE 1A1JA 2ZM6E 4DV4E 2B7TA 4R2AA 4JI1E 2JXPA 2L33A 4BS9A 3ADLA 2LT7A 2ELYA 2YTPA 1YSAC 5ADZA 1BBOA 2EPKX 4M2ZA 2L2NA 4ZYEA 2V89A 1N34E 2EMIA 3JAMC 3EQ1A 1EH6A 2EMLA 4JI6E 3QG5C 1YUJA 2FV4B 1HR0E 4LF4E 2EMXA 2EMZA 3EPHA 4R2PA 1HNZE 4OX9E 2DB2A 1IQSA 5AE3A 2K4VA 2YTQA 2VE7C 4DV5E 2EPMX 4ZYDA 4WSGA 1GQEA 2GHFA 4BC9A 2YTFA 4R2DA 4X62E 1SFEA 5KL3A 2YPNA 1EH7A 1A1FA 1KYQA 1ZR9A 2LO3A 1WXRA 2EL6A 1I4SA 2V83A 1KJKA 1X6EA 2A11A 2EN6A 3UK3C 2LUQA 1FKAE 1YYWA 2V8QB 2RTXA 2EPXA 2LE2A 4ZYGA 4WSPA 4O4KA 2LTRA 4DR2E 2R1FA 5TSEA 2RSMA 2EOQA 2M1SA 1JK2A 2WBSA 2EMAA 1XMQE 2EMFA 2EQ3A 2HGHA 2EPNA 2LUPB 2V86A 2N3HA 4L8NA 4ZYHA 3BBGA 4DUYE 2JY9A 2EOMA 1T39A 2EWLA 1Z1BA 3BGHA 4L5NC 1X6HA 3H09A 1IBME 4KWYA 1TF3A 2RPCA 5A6BA 2FTXB 2YRMA 3ZOQB 2L6MA 2L3JA 3C6KA 2JOXA 2L3CA 3C4TA 4WPYA 4JI8E 1STUA 2B7VA 4GEQB 4B3SE 2ELZA 3F6GA 4BHCA 3OTOE 2ENCA 2J7JA 2NABA 2FGGA 5A6JA 5AASA 4LF7E 1X47A 1A1HA 1J5EE 1IQOA 2MKDA 1U61A 3MHSC 1YYKA 2L2KB 1WJPA 1TN9A 4N4RB
chains in the Genus database with same CATH topology
4M2ZA 2L2NA 2V89A 3JTZA 2GSLA 1N34E 4LF5E 4OOGC 1N32E 3HXLA 4F54A 3JAMC 2KOUA 4X64E 1RC7A 3J81C 2UUAE 2V85A 4P78A 4JI6E 4F9AB 4NXNE 2FV4B 3P1XA 1XNRE 4B3RE 4BBYA 2HHHE 1T4LB 1HR0E 4LF4E 3IWDA 3OMLA 2RS7A 3DJWA 2M7QA 4B3ME 2UXCE 2M4IA 1O0WA 4DUZE 2EZ6A 1X48A 4M0VA 1RQ0A 1IBKE 1HNZE 2UUCE 4OX9E 2DB2A 2WZOA 5AE3A 2K4VA 4JI0E 2VE7C 3FIGA 2JOBA 4DV6E 1IBLE 4DV5E 1XNQE 3HTXA 4X65E 1GQEA 1UILA 1I94E 3RV1A 1ZBQA 1DQ3A 2MDRA 4BC9A 5FLXC 4JI5E 4DR4E 1HNWE 2NA2A 4J8ZA 3AV0A 4LU9A 2F4VE 2L2MA 3VYYA 4K0KE 4X62E 2DSYA 3ADGA 4YY3E 3HPSA 3VYXA 1DI2A 4KHPE 2LTSA 4F9CB 2B3TB 1WXRA 1I4SA 3T1HE 3O2RB 4DR6E 2V83A 5DNYA 3IWBA 5T6JA 2A11A 4WYQB 5LMUE 2F8BA 2LUQA 4KZSA 1FKAE 4NXME 2KONA 1YYWA 2V8QB 3VK6A 4DV3E 1N33E 5CFFE 2RTXA 1YYOA 2LE2A 2G7HA 3LLHA 2QVWA 4WSPA 1N36E 4DV2E 1UHZA 4LFAE 3RV0A 1RC5A 5A2QC 2CPNA 2UUBE 2KHXA 2LTRA 4DKKA 2RS6A 4DR2E 5F3WA 4JI4E 2VF1A 2N3GA 4YHHE 4AQYE 1FJGE 3J7AG 1JFZA 5AE2A 2NUEA 2RSMA 2UU9E 2IHR1 5LMNE 2M1SA 4R03A 3J80C 2E1MA 4DV1E 4GKKE 2VQFE 3JU0A 3K6QA 2JR1A 4DMIA 3LMLA 1XMQE 2NUFA 1QU6A 5LL6R 3HQ1A 2UXDE 3ADJA 2LUPB 4M30A 2V86A 2YZTA 2N3HA 4L8NA 2V88A 1XMOE 4GKJE 4DUYE 1EKZA 2JY9A 4X8WA 4F9BB 5IT9C 2JWOA 4LF6E 4Q28A 4JYAE 4BMJA 2EWLA 2ODRD 4JI3E 3AUZA 4LF9E 4LFBE 2H36X 4L5NC 2MC6A 2EB1A 1J26A 2MC5A 4WFTA 4DR3E 3H09A 1ZBTA 1IBME 2DMYA 4I8OA 2YT4A 5BR8E 3ADIA 2FFLA 5AE1A 2FTXB 2E5LE 2JVAA 1PKPA 2DIXA 4DR5E 3T1YE 4B3TE 3ZOQB 4LTYA 2L6MA 2L3JA 1WHQA 2NUGA 2JOXA 1T4NA 1YZ9A 4TUIA 3C4TA 3HPZA 1GZ6A 4X66E 2L3CA 2VQEE 2B9DA 2L8TA 3KWRA 3MSWA 4WPYA 4JI8E 1STUA 4DV7E 3C4BA 2B7VA 2LRSA 4GEQB 4B3SE 3F6HA 4DR7E 3F6GA 4TUGA 5IWAE 2LBSB 2LMZA 4BCAA 4OUNA 4JI7E 3OTOE 2LJHA 1SR9A 1WHNA 4BC7A 2FGGA 2V87A 2UXBE 5AASA 4DR1E 4R8OA 4LF8E 4DV0E 3RMPA 1X49A 4LF7E 2L92A 3J7Yp 1HNXE 4JV5E 1X47A 2ZM6E 4DV4E 1J5EE 2B7TA 4JI1E 3DF6A 1U61A 4JI2E 2L33A 4LFCE 4P7DA 1YYKA 2L2KB 4BS9A 3ADLA 1T4OA 5ADZA 3N3WA 2ODRC 3IWCA 3O2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2Z A;  2L2N A;  1N34 E;  2GSL A;  4LF5 E;  1N32 E;  4OOG C;  2UUA E;  4X64 E;  4JI6 E;  1RC7 A;  1XNQ E;  4NXN E;  3P1X A;  1XNR E;  4B3R E;  2HHH E;  1T4L B;  1HR0 E;  4LF4 E;  2RS7 A;  4B3M E;  2UXC E;  1O0W A;  4DUZ E;  2EZ6 A;  1X48 A;  2UUC E;  1RQ0 A;  1IBK E;  1HNZ E;  4OX9 E;  2DB2 A;  4JI0 E;  4DV6 E;  1IBL E;  4DV5 E;  4X65 E;  1GQE A;  1UIL A;  1I94 E;  3RV1 A;  4JI5 E;  2MDR A;  1HNW E;  4DR4 E;  2NA2 A;  2F4V E;  2L2M A;  3VYY A;  4K0K E;  4X62 E;  4YY3 E;  3ADG A;  3VYX A;  1DI2 A;  4KHP E;  2LTS A;  2B3T B;  1I4S A;  3T1H E;  3O2R B;  4DR6 E;  2A11 A;  4WYQ B;  5LMU E;  2LUQ A;  1FKA E;  4NXM E;  4DV3 E;  1YYW A;  1N33 E;  5CFF E;  2RTX A;  1YYO A;  3LLH A;  2QVW A;  1N36 E;  4DV2 E;  1UHZ A;  4LFA E;  3RV0 A;  1RC5 A;  2CPN A;  2UUB E;  2KHX A;  2LTR A;  4DKK A;  2RS6 A;  4DR2 E;  4JI4 E;  2N3G A;  4YHH E;  4AQY E;  1FJG E;  1JFZ A;  2NUE A;  2RSM A;  2UU9 E;  2IHR 1;  5LMN E;  4GKK E;  2VQF E;  1XMQ E;  2NUF A;  1QU6 A;  2UXD E;  3ADJ A;  2LUP B;  4M30 A;  2N3H A;  1XMO E;  4GKJ E;  4DUY E;  1EKZ A;  2JY9 A;  4X8W A;  4LF6 E;  4JYA E;  4LF9 E;  4JI3 E;  1J26 A;  4LFB E;  2EB1 A;  4WFT A;  4DR3 E;  1IBM E;  1ZBT A;  2DMY A;  2YT4 A;  5BR8 E;  3ADI A;  2FFL A;  2E5L E;  2JVA A;  1PKP A;  2DIX A;  4DR5 E;  3T1Y E;  2L3J A;  1WHQ A;  2NUG A;  1T4N A;  1YZ9 A;  2L3C A;  3C4T A;  4X66 E;  2VQE E;  4DV1 E;  4B3T E;  3HTX A;  4JI8 E;  1STU A;  4DV7 E;  3C4B A;  2B7V A;  2LRS A;  4B3S E;  4DR7 E;  2LBS B;  5IWA E;  4OUN A;  4JI7 E;  3OTO E;  2LJH A;  1WHN A;  2UXB E;  4DR1 E;  4LF8 E;  4DV0 E;  1X49 A;  4LF7 E;  3J7Y p;  1HNX E;  4JV5 E;  1X47 A;  2ZM6 E;  4DV4 E;  1J5E E;  2B7T A;  4JI1 E;  1U61 A;  4JI2 E;  2L33 A;  4LFC E;  1YYK A;  2L2K B;  3ADL A;  1T4O A;  3N3W A;  3O2R A; 
#chains in the Genus database with same CATH topology
 4LF5 E;  5KL4 A;  2UUA E;  1XNQ E;  3J81 C;  2V85 A;  4P78 A;  4NXN E;  4B3R E;  1PJQ A;  4WXC A;  2HJJ A;  2EM7 A;  3OML A;  2M7Q A;  3VHT B;  2D9H A;  4DUZ E;  2UUC E;  1RQ0 A;  2EPZ A;  4DV6 E;  2VRD A;  2MDG A;  3RV1 A;  1ZBQ A;  1DQ3 A;  2EPL X;  5FLX C;  1HNW E;  4DR4 E;  2F4V E;  2L2M A;  2LVH A;  3ADG A;  2YTJ A;  1NEI A;  3HPS A;  2EL4 A;  4R2R A;  2EPC A;  1YFH A;  2WBT A;  4F9C B;  2B3T B;  2YRH A;  4DR6 E;  1MEY C;  5T6J A;  4WYQ B;  2CT1 A;  4KZS A;  2KON A;  2N8X A;  3LLH A;  2QVW A;  3BID A;  4R2E A;  1N36 E;  2EOO A;  5A2Q C;  2YTD A;  4R2Q A;  5F3W A;  2VF1 A;  2N3G A;  4YHH E;  3J7A G;  1JFZ A;  5AE2 A;  4R03 A;  2EPP A;  4Q35 B;  2NUF A;  1QU6 A;  5LL6 R;  1QNT A;  4M30 A;  1PJT A;  1F2I G;  2JP9 A;  2EJ4 A;  4F2J C;  4HEI A;  2EQ0 A;  1EKZ A;  2DGC A;  5IT9 C;  2JWO A;  5IXM B;  4JYA E;  2ODR D;  4LF9 E;  2EOZ A;  2EM4 A;  2EN2 A;  4RH8 A;  1ZU1 A;  2MKN A;  4I8O A;  1PDA A;  2FFL A;  5AE1 A;  2JVA A;  2DIX A;  1L4S A;  3T1Y E;  1WHQ A;  4TUI A;  3HTX A;  2YU8 A;  2B9D A;  2L8T A;  3MSW A;  1UN6 B;  2YRK A;  2E72 A;  3THN A;  1TF6 A;  2LMZ A;  4BCA A;  4OUN A;  4JI7 E;  2UXB E;  2WBU A;  1YUI A;  2EOH A;  2M9A A;  3RMP A;  3DF6 A;  2JYA A;  1BB8 A;  4LFC E;  2ENH A;  1T4O A;  2EE8 A;  3N3W A;  2DLK A;  1LLM C;  3IWC A;  3O2R A;  2EOI A;  3JTZ A;  2GSL A;  2EOR A;  2EPO A;  4F54 A;  4X64 E;  2KOU A;  1RC7 A;  4F9A B;  1XNR E;  5LLQ A;  4BBY A;  2HHH E;  1T4L B;  3MHH C;  3IWD A;  4B3M E;  4WXD A;  2RQL A;  2EZ6 A;  2EMY A;  5KL7 A;  4M9V C;  1N3G A;  5A6K A;  2JOB A;  1IBL E;  4X65 E;  4IJD A;  5IV8 B;  1UIL A;  1I94 E;  4JI5 E;  2MDR A;  2A25 A;  1ZAA C;  2Q8U A;  2K7I A;  3AV0 A;  4J8Z A;  4YY3 E;  1T38 A;  2EN1 A;  2YU5 A;  1DI2 A;  2BB8 A;  2LTS A;  2EM0 A;  3T1H E;  2YTN A;  4RHB B;  1G2F C;  5LMU E;  2EN3 A;  4NXM E;  4DV3 E;  2R76 A;  5CFF E;  1YYO A;  4LFA E;  4DV2 E;  3EPL A;  3RV0 A;  2CPN A;  2GLI A;  2UUB E;  2KHX A;  2EMC A;  4BHB A;  2RS6 A;  4DKK A;  1FJG E;  2NUE A;  2UU9 E;  5LMN E;  5KL6 A;  2EMW A;  4HTG A;  3J80 C;  2VQF E;  3EPJ A;  3JU0 A;  2YTO A;  4DMI A;  3LML A;  2YSO A;  4O43 A;  1UBD C;  3ADJ A;  1A1L A;  3ECR A;  2YTE A;  4GKJ E;  2EM3 A;  4X8W A;  3TQM A;  1A1I A;  3KZZ A;  4LF6 E;  4BMJ A;  2EMH A;  3AUZ A;  2H36 X;  4F6N A;  1ZBT A;  2DMY A;  2YT4 A;  2WCC 3;  5BR8 E;  3ADI A;  1PKP A;  1X3C A;  2NUG A;  1T4N A;  3HPZ A;  2VQE E;  1GZ6 A;  3KWR A;  4WX9 A;  4R2C A;  2LRS A;  3F6H A;  2LBS B;  2I13 A;  2LJU A;  2EOF A;  3THO B;  1X5W A;  2LJH A;  3C6M A;  1WHN A;  3L00 A;  2V87 A;  4GZN C;  2EPR A;  4O5G A;  3EPK A;  4R8O A;  2DRP A;  4DV0 E;  4LF8 E;  2DLQ A;  2L92 A;  3J7Y p;  1IMU A;  4JV5 E;  1DGC A;  4JI2 E;  4P7D A;  5AC4 A;  1PJS A;  2EM9 A;  2ODR C;  2RSI A;  4FK5 C;  2EM6 A;  2EQ1 A;  2EMB A;  1N32 E;  4OOG C;  3HXL A;  2ADR A;  2EM8 A;  3P1X A;  2YSP A;  2JPA A;  2LCE A;  2EMG A;  2RS7 A;  1X6F A;  3DJW A;  2UXC E;  2M4I A;  1O0W A;  4MLV A;  1X48 A;  4M0V A;  1IBK E;  1EH8 A;  2WZO A;  5A6A A;  4JI0 E;  2EM5 A;  5A6B D;  3FIG A;  2EPA A;  5KL2 A;  1GTK A;  2NA2 A;  2EL5 A;  4LU9 A;  3VYY A;  4K0K E;  2DSY A;  2ENA A;  2LV2 A;  3VYX A;  4KHP E;  4IS1 C;  3O2R B;  2YWQ A;  1ZTD A;  5DNY A;  1BBG A;  3IWB A;  2EOE A;  2CTD A;  2DMI A;  2BBG A;  2F8B A;  2EOX A;  1G2D C;  3VK6 A;  1N33 E;  2EOS A;  2EMK A;  2EPU A;  2G7H A;  2EOY A;  4MLQ A;  1UHZ A;  4F6M A;  1RC5 A;  1NCS A;  5AC5 A;  2CSH A;  4JI4 E;  2PRT A;  4AQY E;  5KL5 A;  2EP3 A;  2IHR 1;  2EN4 A;  4NZV A;  2EN8 A;  2E1M A;  4GKK E;  3K6Q A;  2JR1 A;  3M99 B;  2YTI A;  3HQ1 A;  2UXD E;  1A1G A;  2YZT A;  2V88 A;  4X9J A;  1XMO E;  2YTG A;  2GPI A;  1P47 A;  4F9B B;  2EM2 A;  4R2S A;  4Q28 A;  3BF2 A;  1AAY A;  4JI3 E;  1J26 A;  4LFB E;  2MC6 A;  2EB1 A;  2MC5 A;  4WFT A;  4DR3 E;  1JK1 A;  1AH5 A;  1WRJ A;  2EN7 A;  2I9I A;  2E5L E;  1RMD A;  4DR5 E;  4LTY A;  4NHR A;  2HC5 A;  1YZ9 A;  4B3T E;  1YPN A;  4X66 E;  4DV1 E;  4DV7 E;  3C4B A;  4DR7 E;  4TUG A;  5IWA E;  4O24 A;  3KZY A;  1MGT A;  5A69 A;  1B69 A;  1SR9 A;  4BC7 A;  1A1K A;  4DR1 E;  1X49 A;  2EOJ A;  1HNX E;  1A1J A;  2ZM6 E;  4DV4 E;  2B7T A;  4R2A A;  4JI1 E;  2JXP A;  2L33 A;  4BS9 A;  3ADL A;  2LT7 A;  2ELY A;  2YTP A;  1YSA C;  5ADZ A;  1BBO A;  2EPK X;  4M2Z A;  2L2N A;  4ZYE A;  2V89 A;  1N34 E;  2EMI A;  3JAM C;  3EQ1 A;  1EH6 A;  2EML A;  4JI6 E;  3QG5 C;  1YUJ A;  2FV4 B;  1HR0 E;  4LF4 E;  2EMX A;  2EMZ A;  3EPH A;  4R2P A;  1HNZ E;  4OX9 E;  2DB2 A;  1IQS A;  5AE3 A;  2K4V A;  2YTQ A;  2VE7 C;  4DV5 E;  2EPM X;  4ZYD A;  4WSG A;  1GQE A;  2GHF A;  4BC9 A;  2YTF A;  4R2D A;  4X62 E;  1SFE A;  5KL3 A;  2YPN A;  1EH7 A;  1A1F A;  1KYQ A;  1ZR9 A;  2LO3 A;  1WXR A;  2EL6 A;  1I4S A;  2V83 A;  1KJK A;  1X6E A;  2A11 A;  2EN6 A;  3UK3 C;  2LUQ A;  1FKA E;  1YYW A;  2V8Q B;  2RTX A;  2EPX A;  2LE2 A;  4ZYG A;  4WSP A;  4O4K A;  2LTR A;  4DR2 E;  2R1F A;  5TSE A;  2RSM A;  2EOQ A;  2M1S A;  1JK2 A;  2WBS A;  2EMA A;  1XMQ E;  2EMF A;  2EQ3 A;  2HGH A;  2EPN A;  2LUP B;  2V86 A;  2N3H A;  4L8N A;  4ZYH A;  3BBG A;  4DUY E;  2JY9 A;  2EOM A;  1T39 A;  2EWL A;  1Z1B A;  3BGH A;  4L5N C;  1X6H A;  3H09 A;  1IBM E;  4KWY A;  1TF3 A;  2RPC A;  5A6B A;  2FTX B;  2YRM A;  3ZOQ B;  2L6M A;  2L3J A;  3C6K A;  2JOX A;  2L3C A;  3C4T A;  4WPY A;  4JI8 E;  1STU A;  2B7V A;  4GEQ B;  4B3S E;  2ELZ A;  3F6G A;  4BHC A;  3OTO E;  2ENC A;  2J7J A;  2NAB A;  2FGG A;  5A6J A;  5AAS A;  4LF7 E;  1X47 A;  1A1H A;  1J5E E;  1IQO A;  2MKD A;  1U61 A;  3MHS C;  1YYK A;  2L2K B;  1WJP A;  1TN9 A;  4N4R B; 
#chains in the Genus database with same CATH homology
 4M2Z A;  2L2N A;  2V89 A;  3JTZ A;  2GSL A;  1N34 E;  4LF5 E;  4OOG C;  1N32 E;  3HXL A;  4F54 A;  3JAM C;  2KOU A;  4X64 E;  1RC7 A;  3J81 C;  2UUA E;  2V85 A;  4P78 A;  4JI6 E;  4F9A B;  4NXN E;  2FV4 B;  3P1X A;  1XNR E;  4B3R E;  4BBY A;  2HHH E;  1T4L B;  1HR0 E;  4LF4 E;  3IWD A;  3OML A;  2RS7 A;  3DJW A;  2M7Q A;  4B3M E;  2UXC E;  2M4I A;  1O0W A;  4DUZ E;  2EZ6 A;  1X48 A;  4M0V A;  1RQ0 A;  1IBK E;  1HNZ E;  2UUC E;  4OX9 E;  2DB2 A;  2WZO A;  5AE3 A;  2K4V A;  4JI0 E;  2VE7 C;  3FIG A;  2JOB A;  4DV6 E;  1IBL E;  4DV5 E;  1XNQ E;  3HTX A;  4X65 E;  1GQE A;  1UIL A;  1I94 E;  3RV1 A;  1ZBQ A;  1DQ3 A;  2MDR A;  4BC9 A;  5FLX C;  4JI5 E;  4DR4 E;  1HNW E;  2NA2 A;  4J8Z A;  3AV0 A;  4LU9 A;  2F4V E;  2L2M A;  3VYY A;  4K0K E;  4X62 E;  2DSY A;  3ADG A;  4YY3 E;  3HPS A;  3VYX A;  1DI2 A;  4KHP E;  2LTS A;  4F9C B;  2B3T B;  1WXR A;  1I4S A;  3T1H E;  3O2R B;  4DR6 E;  2V83 A;  5DNY A;  3IWB A;  5T6J A;  2A11 A;  4WYQ B;  5LMU E;  2F8B A;  2LUQ A;  4KZS A;  1FKA E;  4NXM E;  2KON A;  1YYW A;  2V8Q B;  3VK6 A;  4DV3 E;  1N33 E;  5CFF E;  2RTX A;  1YYO A;  2LE2 A;  2G7H A;  3LLH A;  2QVW A;  4WSP A;  1N36 E;  4DV2 E;  1UHZ A;  4LFA E;  3RV0 A;  1RC5 A;  5A2Q C;  2CPN A;  2UUB E;  2KHX A;  2LTR A;  4DKK A;  2RS6 A;  4DR2 E;  5F3W A;  4JI4 E;  2VF1 A;  2N3G A;  4YHH E;  4AQY E;  1FJG E;  3J7A G;  1JFZ A;  5AE2 A;  2NUE A;  2RSM A;  2UU9 E;  2IHR 1;  5LMN E;  2M1S A;  4R03 A;  3J80 C;  2E1M A;  4DV1 E;  4GKK E;  2VQF E;  3JU0 A;  3K6Q A;  2JR1 A;  4DMI A;  3LML A;  1XMQ E;  2NUF A;  1QU6 A;  5LL6 R;  3HQ1 A;  2UXD E;  3ADJ A;  2LUP B;  4M30 A;  2V86 A;  2YZT A;  2N3H A;  4L8N A;  2V88 A;  1XMO E;  4GKJ E;  4DUY E;  1EKZ A;  2JY9 A;  4X8W A;  4F9B B;  5IT9 C;  2JWO A;  4LF6 E;  4Q28 A;  4JYA E;  4BMJ A;  2EWL A;  2ODR D;  4JI3 E;  3AUZ A;  4LF9 E;  4LFB E;  2H36 X;  4L5N C;  2MC6 A;  2EB1 A;  1J26 A;  2MC5 A;  4WFT A;  4DR3 E;  3H09 A;  1ZBT A;  1IBM E;  2DMY A;  4I8O A;  2YT4 A;  5BR8 E;  3ADI A;  2FFL A;  5AE1 A;  2FTX B;  2E5L E;  2JVA A;  1PKP A;  2DIX A;  4DR5 E;  3T1Y E;  4B3T E;  3ZOQ B;  4LTY A;  2L6M A;  2L3J A;  1WHQ A;  2NUG A;  2JOX A;  1T4N A;  1YZ9 A;  4TUI A;  3C4T A;  3HPZ A;  1GZ6 A;  4X66 E;  2L3C A;  2VQE E;  2B9D A;  2L8T A;  3KWR A;  3MSW A;  4WPY A;  4JI8 E;  1STU A;  4DV7 E;  3C4B A;  2B7V A;  2LRS A;  4GEQ B;  4B3S E;  3F6H A;  4DR7 E;  3F6G A;  4TUG A;  5IWA E;  2LBS B;  2LMZ A;  4BCA A;  4OUN A;  4JI7 E;  3OTO E;  2LJH A;  1SR9 A;  1WHN A;  4BC7 A;  2FGG A;  2V87 A;  2UXB E;  5AAS A;  4DR1 E;  4R8O A;  4LF8 E;  4DV0 E;  3RMP A;  1X49 A;  4LF7 E;  2L92 A;  3J7Y p;  1HNX E;  4JV5 E;  1X47 A;  2ZM6 E;  4DV4 E;  1J5E E;  2B7T A;  4JI1 E;  3DF6 A;  1U61 A;  4JI2 E;  2L33 A;  4LFC E;  4P7D A;  1YYK A;  2L2K B;  4BS9 A;  3ADL A;  1T4O A;  5ADZ A;  3N3W A;  2ODR C;  3IWC A;  3O2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...