2NUEA

Crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.9-angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
220
structure length
220
Chain Sequence
KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A stepwise model for double-stranded RNA processing by ribonuclease III.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
molecule keywords 46-MER
total genus 68
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 2nueA01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2nueA02
4X66E 4LFBE 4GKKE 4B3RE 3J7Yp 1WHNA 4WFTA 2LRSA 4DR5E 2L3JA 1FJGE 1YYOA 3RV0A 1IBME 1N33E 1HR0E 5LMNE 4LF5E 2E5LE 1XMOE 2UXCE 4LFCE 1T4OA 4JI3E 3T1HE 4OUNA 2L2NA 2LUQA 2RTXA 2UXBE 4DR3E 1YYWA 4JI6E 2N3GA 1IBLE 4WYQB 1X49A 4GKJE 3OTOE 1O0WA 2FFLA 3ADGA 1T4LB 3ADLA 1XMQE 4JI7E 1RC7A 4DV5E 2CPNA 4DV0E 4JI1E 4X64E 4JI0E 2QVWA 1ZBTA 3C4BA 1WHQA 3O2RA 2LTSA 2LUPB 2UUBE 2IHR1 4DR2E 2RS6A 1N36E 1XNRE 1HNWE 4LF7E 4JI5E 5CFFE 2A11A 4LF4E 4DV7E 1JFZA 1PKPA 1QU6A 4JI2E 1XNQE 1HNZE 1T4NA 2UUAE 1J26A 1J5EE 3P1XA 1EKZA 1U61A 4DV6E 2NUEA 4YHHE 4M2ZA 2LBSB 4DR4E 2B7TA 5BR8E 4B3SE 5IWAE 2VQFE 3HTXA 2DIXA 1IBKE 1N32E 2N3HA 4DR6E 2NUGA 2L2MA 1I94E 2L3CA 4LFAE 2GSLA 2LJHA 3VYXA 4JI4E 4AQYE 4LF8E 2UXDE 4X62E 2ZM6E 2NUFA 1X48A 2DB2A 2MDRA 4DKKA 1I4SA 2VQEE 1YYKA 4X8WA 1YZ9A 4LF6E 4DV4E 4M30A 5LMUE 4DUYE 4B3ME 4K0KE 3N3WA 4KHPE 2NA2A 1UILA 2KHXA 3VYYA 2LTRA 4DV2E 1RQ0A 4NXNE 1STUA 1GQEA 2RS7A 4LF9E 2EB1A 4DV3E 3T1YE 4DUZE 2RSMA 2B3TB 4NXME 1N34E 4JI8E 2L33A 4DV1E 1HNXE 3LLHA 2JVAA 2L2KB 1RC5A 2HHHE 4OX9E 2F4VE 2DMYA 4DR1E 2UUCE 1DI2A 1UHZA 3RV1A 3C4TA 2EZ6A 2UU9E 4DR7E 2JY9A 3ADIA 2B7VA 4JYAE 4OOGC 2YT4A 4JV5E 1FKAE 1X47A 4X65E 3O2RB 4B3TE 3ADJA 4YY3E
chains in the Genus database with same CATH superfamily
4GKKE 3THOB 4B3RE 2RSIA 2LV2A 2LE2A 2EM9A 4R2DA 1FJGE 1YYOA 1MEYC 2LMZA 2YTNA 4F9CB 1BBGA 2ELZA 1X6EA 4FK5C 3T1HE 4OUNA 2L2NA 5A6BA 2EL6A 5DNYA 4BC9A 2EL4A 4O24A 2EMKA 1AH5A 2N3GA 5KL2A 3OTOE 4WSPA 2EPZA 4JI0E 1AAYA 3JU0A 2FV4B 3F6GA 2D9HA 2IHR1 5FLXC 2A11A 1P47A 5A2QC 1G2DC 4LF4E 2EPCA 1MGTA 1X5WA 2DGCA 1T4NA 4J8ZA 1J26A 2V87A 2HC5A 1X3CA 2EOIA 1U61A 2NUEA 3QG5C 3MHSC 2VQFE 2DMIA 3HTXA 2N3HA 1T39A 2L2MA 4LFAE 1L4SA 2EN3A 2MDRA 3BF2A 1I4SA 4X8WA 1YZ9A 3K6QA 2EMYA 4LF6E 4DV4E 4M30A 2EOOA 2DLQA 2YSPA 4TUIA 2J7JA 3UK3C 2V8QB 2JOBA 1UILA 4F9BB 2EM5A 3EQ1A 5AC5A 2RS7A 1TF3A 3EPKA 2CSHA 2YTQA 2JWOA 2YTEA 4HTGA 2RSMA 4LU9A 2YZTA 4DUZE 4IJDA 4JI8E 1DGCA 4DV1E 1HNXE 2EOYA 2EMGA 1YSAC 2L2KB 5A6BD 2EPKX 5KL5A 1RC5A 2YTOA 2HHHE 2EQ1A 2LCEA 2V88A 2F4VE 2UUCE 1UHZA 1A1JA 4DR7E 2UU9E 3IWBA 5T6JA 3ADIA 4JYAE 2EOJA 1X47A 2EMXA 2EPAA 4YY3E 2BB8A 3H09A 4LFBE 2GPIA 2EM7A 1GZ6A 5AASA 3J7Yp 4RHBB 2ENHA 5AC4A 2JOXA 4BHBA 3DF6A 2K4VA 2L3JA 2L8TA 3RV0A 1RMDA 1IBME 2KONA 1HR0E 5LMNE 1G2FC 2UXCE 2F8BA 1T4OA 2EOZA 2EM6A 2LUQA 2EL5A 4DR3E 4JI6E 2EPLX 2EMIA 3OMLA 2WBSA 3J81C 4F6MA 3TQMA 4DV0E 1A1LA 1ZBTA 3C4BA 2EM8A 2DLKA 2E72A 2EMHA 1ZU1A 2RS6A 3ECRA 1N3GA 4JI5E 4MLQA 2EM4A 4LTYA 1WXRA 1UN6B 1ZTDA 1JFZA 2YRHA 2EJ4A 4F54A 1XNQE 3J7AG 4I8OA 2R76A 1EKZA 4YHHE 2YTDA 2LBSB 4KZSA 2JR1A 4NHRA 4DR6E 1IBKE 4L8NA 1N32E 2FTXB 1EH7A 4LF8E 2EPUA 4R2QA 5KL4A 1KYQA 2A25A 4DKKA 3THNA 2VQEE 2E1MA 2EMCA 1NEIA 4R2EA 5LMUE 4KWYA 4R2SA 2MC5A 2CTDA 5A6KA 3VYYA 4Q28A 2LTRA 5ADZA 1EH8A 5KL6A 4LF9E 2EB1A 2HGHA 2WCC3 3HQ1A 1WJPA 2EMLA 1ZAAC 4F9AB 3ZOQB 3LLHA 2JVAA 2VRDA 4BBYA 2EORA 4P7DA 3C6KA 2V83A 1LLMC 1QNTA 2DMYA 2EOHA 2EZ6A 2Q8UA 2B7VA 1T38A 4OOGC 2EOFA 4R03A 3KWRA 2PRTA 4X66E 3VK6A 2DRPA 4ZYHA 2LRSA 3FIGA 2GLIA 4ZYDA 1F2IG 5IV8B 2EOMA 1N33E 4LF5E 3EPLA 4NZVA 1KJKA 2LVHA 2FGGA 2E5LE 2EE8A 2WBTA 4JI3E 2YU8A 2EOQA 3RMPA 2EN6A 4L5NC 2RQLA 1YYWA 2H36X 5F3WA 2EN7A 4GKJE 1X49A 4M0VA 4WYQB 5AE1A 2YPNA 4R2AA 1WRJA 2YTGA 4P78A 3HPZA 3ADLA 4JI1E 1RC7A 4X64E 2ADRA 2QVWA 4N4RB 2V89A 2EN1A 1WHQA 3O2RA 2LTSA 2EMAA 2YSOA 1ZBQA 2LUPB 1PJTA 2K7IA 2EP3A 3BGHA 4DR2E 1N36E 1SFEA 1HNWE 4LF7E 5CFFE 1IMUA 1YPNA 4R2CA 1X6HA 1PKPA 1QU6A 4JI2E 1IQOA 1HNZE 2EMZA 2UUAE 4X9JA 4WX9A 3VHTB 1J5EE 1A1FA 3L00A 5IXMB 4DV6E 3KZZA 4M2ZA 2EOEA 3J80C 4M9VC 2YTPA 2B7TA 4R2RA 5LL6R 4BCAA 5IWAE 5TSEA 5KL3A 2DIXA 2YTJA 2EPOA 3VYXA 2GSLA 2LJHA 5IT9C 4JI4E 4AQYE 4GEQB 2MDGA 4X62E 2ZM6E 2NUFA 1EH6A 1X48A 2DB2A 2MKNA 2EOXA 2L6MA 2VF1A 3JAMC 1YYKA 4BHCA 2CT1A 4DUYE 4B3ME 3C6MA 4K0KE 4WXCA 4KHPE 2GHFA 2NA2A 2L92A 2KHXA 1PDAA 2EM3A 1RQ0A 3BBGA 4NXNE 4RH8A 1STUA 4R8OA 1GQEA 2YRMA 1DQ3A 2EMFA 2EN8A 4GZNC 2WZOA 1JK2A 2B3TB 4NXME 1N34E 4O5GA 2EN4A 4OX9E 4F6NA 2VE7C 1Z1BA 4DR1E 1DI2A 3HPSA 2JPAA 2V85A 3RV1A 2G7HA 4JV5E 4WSGA 4X65E 2EMWA 3BIDA 1A1KA 3AV0A 3ADJA 2ODRC 2HJJA 3IWDA 3AUZA 3MHHC 1WHNA 4WFTA 4R2PA 4DR5E 1B69A 2MKDA 3MSWA 1SR9A 1XMOE 2R1FA 4LFCE 2BBGA 2M9AA 4IS1C 5AE3A 1BBOA 2EOSA 2RTXA 2UXBE 3KZYA 4Q35B 1GTKA 1YUJA 2M4IA 3F6HA 2M7QA 2EN2A 1IBLE 3JTZA 2ODRD 1YFHA 1O0WA 2FFLA 4BMJA 2LT7A 3ADGA 1T4LB 2EQ0A 1XMQE 4JI7E 2V86A 4DV5E 2CPNA 2MC6A 1X6FA 4TUGA 3M99B 4ZYEA 2EWLA 5A6JA 1A1GA 2UUBE 4F2JC 1XNRE 3LMLA 2N8XA 4DV7E 2KOUA 4BS9A 1BB8A 1A1IA 5AE2A 2ENAA 4BC7A 3P1XA 2EPXA 4HEIA 2EM2A 2YU5A 2NABA 2ENCA 2EQ3A 2B9DA 3DJWA 4DR4E 5BR8E 4B3SE 2EM0A 2DSYA 2NUGA 1ZR9A 1PJQA 1I94E 2L3CA 1PJSA 4MLVA 2UXDE 2LO3A 4WXDA 3EPHA 2YTFA 1A1HA 3IWCA 5A6AA 5KL7A 1JK1A 4O4KA 2I13A 2YRKA 3N3WA 2JYAA 2YWQA 3EPJA 2I9IA 5LLQA 2JP9A 4O43A 2YTIA 4DMIA 4DV2E 1IQSA 2M1SA 1UBDC 4DV3E 2EMBA 3T1YE 2EPRA 2ELYA 5A69A 2L33A 2WBUA 1TN9A 2JXPA 1YUIA 1TF6A 2EPMX 3C4TA 2LJUA 2JY9A 2RPCA 4ZYGA 2EPNA 2YT4A 1FKAE 4WPYA 3HXLA 1NCSA 3O2RB 2EPPA 4B3TE
chains in the Genus database with same CATH topology
4X66E 3H09A 4DR6E 4LFBE 4GKKE 2ODRC 3VK6A 1GZ6A 3IWDA 4B3RE 3AUZA 5AASA 3J7Yp 1WHNA 4WFTA 2LE2A 2LRSA 4DR5E 3FIGA 2JOXA 3DF6A 2K4VA 2L3JA 2L8TA 1FJGE 1YYOA 3MSWA 3RV0A 1SR9A 1IBME 1N33E 2LMZA 2KONA 1HR0E 5LMNE 4LF5E 2E5LE 2FGGA 1XMOE 4F9CB 2UXCE 2F8BA 4LFCE 1T4OA 4JI3E 3RMPA 5AE3A 3T1HE 4OUNA 2L2NA 2LUQA 4L5NC 2RTXA 2UXBE 4DR3E 1YYWA 4JI6E 5DNYA 4BC9A 2H36X 2M4IA 3F6HA 2M7QA 5F3WA 3OMLA 2N3GA 3JTZA 1X49A 2ODRD 4M0VA 4WYQB 5AE1A 1IBLE 3J81C 3OTOE 1O0WA 2FFLA 4BMJA 3ADGA 4WSPA 1T4LB 4P78A 3HPZA 1XMQE 3ADLA 4JI7E 1RC7A 2V86A 2CPNA 4DV0E 4DV5E 4X64E 2MC6A 2QVWA 4TUGA 4JI0E 2V89A 3JU0A 1ZBTA 3C4BA 1WHQA 2EWLA 2FV4B 3F6GA 3O2RA 2LTSA 2LUPB 2UUBE 1ZBQA 2IHR1 3LMLA 2RS6A 5FLXC 4DR2E 1N36E 1XNRE 1HNWE 4LF7E 4JI5E 5CFFE 2A11A 4LF4E 5A2QC 4DV7E 4LTYA 2KOUA 4JI1E 4BS9A 1WXRA 1JFZA 1PKPA 1QU6A 4F54A 4JI2E 1XNQE 1HNZE 1T4NA 4J8ZA 2UUAE 3J7AG 5AE2A 2V87A 1J26A 4I8OA 1J5EE 4BC7A 3P1XA 1EKZA 1U61A 4DV6E 2NUEA 4YHHE 4M2ZA 3J80C 2LBSB 4KZSA 2B9DA 2JR1A 3DJWA 4DR4E 2B7TA 5BR8E 4B3SE 5LL6R 4BCAA 5IWAE 2VQFE 3HTXA 2DIXA 2DSYA 4L8NA 2N3HA 1IBKE 2FTXB 1N32E 2NUGA 2L2MA 1I94E 2L3CA 4LFAE 2GSLA 2LJHA 3VYXA 5IT9C 4JI4E 4AQYE 4GEQB 4LF8E 2UXDE 4X62E 2ZM6E 2NUFA 4GKJE 1X48A 2DB2A 2MDRA 3IWCA 4DKKA 1I4SA 2L6MA 2VF1A 1YYKA 4X8WA 3JAMC 1YZ9A 2E1MA 3K6QA 2VQEE 4LF6E 4DV4E 4M30A 5LMUE 4DUYE 4B3ME 4K0KE 4TUIA 3N3WA 2MC5A 2V8QB 2JOBA 4KHPE 2NA2A 2L92A 1UILA 2KHXA 4F9BB 3VYYA 4Q28A 2LTRA 5ADZA 4DMIA 4DV2E 1RQ0A 4NXNE 1STUA 4R8OA 2M1SA 1GQEA 2RS7A 4LF9E 1DQ3A 2EB1A 4DV3E 3T1YE 2JWOA 3HQ1A 2WZOA 2RSMA 4LU9A 2B3TB 2YZTA 4DUZE 4NXME 1N34E 4JI8E 2L33A 4DV1E 4F9AB 3ZOQB 1HNXE 3LLHA 2JVAA 2L2KB 4BBYA 4P7DA 1RC5A 2HHHE 4OX9E 2V83A 2V88A 2F4VE 2VE7C 2DMYA 4DR1E 2UUCE 1DI2A 3HPSA 1UHZA 2V85A 3RV1A 3C4TA 2EZ6A 2UU9E 4DR7E 2G7HA 2JY9A 3IWBA 2B7VA 5T6JA 3ADIA 4JYAE 4OOGC 2YT4A 4JV5E 1FKAE 1X47A 4WPYA 4R03A 4X65E 3HXLA 3KWRA 3O2RB 3AV0A 4B3TE 3ADJA 4YY3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 E;  4LFB E;  4GKK E;  4B3R E;  3J7Y p;  1WHN A;  4WFT A;  2LRS A;  4DR5 E;  2L3J A;  1FJG E;  1YYO A;  3RV0 A;  1IBM E;  1N33 E;  1HR0 E;  5LMN E;  4LF5 E;  2E5L E;  1XMO E;  2UXC E;  4LFC E;  1T4O A;  4JI3 E;  3T1H E;  4OUN A;  2L2N A;  2LUQ A;  2RTX A;  2UXB E;  4DR3 E;  1YYW A;  4JI6 E;  2N3G A;  1IBL E;  4WYQ B;  1X49 A;  4GKJ E;  3OTO E;  1O0W A;  2FFL A;  3ADG A;  1T4L B;  3ADL A;  1XMQ E;  4JI7 E;  1RC7 A;  4DV5 E;  2CPN A;  4DV0 E;  4JI1 E;  4X64 E;  4JI0 E;  2QVW A;  1ZBT A;  3C4B A;  1WHQ A;  3O2R A;  2LTS A;  2LUP B;  2UUB E;  2IHR 1;  4DR2 E;  2RS6 A;  1N36 E;  1XNR E;  1HNW E;  4LF7 E;  4JI5 E;  5CFF E;  2A11 A;  4LF4 E;  4DV7 E;  1JFZ A;  1PKP A;  1QU6 A;  4JI2 E;  1XNQ E;  1HNZ E;  1T4N A;  2UUA E;  1J26 A;  1J5E E;  3P1X A;  1EKZ A;  1U61 A;  4DV6 E;  2NUE A;  4YHH E;  4M2Z A;  2LBS B;  4DR4 E;  2B7T A;  5BR8 E;  4B3S E;  5IWA E;  2VQF E;  3HTX A;  2DIX A;  1IBK E;  1N32 E;  2N3H A;  4DR6 E;  2NUG A;  2L2M A;  1I94 E;  2L3C A;  4LFA E;  2GSL A;  2LJH A;  3VYX A;  4JI4 E;  4AQY E;  4LF8 E;  2UXD E;  4X62 E;  2ZM6 E;  2NUF A;  1X48 A;  2DB2 A;  2MDR A;  4DKK A;  1I4S A;  2VQE E;  1YYK A;  4X8W A;  1YZ9 A;  4LF6 E;  4DV4 E;  4M30 A;  5LMU E;  4DUY E;  4B3M E;  4K0K E;  3N3W A;  4KHP E;  2NA2 A;  1UIL A;  2KHX A;  3VYY A;  2LTR A;  4DV2 E;  1RQ0 A;  4NXN E;  1STU A;  1GQE A;  2RS7 A;  4LF9 E;  2EB1 A;  4DV3 E;  3T1Y E;  4DUZ E;  2RSM A;  2B3T B;  4NXM E;  1N34 E;  4JI8 E;  2L33 A;  4DV1 E;  1HNX E;  3LLH A;  2JVA A;  2L2K B;  1RC5 A;  2HHH E;  4OX9 E;  2F4V E;  2DMY A;  4DR1 E;  2UUC E;  1DI2 A;  1UHZ A;  3RV1 A;  3C4T A;  2EZ6 A;  2UU9 E;  4DR7 E;  2JY9 A;  3ADI A;  2B7V A;  4JYA E;  4OOG C;  2YT4 A;  4JV5 E;  1FKA E;  1X47 A;  4X65 E;  3O2R B;  4B3T E;  3ADJ A;  4YY3 E; 
#chains in the Genus database with same CATH topology
 4GKK E;  3THO B;  4B3R E;  2RSI A;  2LV2 A;  2LE2 A;  2EM9 A;  4R2D A;  1FJG E;  1YYO A;  1MEY C;  2LMZ A;  2YTN A;  4F9C B;  1BBG A;  2ELZ A;  1X6E A;  4FK5 C;  3T1H E;  4OUN A;  2L2N A;  5A6B A;  2EL6 A;  5DNY A;  4BC9 A;  2EL4 A;  4O24 A;  2EMK A;  1AH5 A;  2N3G A;  5KL2 A;  3OTO E;  4WSP A;  2EPZ A;  4JI0 E;  1AAY A;  3JU0 A;  2FV4 B;  3F6G A;  2D9H A;  2IHR 1;  5FLX C;  2A11 A;  1P47 A;  5A2Q C;  1G2D C;  4LF4 E;  2EPC A;  1MGT A;  1X5W A;  2DGC A;  1T4N A;  4J8Z A;  1J26 A;  2V87 A;  2HC5 A;  1X3C A;  2EOI A;  1U61 A;  2NUE A;  3QG5 C;  3MHS C;  2VQF E;  2DMI A;  3HTX A;  2N3H A;  1T39 A;  2L2M A;  4LFA E;  1L4S A;  2EN3 A;  2MDR A;  3BF2 A;  1I4S A;  4X8W A;  1YZ9 A;  3K6Q A;  2EMY A;  4LF6 E;  4DV4 E;  4M30 A;  2EOO A;  2DLQ A;  2YSP A;  4TUI A;  2J7J A;  3UK3 C;  2V8Q B;  2JOB A;  1UIL A;  4F9B B;  2EM5 A;  3EQ1 A;  5AC5 A;  2RS7 A;  1TF3 A;  3EPK A;  2CSH A;  2YTQ A;  2JWO A;  2YTE A;  4HTG A;  2RSM A;  4LU9 A;  2YZT A;  4DUZ E;  4IJD A;  4JI8 E;  1DGC A;  4DV1 E;  1HNX E;  2EOY A;  2EMG A;  1YSA C;  2L2K B;  5A6B D;  2EPK X;  5KL5 A;  1RC5 A;  2YTO A;  2HHH E;  2EQ1 A;  2LCE A;  2V88 A;  2F4V E;  2UUC E;  1UHZ A;  1A1J A;  4DR7 E;  2UU9 E;  3IWB A;  5T6J A;  3ADI A;  4JYA E;  2EOJ A;  1X47 A;  2EMX A;  2EPA A;  4YY3 E;  2BB8 A;  3H09 A;  4LFB E;  2GPI A;  2EM7 A;  1GZ6 A;  5AAS A;  3J7Y p;  4RHB B;  2ENH A;  5AC4 A;  2JOX A;  4BHB A;  3DF6 A;  2K4V A;  2L3J A;  2L8T A;  3RV0 A;  1RMD A;  1IBM E;  2KON A;  1HR0 E;  5LMN E;  1G2F C;  2UXC E;  2F8B A;  1T4O A;  2EOZ A;  2EM6 A;  2LUQ A;  2EL5 A;  4DR3 E;  4JI6 E;  2EPL X;  2EMI A;  3OML A;  2WBS A;  3J81 C;  4F6M A;  3TQM A;  4DV0 E;  1A1L A;  1ZBT A;  3C4B A;  2EM8 A;  2DLK A;  2E72 A;  2EMH A;  1ZU1 A;  2RS6 A;  3ECR A;  1N3G A;  4JI5 E;  4MLQ A;  2EM4 A;  4LTY A;  1WXR A;  1UN6 B;  1ZTD A;  1JFZ A;  2YRH A;  2EJ4 A;  4F54 A;  1XNQ E;  3J7A G;  4I8O A;  2R76 A;  1EKZ A;  4YHH E;  2YTD A;  2LBS B;  4KZS A;  2JR1 A;  4NHR A;  4DR6 E;  1IBK E;  4L8N A;  1N32 E;  2FTX B;  1EH7 A;  4LF8 E;  2EPU A;  4R2Q A;  5KL4 A;  1KYQ A;  2A25 A;  4DKK A;  3THN A;  2VQE E;  2E1M A;  2EMC A;  1NEI A;  4R2E A;  5LMU E;  4KWY A;  4R2S A;  2MC5 A;  2CTD A;  5A6K A;  3VYY A;  4Q28 A;  2LTR A;  5ADZ A;  1EH8 A;  5KL6 A;  4LF9 E;  2EB1 A;  2HGH A;  2WCC 3;  3HQ1 A;  1WJP A;  2EML A;  1ZAA C;  4F9A B;  3ZOQ B;  3LLH A;  2JVA A;  2VRD A;  4BBY A;  2EOR A;  4P7D A;  3C6K A;  2V83 A;  1LLM C;  1QNT A;  2DMY A;  2EOH A;  2EZ6 A;  2Q8U A;  2B7V A;  1T38 A;  4OOG C;  2EOF A;  4R03 A;  3KWR A;  2PRT A;  4X66 E;  3VK6 A;  2DRP A;  4ZYH A;  2LRS A;  3FIG A;  2GLI A;  4ZYD A;  1F2I G;  5IV8 B;  2EOM A;  1N33 E;  4LF5 E;  3EPL A;  4NZV A;  1KJK A;  2LVH A;  2FGG A;  2E5L E;  2EE8 A;  2WBT A;  4JI3 E;  2YU8 A;  2EOQ A;  3RMP A;  2EN6 A;  4L5N C;  2RQL A;  1YYW A;  2H36 X;  5F3W A;  2EN7 A;  4GKJ E;  1X49 A;  4M0V A;  4WYQ B;  5AE1 A;  2YPN A;  4R2A A;  1WRJ A;  2YTG A;  4P78 A;  3HPZ A;  3ADL A;  4JI1 E;  1RC7 A;  4X64 E;  2ADR A;  2QVW A;  4N4R B;  2V89 A;  2EN1 A;  1WHQ A;  3O2R A;  2LTS A;  2EMA A;  2YSO A;  1ZBQ A;  2LUP B;  1PJT A;  2K7I A;  2EP3 A;  3BGH A;  4DR2 E;  1N36 E;  1SFE A;  1HNW E;  4LF7 E;  5CFF E;  1IMU A;  1YPN A;  4R2C A;  1X6H A;  1PKP A;  1QU6 A;  4JI2 E;  1IQO A;  1HNZ E;  2EMZ A;  2UUA E;  4X9J A;  4WX9 A;  3VHT B;  1J5E E;  1A1F A;  3L00 A;  5IXM B;  4DV6 E;  3KZZ A;  4M2Z A;  2EOE A;  3J80 C;  4M9V C;  2YTP A;  2B7T A;  4R2R A;  5LL6 R;  4BCA A;  5IWA E;  5TSE A;  5KL3 A;  2DIX A;  2YTJ A;  2EPO A;  3VYX A;  2GSL A;  2LJH A;  5IT9 C;  4JI4 E;  4AQY E;  4GEQ B;  2MDG A;  4X62 E;  2ZM6 E;  2NUF A;  1EH6 A;  1X48 A;  2DB2 A;  2MKN A;  2EOX A;  2L6M A;  2VF1 A;  3JAM C;  1YYK A;  4BHC A;  2CT1 A;  4DUY E;  4B3M E;  3C6M A;  4K0K E;  4WXC A;  4KHP E;  2GHF A;  2NA2 A;  2L92 A;  2KHX A;  1PDA A;  2EM3 A;  1RQ0 A;  3BBG A;  4NXN E;  4RH8 A;  1STU A;  4R8O A;  1GQE A;  2YRM A;  1DQ3 A;  2EMF A;  2EN8 A;  4GZN C;  2WZO A;  1JK2 A;  2B3T B;  4NXM E;  1N34 E;  4O5G A;  2EN4 A;  4OX9 E;  4F6N A;  2VE7 C;  1Z1B A;  4DR1 E;  1DI2 A;  3HPS A;  2JPA A;  2V85 A;  3RV1 A;  2G7H A;  4JV5 E;  4WSG A;  4X65 E;  2EMW A;  3BID A;  1A1K A;  3AV0 A;  3ADJ A;  2ODR C;  2HJJ A;  3IWD A;  3AUZ A;  3MHH C;  1WHN A;  4WFT A;  4R2P A;  4DR5 E;  1B69 A;  2MKD A;  3MSW A;  1SR9 A;  1XMO E;  2R1F A;  4LFC E;  2BBG A;  2M9A A;  4IS1 C;  5AE3 A;  1BBO A;  2EOS A;  2RTX A;  2UXB E;  3KZY A;  4Q35 B;  1GTK A;  1YUJ A;  2M4I A;  3F6H A;  2M7Q A;  2EN2 A;  1IBL E;  3JTZ A;  2ODR D;  1YFH A;  1O0W A;  2FFL A;  4BMJ A;  2LT7 A;  3ADG A;  1T4L B;  2EQ0 A;  1XMQ E;  4JI7 E;  2V86 A;  4DV5 E;  2CPN A;  2MC6 A;  1X6F A;  4TUG A;  3M99 B;  4ZYE A;  2EWL A;  5A6J A;  1A1G A;  2UUB E;  4F2J C;  1XNR E;  3LML A;  2N8X A;  4DV7 E;  2KOU A;  4BS9 A;  1BB8 A;  1A1I A;  5AE2 A;  2ENA A;  4BC7 A;  3P1X A;  2EPX A;  4HEI A;  2EM2 A;  2YU5 A;  2NAB A;  2ENC A;  2EQ3 A;  2B9D A;  3DJW A;  4DR4 E;  5BR8 E;  4B3S E;  2EM0 A;  2DSY A;  2NUG A;  1ZR9 A;  1PJQ A;  1I94 E;  2L3C A;  1PJS A;  4MLV A;  2UXD E;  2LO3 A;  4WXD A;  3EPH A;  2YTF A;  1A1H A;  3IWC A;  5A6A A;  5KL7 A;  1JK1 A;  4O4K A;  2I13 A;  2YRK A;  3N3W A;  2JYA A;  2YWQ A;  3EPJ A;  2I9I A;  5LLQ A;  2JP9 A;  4O43 A;  2YTI A;  4DMI A;  4DV2 E;  1IQS A;  2M1S A;  1UBD C;  4DV3 E;  2EMB A;  3T1Y E;  2EPR A;  2ELY A;  5A69 A;  2L33 A;  2WBU A;  1TN9 A;  2JXP A;  1YUI A;  1TF6 A;  2EPM X;  3C4T A;  2LJU A;  2JY9 A;  2RPC A;  4ZYG A;  2EPN A;  2YT4 A;  1FKA E;  4WPY A;  3HXL A;  1NCS A;  3O2R B;  2EPP A;  4B3T E; 
#chains in the Genus database with same CATH homology
 4X66 E;  3H09 A;  4DR6 E;  4LFB E;  4GKK E;  2ODR C;  3VK6 A;  1GZ6 A;  3IWD A;  4B3R E;  3AUZ A;  5AAS A;  3J7Y p;  1WHN A;  4WFT A;  2LE2 A;  2LRS A;  4DR5 E;  3FIG A;  2JOX A;  3DF6 A;  2K4V A;  2L3J A;  2L8T A;  1FJG E;  1YYO A;  3MSW A;  3RV0 A;  1SR9 A;  1IBM E;  1N33 E;  2LMZ A;  2KON A;  1HR0 E;  5LMN E;  4LF5 E;  2E5L E;  2FGG A;  1XMO E;  4F9C B;  2UXC E;  2F8B A;  4LFC E;  1T4O A;  4JI3 E;  3RMP A;  5AE3 A;  3T1H E;  4OUN A;  2L2N A;  2LUQ A;  4L5N C;  2RTX A;  2UXB E;  4DR3 E;  1YYW A;  4JI6 E;  5DNY A;  4BC9 A;  2H36 X;  2M4I A;  3F6H A;  2M7Q A;  5F3W A;  3OML A;  2N3G A;  3JTZ A;  1X49 A;  2ODR D;  4M0V A;  4WYQ B;  5AE1 A;  1IBL E;  3J81 C;  3OTO E;  1O0W A;  2FFL A;  4BMJ A;  3ADG A;  4WSP A;  1T4L B;  4P78 A;  3HPZ A;  1XMQ E;  3ADL A;  4JI7 E;  1RC7 A;  2V86 A;  2CPN A;  4DV0 E;  4DV5 E;  4X64 E;  2MC6 A;  2QVW A;  4TUG A;  4JI0 E;  2V89 A;  3JU0 A;  1ZBT A;  3C4B A;  1WHQ A;  2EWL A;  2FV4 B;  3F6G A;  3O2R A;  2LTS A;  2LUP B;  2UUB E;  1ZBQ A;  2IHR 1;  3LML A;  2RS6 A;  5FLX C;  4DR2 E;  1N36 E;  1XNR E;  1HNW E;  4LF7 E;  4JI5 E;  5CFF E;  2A11 A;  4LF4 E;  5A2Q C;  4DV7 E;  4LTY A;  2KOU A;  4JI1 E;  4BS9 A;  1WXR A;  1JFZ A;  1PKP A;  1QU6 A;  4F54 A;  4JI2 E;  1XNQ E;  1HNZ E;  1T4N A;  4J8Z A;  2UUA E;  3J7A G;  5AE2 A;  2V87 A;  1J26 A;  4I8O A;  1J5E E;  4BC7 A;  3P1X A;  1EKZ A;  1U61 A;  4DV6 E;  2NUE A;  4YHH E;  4M2Z A;  3J80 C;  2LBS B;  4KZS A;  2B9D A;  2JR1 A;  3DJW A;  4DR4 E;  2B7T A;  5BR8 E;  4B3S E;  5LL6 R;  4BCA A;  5IWA E;  2VQF E;  3HTX A;  2DIX A;  2DSY A;  4L8N A;  2N3H A;  1IBK E;  2FTX B;  1N32 E;  2NUG A;  2L2M A;  1I94 E;  2L3C A;  4LFA E;  2GSL A;  2LJH A;  3VYX A;  5IT9 C;  4JI4 E;  4AQY E;  4GEQ B;  4LF8 E;  2UXD E;  4X62 E;  2ZM6 E;  2NUF A;  4GKJ E;  1X48 A;  2DB2 A;  2MDR A;  3IWC A;  4DKK A;  1I4S A;  2L6M A;  2VF1 A;  1YYK A;  4X8W A;  3JAM C;  1YZ9 A;  2E1M A;  3K6Q A;  2VQE E;  4LF6 E;  4DV4 E;  4M30 A;  5LMU E;  4DUY E;  4B3M E;  4K0K E;  4TUI A;  3N3W A;  2MC5 A;  2V8Q B;  2JOB A;  4KHP E;  2NA2 A;  2L92 A;  1UIL A;  2KHX A;  4F9B B;  3VYY A;  4Q28 A;  2LTR A;  5ADZ A;  4DMI A;  4DV2 E;  1RQ0 A;  4NXN E;  1STU A;  4R8O A;  2M1S A;  1GQE A;  2RS7 A;  4LF9 E;  1DQ3 A;  2EB1 A;  4DV3 E;  3T1Y E;  2JWO A;  3HQ1 A;  2WZO A;  2RSM A;  4LU9 A;  2B3T B;  2YZT A;  4DUZ E;  4NXM E;  1N34 E;  4JI8 E;  2L33 A;  4DV1 E;  4F9A B;  3ZOQ B;  1HNX E;  3LLH A;  2JVA A;  2L2K B;  4BBY A;  4P7D A;  1RC5 A;  2HHH E;  4OX9 E;  2V83 A;  2V88 A;  2F4V E;  2VE7 C;  2DMY A;  4DR1 E;  2UUC E;  1DI2 A;  3HPS A;  1UHZ A;  2V85 A;  3RV1 A;  3C4T A;  2EZ6 A;  2UU9 E;  4DR7 E;  2G7H A;  2JY9 A;  3IWB A;  2B7V A;  5T6J A;  3ADI A;  4JYA E;  4OOG C;  2YT4 A;  4JV5 E;  1FKA E;  1X47 A;  4WPY A;  4R03 A;  4X65 E;  3HXL A;  3KWR A;  3O2R B;  3AV0 A;  4B3T E;  3ADJ A;  4YY3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...