2NUHA

Crystal structure of cuta from the phytopathgen bacterium xylella fastidiosa
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
104
structure length
104
Chain Sequence
SDVYLIFSTCPDLPSAEIISRVLVQERLAACVTQLPGAVSTYRWQGKIETTQEIQLLIKTNAVHVNAAITRLCALHPYRLPEAIAVQVSVGLPEYLTWINTEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic divalent cation tolerance protein
publication title Crystal structure of CutA from the phytopathgen bacterium Xylella fastidiosa
rcsb
source organism Xylella fastidiosa
molecule tags Unknown function
total genus 30
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nuhA00
3TA1A 1UL3A 4YB7A 1PILA 4C3MA 1NAQA 5D4LA 3L7PA 2PIIA 5D4NA 1KR4A 1NH8A 2XULA 3N5BA 4RLEA 4OZNA 1HWUA 3BZQA 4ZK7M 1V3SA 1VHFA 3TA0A 4CNYA 4CO3A 2O67A 4OZJA 1V9OA 1P1LA 5D4OA 2ZOMA 1H3DA 4Y6IA 1J2VA 3HLUA 3MHYA 4CNZA 2XG8A 1NH7A 4R25A 5DS7A 4OZLA 2NS1B 3M05A 1UMJA 4USIA 2EG2A 3AH6A 2RD5C 3O5TB 4CO0A 3AA9A 3X3UA 4D3HA 4CO2A 2NUHA 2GX8A 2NUUG 2GNKA 4E98A 4NYOA 5DRKA 2DCLA 3DFEA 4CO1A 4D3GA 2JJ4D 2J9CA 4WK3A 4YB6A 1V6HA 2V5HG 1OSCA 2ZFHA 2Z0GA 3NCQA 3T9ZA 1Q1KA 3LF0A 3O8WA 4WK1A 3NCPA 4YB5A 1UFLA 5L9NA 1VFJA 4CO4A 2J9EA 2XZWA 1O51A 2E66A 3GSDA 2EG1A 1UKUA 3AA8A 3NCRA 1O5JA 4IYQA 2GW8A 2O66A 4USJC 3TA2A 2J9DA 4CO5A 3CE8A 4AFFA 2J9DE 2VD3A 4RX6A 3AHPA 4C3LA 4C3KA 1NZAA 4Y65A 4USHA 1GNKA 4RWXA 5D4PA 4RWWA 2CZ4A 2XBPA 1XK8A 1QY7A 4NYPA 1V3RA 3OPKA
chains in the Genus database with same CATH superfamily
4ZVTB 3FVYA 4ZVPB 1RT5A 2HMIA 3H59A 2GO8A 4IDKA 2HEKA 3GYNA 2XSJA 2HRYA 2LQ8A 2QA1A 4UQTA 3NNAA 4IQXA 1WEXA 3KLIB 4I64A 3FBCA 1DZ5A 3IG1A 2FLLA 1WG4A 4NI2A 2Z56B 2IDEA 3ZNUA 5CA5A 3VAMA 4RW8B 2EBGA 5E3PA 3BF4A 1BQNA 3O5TB 2R2TA 1IWGA 3GMGA 1HBUB 2Q1LA 3PYFA 1HPZA 5KFUA 4RW4A 5CYQA 4HTJA 2PC6A 4LVNP 1RBLA 2OAUA 3RBDA 2K7JA 4DR2F 4DPUA 2FJVA 2ADCA 2DNOA 1EKRA 1NPKA 3G8SA 4UZCA 3GR0A 3MD3A 2JRSA 3W2VB 2DGOA 1GMVA 1N34F 3VAIA 2V2VA 4DFPA 2AYGA 4URSA 4M5MA 1VBYA 2CQ1A 1HNWF 2C22A 5HO4A 1QTNB 2GFFA 1Y5LB 2JNJA 4DWIA 3WX4A 4ZP8A 3FUYA 4USKA 2KN4A 4AT1B 1F1BB 3EJMA 1L3UA 1PJ7A 2DTJA 1YRUA 1T95A 3IBCB 3GIKA 3SCIE 3H98A 2RQ4A 3AQPA 3VR1A 4JI3F 3FBFA 2VL1A 3UDEA 1JLBB 4LFCJ 5KFQA 4CRJA 4KBIA 1K0TA 2KXNB 3CC2S 1NPRA 1UFKA 4CTAA 4NYOA 1U02A 4GKKJ 3DLKA 3MM5B 1RISA 3GCWP 2ZZMA 3PJ9A 3MUMP 3BBCA 2DCUB 1FRHA 1T05B 2BJ3A 5DZ6A 4A8MP 4RW9B 4RUHA 3I0SA 3UQSA 2MLZA 4ECVA 2XB2D 1YIJS 3V4MA 4F02A 5C5JA 1Y5IB 4DG1A 5ITHA 1G3OA 3NMRA 3UVJA 2RMLA 1PBUA 1B4SA 2DPIA 1UW4A 4DLGA 1FDAA 4GC7A 5G4DA 1WJ9A 1VCTA 1LFPA 5JXSA 1J5OB 5GMDA 5HJYA 3IRXB 1LXJA 3IBWA 1ZH5A 2V94A 4R0JA 1X8DA 2PEBA 2QA2A 3IWNC 1CEZA 4IO1A 1FEHA 5C7PA 2BOAA 4R5PA 4Y2CA 1N56A 5C42B 1B3TA 2DXFA 4KHPF 4P75A 3OFHA 4CNZA 2ZH4A 1JKHB 5LXRA 1REGX 4IOBA 3L09A 2HHHF 2H1YA 3O44A 5D0GA 4NLQA 4ANEA 5KT7A 2BW7A 1OQ6A 4HYKA 2G4BA 2YY3A 1FJGJ 5CD4H 2W9BB 2EK1A 2RT3A 5A8WA 2IC3A 3QT7A 2GV1A 2H5IB 4FDFA 1N8RT 4JV0A 2HFSA 2XZWA 3JTOA 2XMJA 3D6MB 3F41A 3WC2A 3K8VA 4F3OA 4LFBJ 4WZMA 2L9DA 2WCXA 4PXEA 1SJ4P 3SDEA 1T02A 5DQGA 1UVNA 4DV3J 3JXOA 2IVMA 2ZBQA 1QAIA 2DT9A 2MZQA 3NGTA 4IH5A 1X9WA 3JSMA 1P9QC 3GV8B 2BYCA 5D4NA 4HI2A 3HKWA 1RT3B 4YDDB 4IFYB 2H3EB 4U9RA 1TMJA 1REVA 3J80Y 4WPAA 1JMTA 4URGA 2ZOMA 4DSKA 2MKCA 2W8LA 1H7XA 4R25A 4BWMA 2OMOA 4F2RA 2HWTA 4H54A 4IG3A 3RR7A 3TNVA 4L3KA 1HARA 3NGUA 4DV7J 1RT1B 4YB6A 4G1QA 3FQKA 2XS5A 3VALA 3HK2A 3I55S 1XN9A 1SC6A 4C8OA 5GAHU 3MFIA 2GW8A 1NDLA 4EBDA 3GP9A 1QE1B 4O4GB 4USTA 1RLDA 3RRHA 4PR6A 4F67A 2HBZB 5ETTA 2DGSA 2ZH7A 5J1EA 4ID5A 1U48A 3QYYA 3RBZA 2NXEA 3MOZA 2HS0A 3KMQA 1FNMA 4DR6J 1X0PA 1TKXA 4X4VA 3V5RA 4X62J 1TL1A 2P8IA 1YBAA 3IFEA 1CJVB 3L7OA 2BA9A 4DPXA 4TY9A 4Z37A 1GTHA 1T8EA 4QW9A 2RAQA 4E0DA 1A0OB 4CLKA 5JVGQ 4NCGA 1WELA 1S6QA 3NY0A 2KG0A 3G6VA 1FTCA 2E5LF 2P6SA 2Z57B 1G7CB 4OJGA 3ZTPA 3QAEA 4AYBD 1WKKA 1R6YA 4I4BA 5LXYA 2CJKA 1ZAXA 3C6TA 4OQJA 1WG5A 1S77D 2O66A 4EBEA 1RAEB 1M0SA 2GGPB 1B0TA 4Y65A 2LP4A 3RB3A 1X4AA 4X4OA 1TK5A 2EXUA 4K4UA 2UUTA 4PWWA 4UZBA 4DR4J 2J7KA 2CYYA 2R7RA 1NAQA 2YH0A 2DR9A 2Y8YA 2CPXA 2ASDA 1CJKB 5C2GA 2RF2A 4DQPA 3MTJA 2J6TA 1UCNA 1IVZA 3R8YA 1H2UX 2DK2A 3D6FB 1KRPA 1HW8A 2RQCA 3MXHP 1VR6A 3PRDA 4RW7B 1RZMA 2HHUA 4I67A 4DI6A 2DRBA 2E1MC 3R1HA 2KG1A 1EQ0A 1CQMA 1KN6A 5E3RA 5HVHA 1R3NA 1QAJA 4Q8EA 3G71S 2ZNYA 1VQYA 4M94A 2EKYA 1KLMB 1F9FA 4OZ3A 4RNFA 2QMWA 2CADA 1K1QA 3MMCA 3D0IE 4NLUA 1UAWA 2RB7A 2VC0A 2L41A 1X4BA 4NMXA 3KHHA 2RILA 2FJBB 3T9NA 2D3OR 1Z4UA 4JI6F 3VHQA 1O8BA 5EX3A 2YH1A 1TTHB 1WI6A 2YX1A 1XC9A 3M8ZA 3AAWB 4IFVB 2B7CB 5G0RB 4EI2A 1NJZA 1V9OA 5H9EJ 2LYVA 1SVDA 2J6SA 1CJUA 4ETZA 1XEZA 1HNZF 4J9UE 2R7OA 2V8PA 3ILIA 2DXEA 2IM1A 1U2RA 1VQMS 5IWAF 2ZBCA 2G0JA 2DR5A 5A8RA 3FRZA 3MR5A 4QZVB 1H73A 3W5YA 4DV4J 2CNOB 4ED6A 3VZHA 3OL8A 1HNXF 2WOMA 5EDWA 5GMEA 4DL2A 2E9RX 3GSDA 2RNEA 5CXTA 3RAMA 3GCXP 3WZ0A 1JJHA 3DDKA 4GVBB 3MCSA 1S1UA 4DV2F 1RSCA 4YHHF 1UA0A 3LAKA 1RU2A 1FK9A 2JLFA 3SQGB 4Q7AA 3BJYA 3N6LA 4LBPA 3GG1A 2UUBJ 3D6TB 4LIWA 1LWXA 3S01A 1VIXA 2IVYA 2HLTA 2C1EB 3OSNA 1ZAVA 3E51A 1CS4A 3TEHB 4ZK7M 1ZOTA 4USVA 5ETOA 2FHKA 4XIUA 2RQKA 4PG4A 2HSEB 2C3MA 2U1AA 1T0TV 3DOKB 5C2CA 2VICA 3NAIA 3GFYA 3M8SA 1KQGB 2H4YB 2HQGA 5IQ6A 3BQ0A 3DGPA 4A8QA 4M5LA 3IN5A 2OSRA 1N88A 4ZN1A 3AQOA 2DEJA 4UUWA 1PSDA 4AL7A 3MFHA 1HQUA 2E5GA 3IC1A 1SXLA 2ZH5A 2AJ1A 1Q4RA 1LW0A 2EG1A 3EICA 1LWFB 4NPOA 2K7KA 1Y10A 2YQ3A 1EQMA 4ED0A 4QU7A 3ILOA 2UXDF 2HVIA 3KUHA 5KG6A 2HVEA 3QT6A 1OJ4A 2UXCF 1U1NA 1ZTWA 1ZBTA 2DHXA 2ZBPA 3M1VA 2JLGA 1NKBA 2VV5A 3KYLA 4KB7A 3OXFA 2E5HA 4GC6A 3OL7A 3OLBA 3C46A 2EFGA 2AP6A 1JLQA 1KTVA 1R0AB 3JYTB 4HH1A 5LM7E 2DNGA 2V69A 3PV8A 3D0GE 2NSBA 4JV1A 4S0MA 3WQPA 1XR5A 1VHIA 3R9LA 5KFTA 2VC1A 1Q81T 4ELUA 2WSCC 3RRGA 2IRUA 3R5CA 4LF5F 4J9MA 2ABYA 4QW8A 1N6QB 4R8UB 1FRKA 4PG6A 3MAHA 2GQ2A 2WVDA 3D66A 2YVSA 1RA7A 3W65A 2FVQA 2X1BA 2HHQA 3IAM9 2VPXB 1UFLA 3CDUA 4P72A 4JI7J 1V3ZA 4CLYA 3UR0A 4PPDA 5K8MA 3AXMA 3RB4A 2HVHA 4OLOA 2F9DA 5DQIA 4ECXA 1HHQA 2XLJA 1SQGA 2FJEB 5EWFA 2I9SA 2HQFA 3O3LA 2QRRA 3CDWA 2Y1JA 1E6YA 2PA3A 4NLPA 1FXRA 4OZ0A 4QIGA 3IGVA 2B4OA 4NLDA 4OJ1A 4ED1A 3DU5A 2F1FA 4QPTA 3TZZA 3HHNB 2VFVA 2AGQA 2WVEA 2XCPA 2C3UA 4KYZA 1FRIA 4CLFA 1NB7A 4PZVA 1N33F 3CW2C 3MM7B 3QAUA 3TI0A 3PR4A 5C24B 1C1CA 1VBKA 1WI8A 3ZZ0A 4ECWA 3M30A 4LBHA 3THPA 2U2FA 1C0TB 5KFDA 3CJ5A 3HJFA 4PXCA 3CNQP 2NPIA 2Y9HA 3T6BA 1R27B 2VODA 1NPPA 1BHNA 1MG7A 2XHWA 2XI3A 3M32A 4Q44A 2RKIB 4TLQA 2GS8A 1VRUA 2K2PA 1MN9A 3OTEA 3G82B 4JI4J 3V4IB 4DR2J 2OELA 3TVKA 4I2QA 2YX7A 2AEJA 3OTOF 4C8ZA 4TU9A 1BD6A 2E7WA 3FCWA 4J9SA 1CJTB 3BGOP 2BQ3A 5FLXU 1JLEA 2HIQA 1RWUA 1P1TA 3IR6B 4OZNA 3TWZA 2CZVC 1DTTA 4V19J 1GT8A 2YXLA 1SPBP 3CMES 3M2VA 1DTQB 5F8LA 1VBZA 3W64A 2IJFA 1R0CB 3MM8B 2RU3A 2D3O1 2OPPA 1X4FA 4B9MA 4OZ1A 3CULA 1T9VA 5HN0A 3J7A1 3X3UA 3V81A 3SQOP 3NGSA 3FZ2A 4JI3J 1HD0A 2DNLA 3PIOQ 3H2LA 5CABA 7AT1B 2EBEA 1MNEA 4WTOB 4Y2MA 3UDVA 4PRFA 5FLXY 1SIZA 1S9EA 4NA3A 3FKBA 3VCDA 3BYRA 2AGPA 3KLHA 2L08A 3D6HB 1QM9A 5DO2A 4I7FA 1RAJA 5E33A 2QC3A 4HTIA 4OHXA 1RT5B 4LF9J 2HMIB 4O4RA 3KHRA 2HRUA 5CYJA 3A3NB 2JHEA 2ILYA 2OHDA 1SBRA 2EFVA 1C1BA 1NNDA 4NX9A 1N54B 1FDDA 1RT4A 4G1IA 5ETNA 1MN7A 3KG1A 3POTA 3GIMA 1MMLA 4RW6A 1BQNB 4DQIA 2HHSA 1TAUA 2LQ5A 1VC6A 4JB8B 1SV5B 3EE3A 4MKVA 2YQ0A 3GIJA 5K20B 1HPZB 2I38A 4BHQA 5CYQB 1SH0A 2IA0A 4F4WA 1I51B 4PKDB 2R9LA 1MU2B 2HHHJ 3VGVA 1WWHA 1FX4A 3DOMA 3W1YC 3FQLA 3GJRB 4WXOA 1UKUA 2W8KA 2FJXA 3C2PA 1YTYA 3TQEA 5A0YA 2J9DA 1S79A 3KOAA 3BH6B 1D9AA 4J7CA 1VK8A 2CNLB 1W2BR 4USHA 1H98A 2BQUA 2ZC4A 3CD5A 5DDPC 4WWSA 1B70B 3VAHA 5HLFA 2ZWPA 4KKOA 1TQLA 3TAMA 1MWQA 2J8AA 5J2QA 4DFKA 1OWXA 1WC4A 1XERA 2BJ7A 2L9NA 4HVZA 4U8VA 1CG2A 2V8VA 5FIIA 2RDJA 4NCAA 3BV8A 1UZHA 1VJQA 1QTMA 5KG5A 1NHUA 2B5JA 2V4RA 2NUHA 3DLKB 4E98A 1X7VA 4RKUC 3D67A 5F41A 3PZPA 2BQRA 1RTZA 1RWKB 1N32J 5IV3A 3BPDA 1YITS 2HNYA 1AZSA 2KJVA 4P2XA 1N5VA 1U1PA 2CQGA 2HHPA 2QZ8A 1WD6A 2GO9A 4TYBA 4J9KA 3UW1A 3T3FA 1DY3A 2VD3A 2AIRB 3PW5A 1WSVA 4BDPA 2DNKA 3DI6A 3UWTA 1FNXH 3C15A 3HX9A 4HDHA 2RS2A 1MROA 3IXQA 1Q8KA 2MGZA 1PG5B 1QDUB 1S9GA 4ZLPA 4NLGA 5I3UA 1DFDA 2OFHX 2XCAA 4DR3F 3GJSB 2GHPA 4R5PB 4OV1A 2AJQA 5IT9U 4DL3A 5HI7A 2KT3A 2GIQA 2OTJS 2QLJB 2CQBA 1S1WB 3HT0A 3NOCA 2MHNA 3NBPB 5KFRA 3KKFA 4FYXB 1RTHB 5KFSA 3ZZPA 2C2NA 4RL1A 3D1HA 2B56A 3MEGA 3MOJB 3D3CJ 3RR8A 5A8WB 4FPIA 2Z0GA 3Q8YA 4OHVA 2OTLS 5T41A 2KT2A 4ANCA 4P2MA 2E5LJ 3HHKA 4QJVA 5ETLA 1O51A 2DHSA 1UWAA 1Y00A 1RWXB 4ZCKA 4IYQA 5ETSA 1U0HB 4WP8A 2YKQA 3H5YA 4B3SF 2X7IA 4ED3A 3PEHA 4ED2A 4H4MA 1S1XA 3SDEB 1B0VA 4PAAA 4K2JA 4AXJA 3K58A 1JLGA 5D77A 3HVTA 1U25A 4QYZJ 3T5KA 1VC0A 4DUYF 1ZM3A 5IZHA 3ITHB 4UOCA 4EFAC 2ACYA 2FB0A 1C4AA 3JSMB 5DDQC 3AB4B 3UD4P 2A6OA 4I6WA 3HXMA 2CVIA 4NZ6A 5CYMA 3OR1A 3SFGA 2QGFB 3A8EA 3PKMA 3IMQJ 3HJVA 1Q16B 1YBTA 3WDOA 4WFAQ 1WOOA 5B7WA 2QLXA 2C2EA 4BS2A 4IOAQ 2B43A 5KFAA 1HKAA 1ZETA 4C8NA 4OYPA 4F26A 1X5TA 4AD6A 1QAXA 1KQSR 2AX1A 1V6HA 1GMWD 1M5HA 1TK0A 4Y2KA 3MDFA 2GJFA 4ECSA 2C2OB 2BJ9A 2UV8G 2J9EA 4WFNQ 3A3OB 1RACB 5L39A 1WF1A 1SKUB 3QIPA 4CI0B 1PBAA 2UVRA 3DMJB 3TVYA 1H74A 2UUAF 3KJVA 5KTQA 5CCLA 3DNCA 5KT6A 2EKNA 1RWMB 1WC0A 2XMMA 4LRDA 5J1EB 4RU9A 1M1KT 4MKAA 4ID5B 3PHEA 2HGMA 1HBMA 4URQU 3MMBB 1FNOA 4NYZA 1D8YA 1FESA 3ENQA 5D3GA 4DL5A 4FXVA 2NSCA 4RUCA 5HVGA 5IS2A 5B08A 1HWUA 3P5BP 1NHKL 4JI6J 4FYDA 1HQEA 3NNHA 3LO3A 5HROA 1GH8A 4I6YA 1IBLF 4PQUA 5DQHA 1C2PA 4YN3B 4N41A 2RSQA 2IBKA 4MFBB 4NCGB 3T1AA 1S6QB 2W4CA 4B9TA 1F5AA 4Y2IA 5DDOC 4V1Ak 4Z7CA 3M9OB 1HNZJ 1DARA 3MM9A 5DM7Q 3RU0A 1RABB 2Q43A 5IWAJ 1QD1A 3HFVA 5DG9A 1G6BA 5E0OA 3P6YC 3KNAA 3HSDA 3RJMB 4C3KA 2N4DA 5B0BA 1M5SA 3LP1A 9RUBA 3SSRA 3KLEA 3CCES 1IBKF 4OYAA 2KVQE 4YHHJ 2F4FA 3CWJA 3JAMU 1HBOA 1XMOF 2CQ3A 4ZPCA 4P10A 1Q5YA 3H40A 2YWGA 3KMSA 5D4OA 1MSWD 2DNQA 2MKJA 4KR0B 2KFZA 3BGFA 1KSPA 2NPFA 2Z58B 2JEFA 5EWGA 5KFYA 4KGZB 1KHWA 3CF5Q 4YR2A 2BE7D 2N7YA 3QWPA 4OYZA 4ZLJA 3MMJA 4DEZA 2RDIA 3R5DA 1UW9A 3TAPA 2XM3A 2VDIA 3PW7A 4JOUA 2PMHA 5E2QA 4OI1A 4P71A 3JAMY 5DG8A 4RNOA 4O44B 4ETXA 4DJBA 3GWCA 2EC0A 1R89A 4KHMA 5HP1B 2DHHA 1KQFB 4O3OA 4J9NA 3PFEA 4U96A 1UWBA 2UXDJ 1VK3A 4J37A 2LEBA 2ZE2B 4ZOSA 1RUSA 4CH1A 2UXCJ 3EZOA 2OIHA 3NP5A 4FN5A 4C0OC 4HL9A 2YKNB 4AL5A 5CCMA 2B4PA 4HDGA 2MKSA 3H2UB 4FS1A 1D8ZA 1GX6A 1R43A 1L3VA 3EMTA 1WC3A 4QYRA 3MMAB 3OXGA 2MPUA 2HGLA 1WDTA 3NWGA 4LF5J 3D2WA 1W26A 2YNFB 1V5VA 2D41A 2GAGC 2JEJA 4C0BA 3BREA 3R5BA 2JH3A 3ZFVA 1KOOA 2ZZNA 1JLFA 2LXIA 3ENWA 4AFFA 4NRUA 3HVRA 3DYAA 3HI9A 4CLSA 5D0HA 1FK9B 2HQ3A 2WB1D 2FIUA 4HH0A 1FE4A 1RHKB 1EARA 2DNYA 1IKWB 1S76D 5DG7A 3I96A 3UDCA 2H48B 2BKPA 2LVWA 3EDRB 2R4FA 1RHMB 3G6ES 4WFZA 4ZVQB 1GMWA 1F3VA 3QNWB 2ZHAA 2XULA 3BB5A 2FJDB 4ZHRB 2XLKA 4Q45A 2FD2A 2XSFA 2HZVA 1WHVA 1QVFR 1XNQF 3OW2R 4N8OA 3OHAA 3VVUA 2H5EA 4DSIA 2W25A 2XY7A 4C4WA 3V6KA 1X5PA 1ZZNA 3NXZA 5F3ZA 3DGPB 1N33J 5CH7B 2LFVA 3KWMA 3ZNJ1 4LREA 1KTQA 1RKIA 5KT3A 1JLAA 1BUXA 4J9VA 2M8DB 3C6UA 4IO9Q 3TRGA 1J27A 1NK9A 3RBXA 3KFWX 1YJTA 1IUJA 3CEDA 2M2BA 2FZCB 1X4GA 8ATCB 2XMAA 1FVQA 4GKKF 1F2GA 1GAOA 3HD1A 4WYLA 1BXNA 2M70A 2XMTA 5RUBA 2V2KA 3OTOJ 4ZCMA 3FFIB 3ZTOA 3OL9A 5KFZA 4QWAA 5GAHI 2KU7A 1FJEB 4MK7A 1NH7A 1SJQA 2LEAA 1X5OA 3CXCR 2HFNA 2V67A 1FF2A 4FZVA 3LGHA 1YJUA 2X1FA 3M9MB 2EWHA 2EW9A 2BJEA 3TJ8A 3NS7B 4EYHB 1SL2A 1TUGB 2E1PA 3Q23A 2NR0A 3BGLA 4L75A 2E66A 1RWWB 5ADZA 2MQOA 5KG3A 4DL6A 1NB2A 4ZVUB 3DM2A 1HFEL 1NSPA 1T03A 2QN6B 4L76A 5T7LB 1EAYC 1I5OB 2HRTA 1QY7A 1YLXA 3CJ2A 3EX7B 5ETQA 2HNDB 2C2KB 1BE4A 1RAIB 3Q8RB 2DHGA 3W60A 3PJXA 1FJGF 1NJYA 2AF6A 2V2QA 3I87A 4ZIWA 1RT6A 5KFIA 2YNHB 1GTEA 5KFCA 1PAUB 3MEEA 4OI6A 2KRBA 4MT1A 4DQRA 2NQPA 4CT9A 4LQ3A 2XG8A 4ICLB 3LTOA 4WKRA 3P49B 2W1BA 2CWKA 3EZUA 3AJDA 1HI1A 1T94A 1C1CB 3M30B 2G1HA 2C2MB 2C28A 2IBOA 3ZZUA 4K4XA 5IV4A 3GFHA 1ULRA 4NZ0A 3SEOA 1YK9A 2A1BA 4MYUA 2BEFA 1FWLA 4QWBA 3M32B 2CPJA 2MMYA 2V50A 1IWAA 4HACA 3M2UA 4WFXA 2I0XA 3H25A 1IJEB 2P2CB 3C66A 4DHVA 3PRVA 2E7XA 1HW9A 4LF1A 3WIUA 1JLEB 3MAAA 5GVQA 1S7IA 2YNIB 2QMUB 3EGZA 4B3TF 3UO0A 2MKKA 3RW6A 5AE3A 3PX6A 4CYUA 2DRAA 1LKZA 3TZYA 2DVIA 3UFCX 1NDCA 5DS7A 2XGPA 4DSFA 1SB6A 5L1KA 3HHLA 4RBTA 1NMEB 3V81B 3PYDA 2FTRA 3OVSA 2NUUG 2W7AA 3FEZA 2IA6A 5J2PA 5C25A 4KPYA 1RU1A 3Q2SC 1U2FA 2W2NP 1NJWA 3KJQB 2D1CA 2QTWA 4X62F 3J7AN 3MM6B 4LIRA 1U1RA 3QRRA 2CQIA 1C0UB 3B6BA 3I82A 3S6EA 1HMVA 3L9ZA 4UW2A 3BSAA 4P2FA 3SV3A 3GTYX 4CM0A 4WE1B 1FKOB 4GKJF 2VBYA 2ROGA 1G1XA 3RZAA 3C19A 1TUVA 2GQCA 3TA1A 4DX5A 4ER8A 2XMVA 5A8KA 4KQZA 1IJFB 4DS4A 2CNNB 1OPZA 1SJ1A 1FWPA 1C1BB 2IYIA 3CCZA 3R6GB 2IRXA 3TAQA 4EWTA 3TQ1A 4Y6IA 2Y8WA 4O3RA 1DRZA 4DR3J 4RW6B 3S1TA 2WVCA 2LQBA 2RD5C 3DHWC 1SI9A 4ZCLA 3N9UC 3G87A 2ATCB 2JFDA 5FDLA 4IRDA 3DLBA 3VZIA 2J9CA 4DR4F 2C3YA 3BKUA 2FHOB 1AB8A 3GG0A 4F4XA 2E7VA 3DOMB 3AODA 1U1MA 4B3OB 4ENOA 2B51A 2HNZA 1RWPB 1O5JA 5EGYA 2W9CB 5M2RA 5A0YB 2VBZA 2QG9B 2PN6A 4FKYA 1VC5A 4K0KF 3HSZA 4NZ7A 1WNEA 4BCAA 2OPQA 3H2VE 6FDRA 2KT5A 4FNHA 5ETRA 2RE1A 3PG9A 4KKOB 3CJSA 1JWWA 1N5TA 3PW2A 2FYXA 4B3SJ 1Q7YT 4EO6A 1VQOS 3V2UC 2YTCA 1IM4A 4F3MA 2NZCA 2FQQB 5AE1A 5L1IA 3NRBA 4DUYJ 4E2FB 1V3SA 5KOWA 4TY8B 3CCJS 4WXWA 4OI3A 2W24A 5U47A 1OSDA 1Y4ZB 2AZ3A 3QBCA 4NLOA 1K47A 4NEZA 5HVFA 3B82A 3JSYA 2B5JB 4N77A 3K57A 3IGNA 2GAHC 5DRKA 3O1LA 4CO1A 2FHJA 4J9PA 5KG7A 2YKOA 3ISND 2KTQA 3VAGA 1AZSB 2RDDA 1APSA 4W90B 2ZKTA 2KHDA 2N4CA 4X4PA 1LWCA 1JJ4A 2AW0A 3H4BA 4TQRA 1LNQA 4JUZA 3CJ3A 3P4UB 2J9DE 3QGGA 1CSJA 1R8PA 4WFYA 3ZTRA 2XEXA 2IFXA 2M7SA 2ZC3A 5J1PA 3C15B 3RYLA 1MROB 1MMNA 2ZJPQ 5ETPA 3L95X 2QL9B 2UUAJ 2AKWB 4MKBA 5I3UB 4LT6A 4RNNA 4FPRA 1TK8A 3E01A 1FEEA 2CFXA 1VQPS 2F65A 2OSQA 4JI2F 1S9FA 3BR9A 4IUFA 4K4TA 3W2WA 1H3DA 2XQCA 3TUIC 2HBYB 4C9DA 4JI1F 5DM6Q 4HR2A 2CZ9A 2PFFB 3VQTA 4ECUA 4DX6A 3K7RA 3BDPA 1IBLJ 3MEGB 2JJ4D 3E8OA 1ZPVA 3DLEA 2CQ0A 2K06A 4NL5A 3S8SA 2OPSA 3CJ8A 1K73T 4NXNF 3VTIA 3SMZA 2LKZA 1WKJA 3GR1A 2KFYA 2DPJA 2RUGA 2YPYA 1CQNA 4C8YA 1OY8A 5AE2A 4DZDA 1R8BA 4P7TA 3KK2B 3MR6A 5IOLA 4ES1A 4H4MB 1N5YA 1S1XB 3KLFA 4L72B 1JLGB 3HVTB 5F8IA 3KTQA 4RWWA 2OPRA 1SIWB 1Q53A 3G4SS 1M1GA 2GVDA 2IM0A 3LGMA 4C3MA 4DSEA 1K9MT 1XNRF 2PGCA 3VAFA 5JUMA 3M8PB 3DXSX 2DNMA 3HDSA 1MW7A 3GLJA 1RTJA 1OYDA 1Y3JA 5AXMA 2E1CA 1HD1A 4QIFA 4L3NA 2H9ZA 5LT5A 3QLHA 1MWYA 2DGTA 1GFWB 1UETA 2ZH3A 3ETOA 2RIJA 2ZZTA 4X4SA 4ZS6A 4GVLA 2GHWA 2GC8A 2HZAA 2Z4PA 4GRSA 1R0BG 2GHVC 4YB5A 4B9SA 2OEJA 1W25A 4Q2LA 2V9WA 4N5SA 1FA0A 4X4UA 1SJFA 3R7BB 4Q8FA 3QGIA 2HPUA 4PEOA 1HBMB 3HZGA 2P5VA 2J0WA 2CQ4A 3I9ZA 1S0NA 2RU9A 2VASA 2WHOA 1XBWA 4AE5A 4NA2A 3ELHA 2KO1A 4ZP9A 5HANA 3R7NB 2D7SA 2LLZA 2WONA 4JI7F 3ET6A 3PJWA 2VPZB 3TJ9A 4M5GA 3F73A 4EYIB 4NASA 5KT5A 2C42A 3I56S 5DLGA 1X60A 1Q8LA 2NZ4A 4PUOA 5GAEI 3NGKA 3I0RB 5KAKA 1EJ7L 1KBRA 4M8LA 3BGRB 1U1OA 4WKYA 1Y3KA 1LK7A 3ISNC 3QWUA 3Q8UA 1OSCA 4DSLA 4X64F 4LVOP 1S6PB 1Z1ZA 1SC1B 3QSIA 3M9NB 1N5SA 2AX0A 2FLOA 2XNQA 4KGMA 2CJYB 4ANDA 1A6LA 3LWLA 4OJ3A 4O3SA 2Z2ZA 3CJQA 2JSXA 2AHOB 2OGUA 1NK8A 3LP1B 2CZ4A 3MECA 4QOTA 2KM8B 3KLEB 3WBZA 2IIHA 1UL3A 1WDDA 1NU4A 4P2SA 4TYAA 1FXDA 2IDLA 2CPEA 2VFSA 1NDPA 1HBOB 4IRCA 1RCOB 4BLGA 4KPCA 2PE8A 3UPFA 3W2VA 2E1RA 5AXKA 3MWBA 4IOCQ 3ADAC 4CP5A 3Q89A 4C11A 2VUGA 1ZZFA 5HSPA 1KHVA 4LR9A 5LSRA 1S7HA 2QT7A 3TX8A 1XNQJ 2HG4A 4JI4F 2OD6A 4NXMJ 2DGUA 1BWEA 3FBBA 3Q8QB 1F3FA 1KDNA 3FBEA 3SV4A 4XDCA 2MLXA 2PFDA 1NKCA 1RA6A 1BLUA 1XWLA 4G1PA 3LP0B 5D6GA 3K5MA 4XDDA 4HHHA 1T05A 4WZQA 1VYAA 5AT1B 3HCXA 1FKPA 5T14A 1GMUA 4F0HA 5BYRA 1NK5A 1NSKL 3QJLA 4CQ1A 3NOGA 4N47A 4TN2A 4EEYA 4YR0A 2CJ9A 3GU0A 4FKXA 2FVCA 1RT2A 4DL0C 4ZVGA 1R6VA 1KS2A 1J5OA 3EUNA 4EGLA 1HQ2A 2AT1B 1X0FA 2QSFA 3G86A 5L8RC 4FF2A 3AT1B 4DCPB 1QAYA 1JXEA 2R7XA 1JLCB 1JKHA 4LF9F 3T5JA 1VLYA 3BO4A 3O8WA 2WVFA 5L38A 4KIAA 4H4KA 4CO4A 1AYEA 2YWWA 4LSNB 2DIVA 3BKTA 4IR9A 2QX0A 3LANA 2WVBA 3DYAB 2W9BA 1Q82T 1WC6A 1X4EA 3IR5B 4IG0A 4Q0BB 1FDNA 4KO0B 4OZ2A 3GIIA 2X3DA 1BQMA 2XO7A 2DNHA 3PO5A 2BX6A 2WSEC 3D9BA 2E5JA 3FJ2A 3IO1A 2XMWA 2D9OA 2CA9A 2BKOA 1O6XA 3UNYA 3M8YA 1LW2B 3DN9A 2GQQA 4QQBA 3W63A 3NS5A 2N3OA 4CO0A 1RT3A 1H2VZ 2F8HA 1VJWA 5JVHQ 4NLVA 5F0UA 2R7UA 2FZKB 4DU7A 2XYPB 5KFPA 1FWKA 3LF0A 2O5DA 1AFIA 3LUYA 2W7PA 3T19A 3DC2A 1JLAB 1DHMA 1TV6B 3C6UB 2JC1A 2VJVA 2UV8A 1WUUA 3R5AA 1XR7A 4ZLLA 3KG0A 4CO5A 1RT1A 3FZBA 2YWHA 2VA3A 1M5KC 1P27B 4JI8F 5F8JA 3LALA 3K89A 1EZZB 3J81j 2NXNA 1N4LA 2JVRA 3NMAA 3DRYA 2VKRA 2ZH9A 1AROP 2DB1A 1YI2S 4O4GA 5KFHA 2HFOA 4CM2A 1PO6A 4RLEA 4A8WA 1N32F 3W66A 1B99A 3DRPB 2MHEA 3OQ2A 1S6UA 2FHMA 4PABA 3QZ7A 1TP7A 2HS3A 4B3TJ 1J5EF 4B08A 3PR5B 1TL4A 5E3QA 1BY9A 2VQFF 4OYXA 3MPYA 4U7CA 2MQQA 2R2RA 3GIRA 3Q0AA 1IR2A 4LFAF 1NO8A 4KJIA 3G8QA 1Q8BA 1KD1T 2QSWA 2BE2B 2V4QA 9ATCB 2EC2A 4NLYA 3MCOA 1PYTA 2R8KA 1FI4A 3G9CA 2BR0A 2UVUA 1JJ2R 2IMOA 2BM1A 1TL3A 4YS2A 3CJKB 3CMAS 4GKJJ 2WW8A 1RAHB 3KG4A 2GGPA 5IXUA 1DQ9A 2CWXA 3DLGB 5ETVA 5HMZA 2QYCA 4OYMA 4DSJA 2COLA 3T1YF 3MEEB 4ZJOA 1A7GE 3H5XA 3E2EA 8AT1B 1GXTA 4DV1F 2N7CA 1IBMF 1I94F 2M88A 2PDAA 2DGQA 1HR0F 1UMJA 1CJKA 2VBWA 2GMJA 3AH6A 4K4ZA 3OT9A 4MTPA 3EZ5A 2MXYA 2QIFA 4QR1A 1HI8A 1F6TA 2YWEA 4DF4A 4RW7A 1XMQF 3OFFA 3CJ0A 4DCJB 1RAFB 1SUQB 4OX9J 4K4SA 4WK1A 2NYIA 2ZD1A 2LA4A 1UVJA 4WCEQ 2BACA 1FVSA 4HACB 4WJBA 1QUVA 2K3IA 4ZPAA 4NCBA 1RJJA 3H5UA 4RX6A 5HL7Q 4K4WA 4DX8H 2GA7A 4NLSA 3C16A 3PVXA 1X5SA 1KLMA 3VQSA 1TR0A 2KL8A 2FUG9 4ZDNA 2HAFA 5HATA 3ISZA 1HL6A 3OR2B 4KGXB 3MAAB 4K0KJ 4ZJLA 2ZBRA 3N5BA 3VV2B 4XO0A 1IM6A 2PT0A 1R8HA 4CYUB 4M63A 1NKEA 1S0MA 3MHYA 2LA6A 4DV6J 1FD8A 1R8AA 2DH7A 1RHJB 4F3QA 5KG1A 4KC5A 1S72S 5G0RA 2HBQB 3IP0A 2RH3A 3MEDB 1TL5A 3O2IA 3Q22A 4O0IA 5B0DA 1EETB 2CAJA 2F8MA 2BANA 2YNGA 4YQWA 2QE5A 5F9NA 2V4JA 2VU5A 2DR8A 2EI5A 2ZKUA 3TEGA 3TR5A 3R7SB 4JYAF 1DLOA 3GYGA 1RQ0A 1PILA 3LP2B 2DNRA 3CCMS 4GVBA 2G2YA 1F60B 5EUHA 5A8KB 1YSJA 1I3OB 3TUZC 3SQGA 1RAAB 4V19X 1NLKL 3U1MA 3KK3A 1DQ8A 1QVGR 3IM8A 3ZZOA 4K4YA 2GMHA 2L48A 2Y1RI 5AXNA 3FC9A 4X2BA 3R3TA 2FVPA 4JI2J 3Q8VA 4UF4A 5K9FA 2M9KA 1PIEA 5M2PA 3RRKA 3BKFA 1U6BA 3HHDA 3NLCA 1RGVA 3N01A 5KFGA 4JI1J 5A76A 4UTGA 1EP4A 3P45B 2DR6A 2MY8A 2QA4G 2MQPA 3N28A 3BSNA 2YKPA 4C97A 1KP6A 1S48A 3LAMA 4C6AA 2CG4A 4NXNJ 3BBBA 2CQPA 4N7TA 3T5HA 1EIYB 3MD1A 4UOHA 5CHCB 2OPQB 2K1RB 1O0PA 2A2DA 1XK8A 5KOXA 1ITPA 5GMKa 2KJWA 5SUHA 5M2UA 4IKAA 3ZTQA 4LJMA 1LWFA 2HQDA 2XY5A 3TYTA 1QUPA 1N52B 1U8SA 2NXUA 3BS9A 3TANA 4DQSA 2EFOA 3AOBA 1U1KA 2V0NA 2VG5B 4UY8T 2GVZB 5IFMA 2P6TA 2ACMA 4F4ZA 2YWKA 1XNRJ 4B02A 4F4AA 1Y11A 1R0AA 3JYTA 4O3PA 1FHTA 2MQ8A 4ZVSB 4QPXA 5KFXA 3VF0B 3FSIA 1RE1B 3H42A 2F9JA 2CJQA 1XR6A 3LQVA 1N6QA 3AA8A 1YVFA 2A2CA 4CCHA 2PSZA 2CPFA 4FVMA 1EX8A 2B9WA 4UOFA 1B7FA 1TL7B 1SCJB 2VG7A 3EGWB 3MTKA 1VRTB 4DBQA 2XC9A 1FKAF 2LU1A 3DRRB 4YY3J 4DV5J 1AUSL 4N56A 3W2WB 1WTFA 3SXLA 2RHQB 3JQKA 4LF8J 2IJNA 2SXLA 3QZ8A 4CO2A 1T3NA 1EB0A 3M2RB 1RWNB 3LOUA 2MEWA 4G65A 2OPSB 2V5HG 2LCWA 3MM7A 1OPIA 4ED4A 3CSKA 5F8NA 2WTFA 2DRDA 4ERDA 1K1SA 2R7WA 2A3JA 3CB4A 1JK9B 4QU6A 2BRLA 3C14A 2R8GA 2QV6A 2B9XA 2W2MP 2Y1LB 4X64J 5DGAA 3KLFB 1C0TA 2JEGA 4A47A 1WF2A 2NYHA 2W4PA 4X65F 3N6NA 2OPRB 1FDBA 3D0HE 2V9KA 3WX8A 5IM0A 2GVDB 4WU3A 2WSFC 3OHBA 4DL7A 1IKYB 2CG8A 1YKWA 1CBKA 1H2TZ 1F5BA 3EDQB 2J6UA 4O0NA 4USUA 2LQ9A 1RTIB 2Z30B 3BYPA 2DIUA 2W2OP 2O67A 3R5JB 1JXVA 1RTJB 3EVOA 4XTTA 4R0EA 1TFWA 4ILRA 4EO8A 1WOPA 3F0NA 1CJTA 2N82B 5J2MB 1PAEX 4W4MA 1UVIA 2VBXA 3M8QA 3T1HF 3GV7B 1NDKA 1UEVA 3QLHB 3D1QA 5KFNA 2VG6A 1DTQA 2HKEA 1HLWA 4G6VB 2Q66A 2O1PA 3CJRA 2MJNA 3EPIA 3ETMA 5LJ5Y 3M8RA 1NK7A 4DPWA 2FDNA 1G2EA 2OMLA 5F8GA 4ZVOB 3I31A 2R7SA 3A8IA 5ETKA 1VQNS 3GYXB 2KXHA 4C8KA 3A4TA 1NK0A 4F0KA 2DNPA 5KFFA 2ATLA 1RI7A 4Y34A 2AYEA 3HMJG 1U4BA 1U2CA 3KK1A 1KOHA 3QT5A 5CZXA 2N3LA 2CXEA 2FY8A 2B6AB 3DU6A 3GILA 1JJCB 1TKZB 3TARA 2WONB 1QJHA 4Q2MA 3ET6B 5A6WA 1IR0A 3J81U 3AD7C 3CC4S 5IC6B 4ZA1A 3DOLB 1YJVA 2MQLA 3RG6A 3CCQS 2DJWA 2XHCA 4PUOB 2UXBF 5D8HB 3U1LA 2Y0SD 4OFZA 4DXLA 4GO5X 2R7QA 3MF5A 1NRKA 2ZUGA 2OEKA 5J2NA 3PRBA 2O3DA 2KHCA 3ILLA 1S12A 1Y7PA 5GAEU 1B64A 1TKTA 2ZJRQ 2XNRA 1CLFA 3MGJA 3JB9k 2AU0A 4ZKAA 1SV5A 4XPEA 4IDKB 1FXLA 1ZM9A 1D09B 2B3TB 1S1VA 2XSJB 4UT4A 1MU2A 3QSYB 3J81Y 3MECB 3IG1B 2JEIA 4YDXA 3NWRA 4NI2B 3B78A 2FGOA 3R6LB 3RAXA 3GJTB 1K0VA 3ENAA 2MQNA 3P3DA 4PWDA 3DLJA 3DLLQ 1VBXA 3HO1A 2P9GA 1Q78A 1RXOB 4Q43A 1RTDA 3SYZA 4C11B 1YZ6A 4RW4B 5KFBA 4FBUA 2CIMA 3SBMA 4BC9A 3FRYA 4CLPA 2EG2A 3GONA 4KFBA 2FJWA 2XYGB 3AD8C 4Y3CA 4O3NA 3BM7A 2HWIA 3JQMA 3PYEA 5K8NA 1UJ6A 1FRXA 3FGVA 3J7ZT 1AT1B 5GADI 3EGNA 4B3RF 4CWBA 4CZCA 2QYGA 4NOHA 2OFGX 5HQLA 1FKPB 3VVTA 4F4YA 2ZNZA 4OJHA 1OY9A 3DDNA 2B8PA 4PWUA 3RGIA 2WBMA 2M0GB 4LF7J 4YB7A 3JSBA 1D1UA 4JI8J 1SKWA 5KG4A 3TVZA 4HT7A 4QR2A 4YUDA 1U45A 3CPWR 3CCUS 5KFWA 2XZTB 4CTAB 2MYFA 2GCFA 1RT2B 2F63A 3V6DA 4F2SA 3I0SB 3SI8A 5LSLA 4F0MA 3BSCA 3CCWA 4CDIA 4HI1A 1YJ9S 4QIVA 2V68A 2VH7A 4ZVEA 1TUWA 1WORA 4DG1B 1RK8A 2W7OA 2C3PA 1J5EJ 3UVJB 2YKMA 4WK3A 4J5OA 4KGKA 4USMA 4A4JA 2VQFJ 5F8HA 3A8KA 1S1WA 4M5KA 3NBPA 2J0QD 3OFGA 1RTHA 3J80U 4LFAJ 1X9SA 2L3MA 4OYOA 1VIOA 1RWVB 3BN4A 4IG0B 1E6VA 1X31C 4ECYA 3FMWA 1U0HA 2W2QP 4I69A 1BQMB 1NH8A 1FFGB 1NK4A 1N36J 2ZM6J 2DITA 4DX7A 4KAIA 4ED8A 2BKNA 5GAGI 6AT1B 4DR5F 3ITHA 3L3CA 2DD8S 2ZEJA 1X4CA 1HWKA 1PKUA 2IC3B 5BR8F 4LSZB 1RADB 3FSXA 2R42A 1BMQB 3T1YJ 1K8AT 3OD2A 4KH1B 4DV1J 2PMWA 5BYQA 1AW0A 2OH2A 3ZO7A 4HHJA 2F7VA 1IBMJ 1Z2LA 2GZOA 5L9XA 1I94J 2AYMA 1WEYA 3RW7A 4TU7A 1HR0J 5HMYA 4EZ6A 3KNGA 4ZPTR 4HLBA 5HMWA 2BZ2A 5IT9Y 1XMQJ 2Q3PA 2DH9A 3O6QA 2XZDB 1RT7A 2WZ1A 1Q0NA 3AHPA 4J90A 4H4OA 3UCUP 3GE9A 2LDYA 4ZN3A 1S59A 1NZ8A 1REVB 3TUJC 3U1NA 4F04B 3IS9A 3TUPA 1YRTA 3T41A 2QO3A 4CLWA 1U7LA 2AJ2A 3OL6A 4OIXA 2R8JA 2XYHB 3DMJA 1OYEA 5HJXA 4Y00A 2E9ZA 3OVBA 4IG3B 1FCAA 3MPUB 2D69A 4LF4F 3MMBA 3HM9A 3PEJA 4G1QB 4B9LA 1CULA 4CLUA 3H4DA 4KY3A 3M05A 1RHQB 2IM2A 3DDIA 3BEGB 2UU9F 2AZ1A 2MKYA 3KJFB 1TVRA 4N76A 1RHRB 3M6VA 1OQ3A 1UPMB 2ZH8A 1S1TA 4NRTA 2HAIA 4MFBA 1FERA 3IRWP 2ALYB 3VGSA 4LR8A 4C7QA 1HBNA 8RUCA 2R8HA 3CT9A 1TKXB 1T9UA 4MKYA 3Q2TC 1TL1B 2FVRA 3MPVA 7FDRA 2LDIA 1P9YA 4ZMMA 1ZS6A 4USWA 1TL3B 3PDNA 2BJ1A 2CJXB 1D0EA 2LEPA 2JZ5A 4DZ6A 2F5GA 2P9CA 4JYAJ 5KFEA 3PY8A 4OZJA 3B4DA 1LXNA 2KM8C 2POKA 4KGVB 3IM9A 4DV0J 1TMMA 1Q7LB 4ZVFA 2F4VJ 4I56A 3SIPB 5AJ3F 4KSEB 3C6TB 3VGTA 1VQKS 1ZM4A 1JNRB 4B9NA 4ITSA 1Q5VA 4YEAA 3OUYA 4I1TA 1YRXA 1AUDA 2H5JB 1JNZB 2ZD1B 2VZ9A 1TFYA 3P96A 3OSPA 1D9DA 4X4RA 1R31A 2APOA 2C2ZB 3R27A 2WK4A 3R1LA 4DR1F 2I5JA 1RP5A 1NSAA 4AQYF 2RF2B 3ZZRA 3C16B 3OJUA 4NA1A 4U7UD 3HHEA 1YJNS 4DN0A 1DJ0A 2HYIB 2E29A 3OPKA 3GJQB 1AXQA 3W61A 2ROPA 4O44A 1SH3A 3NGRA 3CCTA 2G2ZA 3CDBA 4LUBA 3PO4A 3CC7S 2HIYA 1YGYA 4CNYA 4RNMA 4LRFA 5HP1A 2AJ0A 2KYZA 3MR3A 2HVZA 3AJ2A 1J2VA 2QLFB 3HULA 2LXUA 4KTQA 1CPZA 4FYWB 2EPIA 5DGBA 4OI0A 2A6MA 2LMIA 2ZBIA 4USIA 2ZE2A 2J0SD 5FJ4A 2E44A 1SH2A 2ZUAA 3PW4A 2DCLA 2YKNA 3MMCB 2HHWA 4GO7X 2EFQA 2RS8A 3W8GA 1VMBA 4ECTA 2XS2A 4LF6F 1C4CA 2BANB 2YNGB 3N4WA 2MSSA 2V4JB 3OTCA 3MMAA 3GSIA 4ECQA 2YNFA 4B17A 4BWJA 3D1OA 1DLOB 3HF5A 1Y9OA 2FVSA 2ZVIA 4CT8A 4K59A 2R7VA 1CJUB 2I8EA 3QJJA 5HK4A 4A8SA 2J8SA 4WTYA 2FZGB 4ZVRB 2YPZA 5A8RB 1UVLA 2G13A 3UDLA 1IKWA 3KK3B 3D28A 1ZA2B 2HFZA 3ZXWA 3C3LA 1KC8T 1RHUB 2BRKA 4OV6A 2NXJA 2WOMB 5LMUJ 5IQQA 4DUZJ 4WIQA 1PCAA 3TW0A 1DBDA 4ZHRA 3NGDA 4ILLA 1UFWA 2WBRA 3BH7B 4F25A 4OZ5A 3I5BA 4U6PA 2QJ3A 1M5VC 4K50A 1S1UB 5F0WA 3PCOB 4JBCA 1EP4B 1RAOA 1KVKA 1V5IB 4CLLA 3HHLD 4F50A 2NREA 2CKWA 4KRWA 4FF4A 3I6PA 2M5YA 3FEYB 2DR7A 1PYOB 1NZAA 1XMBA 5AXLA 1GNKA 1CS4B 5LMNJ 5EHHA 4I2PA 1HYSA 3IWLA 1WACA 4NXMF 3QT8A 4L6V3 4TU8A 4ZITA 3GZ7A 4XPCA 2EEYA 2IHR1 3M4XA 3R2DJ 4DR7F 5I42A 3OTBA 1NBEB 1S10A 3CO0P 2H65B 4X65J 2ZDOA 4J91A 3X1LB 2OI2A 2A10A 4NE9C 2W2PP 1KNZA 1VLOA 2IAJA 3HFZB 2ZITA 1HQUB 2W4DA 4UUXA 1RB0A 3W9IA 1OIAA 2MQMA 1IKVA 1LW0B 2QLWA 3ULHA 2DO4A 2VFUA 3FFIA 2HK3A 1SC4B 4K5SA 4Y2AA 3T1HJ 1SJ3P 2JVOA 4OHYA 5H9FK 3R97A 3NKYA 1VQSA 4LRCA 4PG7A 3M1VB 3GFXA 5D0RA 1Q79A 2K8GA 1JLQB 2VOPA 1Y0HA 3ZZTA 2M4MA 2VG7B 1WF0A 4DCOB 1MWZA 3J7YU 4P7VA 1GQEA 2GJIA 2W01A 4RUAA 2EFNA 4P73A 1BGXT 3UCZP 2FY1A 3KLGA 1BQXA 5T7LA 1KLNA 5B0AA 3VAJA 3V6JA 4QWDA 3PKYA 3OVAA 3HLUA 4DL4A 2HNDA 5E41A 3R5GA 4DPYA 1U49A 1YZ7A 3TZXA 1Q86T 1SQFA 4PXBA 2YNHA 1FD2A 2QL5B 4RZRA 2D3ZA 2MJUA 3PHTA 3WHIA 2ADBA 1RBAA 2UXBJ 2ASLA 4ICLA 5KFOA 2VOOA 4DN9A 2KVIA 4PYAA 4DS5A 3RB0A 3GB0A 4A48A 1YDLA 1E6YB 4RBVA 4NMLA 3C14B 1U1QA 2FHJD 4A46A 1JQGA 2ZH2A 4C8MA 4QIEA 2ZH1A 3Q8SB 1OS5A 3KLVA 4GMKA 1HNIA 4PXDA 1DQAA 5D4PA 4ZVHA 5IM0B 1B7YB 4P6QA 1W2IA 1F2HA 2UP1A 1HA1A 2Q79A 3RB6A 3L7PA 3BPSP 4ALZA 2VQEF 5MLCV 1TELA 3QATA 4K2XA 4Z7YA 5DETA 3CO9A 3EYZA 4M5IA 4XAKA 1ZPWX 2YWFA 1KWMA 3VWSA 3FMBA 2YNIA 1BWVA 3M8QB 1URNA 4LSLA 1N34J 1LFWA 4ID8A 2CQCA 1U26A 1BC6A 4ATNA 4FP9A 2CVEA 2GJ2A 2C3OA 3CCSS 2VG6B 3IAS9 2G0IA 2RUSA 2QL7B 1XIQA 1UEKA 1HNWJ 3OV7A 1VRUB 2BXJA 2AJFE 3UN2A 4HEA9 3PACA 3UN3A 3HKZD 1F5CA 4W98A 4I2QB 3HHLC 4QWCA 3TP2A 3M7VA 4WBFA 4NLXA 4OI4A 1S5ZA 4P52A 3A8JA 5SZTA 2MY7A 5KT2A 3FCHA 4ZCIA 2CDRB 1M5OC 2B8QA 1R8CA 1DTTB 3D68A 1I6JA 3M2VB 2B4UA 3MM6A 2OPPB 3IBFB 3KK1B 1C0UA 5B09A 1M5PC 2E1AA 4B3RJ 2DISA 4WE1A 1FKOA 2DNZA 1FT8A 2O01C 1ACMB 3I4PA 3Q83A 4LR7A 1RLCL 3NS6A 1WHWA 1NJIT 3S7RA 1LK5A 4YR3A 2AD9A 1ICEB 1SC3B 1S4EA 4C8LA 4OLPA 3AD9C 3CGIA 2RQMA 3EXYA 4JI0F 4XK8C 3FK4A 1U6ZA 2B7BB 5J2NB 1S9EB 1RYRA 3A13A 1GXLA 1DURA 4KT0C 1Q1KA 4U67Q 3M6WA 3UN5A 3DHXA 3KLHB 2LQJA 1TKTB 4I7FB 1WEZA 2IY5B 2CPHA 4KHPJ 4OYIA 1RAGB 1XTZA 2RRNA 1S1VB 4OYWA 1RYSA 2F40A 2NLWA 2FLNA 3MCMA 2EVZA 3AXKA 1RKJA 2ASJA 4B3OA 3WC0A 1AA1B 1T9WA 1RT4B 3P5TL 1HWLA 1YJRA 1UJ4A 3POTB 2W9CA 4PWDB 4ES2A 5DJBA 2FC8A 2CPDA 3K0JA 4JI5F 4OX9F 1RTDB 5L46A 4X84A 5K14A 2Y1IA 3KHGA 4ZJQA 1PJ5A 2J76E 3QGPA 2ALZA 2CPYA 1TZ0A 3L7UA 1WHXA 3MAQA 3QJPA 4KFBB 4DR5J 1PGZA 1LWEA 1UP1A 4TY8A 2W9AA 3W7BA 3QFHA 2V8GA 4L74A 3UD5A 5BR8J 3TZWA 4AXIA 3FSYA 1NM2A 3THVA 1OY6A 2VF3A 3OTDA 5HLFB 5B0CA 3SCLE 1U0SA 2YBVA 3CCRS 3TAMB 6FD1A 4DV6F 5J2QB 2HQCA 2DY9A 1WTBA 2DGVA 4B3MF 1P6TA 1U24A 2MSTA 2V34A 3FDSA 5GADU 4LQ9A 3LW5C 4TNOA 5L1LA 3IWXA 2PD1A 2HWHA 1A9NB 4PG5A 3V6DB 3RUBL 1L3KA 3W9HA 2CUYA 4DU8A 2GIFA 2HNYB 1U8WA 3I5AA 1FRMA 2R8IA 2FJAB 3MR7A 4LF4J 3AA9A 4JV5F 1RWOB 1UTAA 2WW4A 4RPFA 2HURA 2C2DA 3DCAA 1JB0C 1SKSA 2YKMB 1ROFA 2OJ3A 5HBMA 2UU9J 3LWMA 2VHGA 3LPEA 2AEMA 3DI6B 3SZ2A 3AY0A 3DRSA 4DF8A 2MGZB 1S9GB 2JX2A 2QFIA 1HIYA 1VQ5S 4MIWA 1KEKA 1HWIA 2XGQA 1E6VB 4KV8A 2YKAA 3HT3A 3K59A 3KK2A 3H5SA 2CQ2A 4IH6A 3A12A 2AEFA 2CRLA 1ZAWA 1UJ5A 2KH9A 4YOEA 3CD7A 1B0PA 3R2CJ 2ILZA 4F7VA 1NJXA 4FVCA 3IR7B 2VFRA 1D3WA 1WOSA 4JV2A 2G0CA 2VKZG 3BO2A 2D74B 1VQ4S 2JFKA 3QIDA 3QRPA 4KHRA 5GAGU 2FGCA 1H7WA 5I4MA 3M8PA 1Y5NB 3K5NA 3JQJA 3HZEA 2DNNA 5AJ3J 4NWBA 1H72C 3D5MA 3K8WA 3VGUA 3A3PB 3CD6S 1H0HB 3AOCA 3TO8A 2QA4S 2IVFB 2PI4A 1RT7B 2DBBA 4C2MA 1IKXA 2CJBA 3H7HB 2PO4A 1GK8A 4YB1P 4H4OB 5LJ3Y 5CYMB 4M5DA 5ETMA 3OR1B 3EPGA 2Z2MA 3IS9B 4DR1J 3G6YA 5KG2A 2GIRA 5JJBA 3K5PA 4CH0S 4AQYJ 5D4LA 3F56A 2X51A 5F8MA 3PYGA 3JTPA 3DLHA 3A1YG 2JC0A 2MZ1A 4F36A 1KKHA 2HFVA 3NNCA 3HPOA 1S57A 2VDHA 1CULB 4WFBQ 4HHUA 1T9TA 3GQCA 2NS1B 3CIZA 3TJAA 1SL1A 2B0GA 4ZPVR 4X4TA 2GMLA 4A8XA 2C2RA 5BXIA 3QO9A 1SJRA 3FCVA 4A8OA 2FLPA 1TVRB 4U7UK 3RAQA 3QIPB 1IQTA 3KJVB 1CC7A 1S1TB 3MI7X 4A8FA 4ZPDA 2ERRA 3FNNA 3NCPA 2HBRB 4X4NA 4HKQA 1KONA 3UCGA 3I0RA 1G4CA 4YY3F 1Q95G 1HBNB 1IXKA 4AL6A 2VPYB 4DV5F 5D3GB 2IRYA 3BGRA 4C48A 2AGOA 2HZCA 4LF8F 4DFMA 1VI7A 3B8HA 4U8YA 3CJTA 2BBEA 4LF6J 2UVVA 1S0VA 1S6PA 4CH7A 1HQEB 3PTWA 5KFJA 1H6KX 3BGUA 1HNVA 3GV5B 4IH7A 3LPYA 1LEOA 5HROB 2DYAA 3L4BC 2BDPA 2Y3YA 4OX7A 4PQUB 2CQHA 5CQGA 2KYXA 2VJUA 1HNXJ 5IT4A 3CUNA 2FC9A 1GEHA 1YWXA 1GX5A 3KLIA 1IR1A 1P1LA 3ENVA 3MM9B 2QEXS 2XWYA 4DV2J 3SSSA 3PX0A 3T6JA 2Z2YB 2MZRA 4RW8A 1WSRA 2JDJA 4OMFG 3SSQA 2LU2A 4PYDA 3TOQA 2IJRA 3OXLA 3D4JA 1CVJA 1HBUA 1FTRA 1T11A 3OUYB 5D0EA 5F3TA 2BOPA 2HS4A 4PCQA 5A6PA 2AYBA 1VRQC 3BQ2A 3AB2B 2PEHA 2DEIA 5L9NA 1N0UA 3CCLS 2BJ8A 4OYBA 3UNGC 4ZPBA 2HVDA 3K5OA 4MMOA 5HQ8A 2I5JB 4X66F 1IN0A 3SCKE 3ZZYA 2UVWA 4KE5A 2MDAA 2XBPA 5HQMA 5K5MA 3KJNB 3LP0A 2IYGA 3PX4A 1N48A 2M8HA 2UUCF 4MIAA 1D9FA 2H51B 3BZQA 4K8RA 4DR7J 4EMDA 2CPIA 2H54B 1W7WA 3BO3A 2RRBA 3CDEA 2XMUA 1ELOA 1TKDA 4FBTA 2AV5A 1YHQS 2RJZA 3OBIA 4Y28C 2G2OA 1VQ8S 3I5CA 1JLBA 2H4WB 1YJWS 3KDOA 2DGWA 5J1NA 1AFJA 2GNKA 3HVAA 1VS3A 3NG8A 1URRA 4UY85 3MM5A 2BUNA 2HK2A 3UD3P 3H20A 4RW9A 2VB6A 3CMQA 4U95A 3ZZZA 2DXDA 3QGHA 3OFEA 5A2QU 5H1SV 2RRAA 4DUTA 2L9WA 1JLCA 1UWBB 4E8UA 3H0PA 4K5RA 1S99A 3E3XA 4ECRA 3NAHA 4H4KC 4Z2XA 4NLRA 4P74A 4LSNA 2PI5A 3EVMA 3IRXA 3ZC4A 4F4KA 2I6WA 1JX4A 4RBUA 4M5NA 3ICLA 4J9LA 2DO0A 3RTVA 2AMCB 2D3UA 3CIMA 3TX0A 2DY1A 3TA0A 1ZA1B 1NSQA 2DGXA 1X4DA 2V8HA 5C42A 4QR0A 4Q0BA 4IRKA 3SFUA 4KO0A 4I68A 1KVJA 4OZLA 1WKLA 1LV5A 2XS7A 3FEXB 5A2QY 5LOQA 4UOGA 2GX8A 4O23A 1QLNA 1QSSA 3PIPQ 1JLFB 3SCJE 3T5LA 1S4FA 1LW2A 3BN7A 3T9ZA 2KB2A 5L1JA 1T3OA 2CJAA 1YX2A 2MLYA 3W9JA 3W8PA 1T9XA 5EN1A 4K4VA 1NHVA 4DDFA 4DLEA 1HWJA 2A18A 2XY6A 4C3LA 3K5LA 5H9EK 1FX2A 3EM1A 4I2PB 2LECA 1HYSB 4QCLA 1VQ7S 1TV6A 1EHWA 4LBIA 4OHZA 5I42B 1OMSA 1QSLA 3QMQA 5B0GA 3LGNA 3G96A 4IFYA 5KFMA 3MR2A 4I6AA 1S0OA 4LFCF 4OL8A 3AJ1A 1KVIA 1NXIA 2AWZA 2IAJB 1YG0A 4PG8A 5DDRC 2Z2LA 2VQEJ 1NUEA 3M8WA 2WAQD 1F9HA 1IKVB 3PFOA 2KRRA 3CTRA 3H8YA 2VA2A 2HHXA 2V63A 3B54A 1FO1A 3DRPA 3DFEA 4W92B 4D3GA 2NCKL 2V6AA 3HP6A 1TAQA 4LF7F 2B9YA 1FJ7A 4WP3A 2ZDPA 4EBCA 3QFWA 5DLFA 1SKRA 5HAOA 1X4HA 2OLWA 3WIVA 4RNHA 3CE8A 1QE1A 2RHSB 4CLZA 4OHWA 3OJSA 3B4MA 4K7QA 2LXFA 2PA8D 4ES3A 2QLBB 1WG1A 2CQDA 2KKHA 1UVKA 5KT4A 5B0FA 2I2YA 3QQCD 3OLAA 4MAKA 2BE2A 2IMWP 2ZHOA 4BBYA 3KLGB 2KZZA 2F3JA 3I4HX 1U09A 3VAKA 1CJVA 2UUWA 2KI2A 2JL9A 5CD4A 3CJKA 2KDOA 4OX8A 1SQEA 1KQKA 1F9EB 3DLGA 5DZ7A 4RO0A 3MURP 1FFSB 4MH8A 1N0VC 4A8YA 3D7SB 4MIBA 1S97A 5F9LA 3U27A 4OX6A 1YBUA 3QRQA 4TXSA 3DM2B 4FS2A 1FRJA 5JMNA 5E3AA 1T7PA 1T03B 4LRBA 4LFBF 1VOMA 2HHTA 2VIHA 1N36F 3US5A 4JI0J 2ZM6F 4M1KA 4EUVA 4DV3F 1HHSA 2MKIA 2V2ZA 5HMXA 2HLUA 2OUGA 4USJC 3K17A 5E3CA 1NK6A 4QWEA 3P8BB 2IM3A 2MZJA 3PNIA 2DH8A 2JWNA 3KXDA 5THWA 1RT6B 1XJWB 4J9RA 3MEKA 1HNIB 1SUQA 1HHTP 2EK6A 3W5XA 4ELTA 2Q6CA 2VPWB 2MZSA 5EWEA 3N79A 5IT0A 3HSGA 4LRAA 3PW0A 2ASYA 1M90T 2MZTA 3MZIA 2JOQA 1H38A 3CVKA 5K8OA 1MMDA 3NL0A 1VQ9S 3OR2A 4ECZA 2VFTA 3I9V9 2WRMA 4JI5J 4LSLB 4DV7F 3H90A 3LA0A 1MLAA 4TKTA 2HW3A 1I1GA 1EKSA 1VGYA 1OO0B 3ZTSA 3CJ4A 1ZTTA 2OP5A 4NLWA 2CPZA 3CDAA 3M2UB 3MUTP 1ZYQA 2ZOGA 4F8RA 5BYSA 3JSRA 4IQMA 4DPOA 3CCVS 3G2XA 2J5AA 3NCRA 1R7IA 2M3DA 1UPPA 3THTA 3DRXA 3BBFA 2DKOB 3MEDA 3I32A 4ZPWR 2R2SA 3HVWA 4DR6F 4B9VA 2MTLA 4RWXA 1EETA 2IPOB 3J7Z5 1YJ7A 4DQQA 2R7TA 1KR4A 3QPIA 3HD2A 2J0XA 3HHLB 2FPHX 4B3MJ 4IFVA 5J2PB 3W62A 1IQZA 5I3PA 1K44A 5C25B 3RBEA 1QSYA 2ROEA 2ZWOA 3LP2A 3DGVA 3F44A 2HFUA 2X1GA 1N5QA 1HI0P 4DOZA 1WHYA 4FF3A 1HMVB 1Q8IA 4WU2A 2OO4A 2MB0B 2DHAA 5LSOA 2BE9B 2XWXA 4MYTA 3PM9A 2QMXA 3JS9A 4JV5J 1RCXB 3JTNA 2I1RA 4M5HA 2VONA 4N8NA 2QFJA 3K2YA 4WYWA 4ED7A 2ZJQQ 1XQIA 1KFSA 5IC4B 4DV0F 3BSOA 2ZH6A 2G9OA 1FJCA 2F4VF 4DFJA 4I0WA 4NYPA 4JP8A 5B0EA 5H9FJ 2RVJA 2BVZA 4WIIA 4AUKA 3EXCX 2CNKB 2PIIA 2XMKA 4L73A 4ZP6A 2K1RA 2HQIA 2X3GA 5K14B 5FDLB 4ED5A 1PJ6A 4FXWA 3Q86A 3EGVA 5KFKA 2ZHBA 3DOKA 4J9OA 1LWEB 3HSJA 3KUEA 4RR5A 2V8DA 2HNZB 5I3QA 1VQ6S 2VG5A 3C8YA 2GVZA 3EWGA 4QIWD 4EU0A 3BDEA 2AQ4A 1SL0A 1YQHA 3G8TA 2K3KA 4UQGA 1TU0B 3TA2A 4TQSA 4OI2A 2CDQA 1UA1A 5CAAA 1NCLA 1VQLS 4MJKA 4ZP7A 5FD1A 3MCNA 4KH0B 2Q6BA 1L3TA 1X9MA 1PYSB 2KXFA 3N6MA 3GPAA 5CZVA 2BW2A 4NLTA 3UR3C 1RDRA 3DXBA 4YMEA 1TL7A 4FNIA 4TVAB 1L5UA 3BQ1A 2XTJP 4J9QA 2WB4A 1DAXA 5E7OB 1VRTA 2E9TA 3D3BJ 2PMZD 2UZAA 2BJDA 4DV4F 3DKDA 4MK9A 1S49A 4FF1A 4D3HA 4QBUA 4CIOA 3DRRA 1LWCB 4R8UA 2M52A 3J7YI 5LL6d 2J7UA 5E5NA 4B9UA 5HBMB 2BMBA 1U1LA 2NXCA 3ILJA 4Q5VA 1P8GA 1JIHA 3U7JA 3DRSB 1FRLA 4DPTA 2A0FB 2OD4A 5EX0A 3M2RA 1Z2ZA 5KFLA 3Q8PB 2UUBF 4WF9Q 1LOUA 4IR1A 1WC5A 4Y0FA 3E01B 3GFZA 3UI3A 5KG0A 5LMUF 3N0VA 4PPZA 4ZIVA 4CLTA 5MAOA 4DUZF 4A8KA 4M5JA 4KV8B 2XO6A 3NEKA 1V3RA 4YFUA 3G6XA 1T9YA 3M6UA 3M6XA 4DMZA 4G3IA 1IBCB 2OEMA 1UEUA 3KUGA 1M1HA 1VDHA 4HT5A 4CO3A 1LQ9A 3DLEB 1IKYA 3W3SA 1KFDA 4BC7A 1CC8A 2X1AA 2ZVSA 1WC1A 2BV3A 2P9EA 1RTIA 5C24A 5LMNF 5KFVA 3AOAA 4M95A 4FYVB 1IBKJ 3PXGa 1NEEA 2YX4A 1FE0A 2MKHA 4FXDA 1N5YB 3ONQA 1XMOJ 3NCQA 2Z8QA 4ZLNA 3UE2A 5J2MA 4ILMA 2E5IA 4EZ9A 3BR8A 2G1DA 1VFJA 1RBOB 2XLIA 3D54A 1U6FA 4C0HA 3KHLA 3EVWA 7FD1A 1IKXB 2RKIA 4X4QA 1PC5A 1S6OA 2R3VA 2KFNA 2D9PA 3G82A 4M5DB 3V4IA 2F8EX 2EFPA 2XI2A 3AFGA 1F0XA 4RUBA 4RU2A 2BM0A 3U02A 4X66J 4YP3A 3MPWA 3LH2S 2Y0BB 1FFWB 3W5ZA 1JXLA 1PC4A 2B4VA 1UZDA 4FYYB 2R2UA 3N5FA 1VHFA 1VISA 2HGNA 4O3QA 3IA0A 3MM8A 2UUCJ 1ZM2A 4MK8A 2YQ1A 4NEYA 2J7WA 2B6AA 3QO9B 1TKZA 2JLEA 1L3SA 3HFKA 4PQAA 5BJRA 5D78A 3V6HA 3KDNA 4QYZK 3MPDA 4WP9A 2OKQA 2KZMA 3DOLA 2HHVA 2ZOFA 3CD0A 2ZFHA 4RJVA 5D15A 4C98A 3Q24A 4P9SA 2B9EA 4TLRA 2AJ4A 1UVMA 4EK2A 2BABA 3MUVP 1GXUA 4ELVA 4LF2A 5K8PA 1HNVB 4LMZA 1U47A
chains in the Genus database with same CATH topology
1C0UA 1HL6A 3KLEA 5B09A 3CCES 3OR2B 1M5PC 1IBKF 2E1AA 3FVYA 2DISA 1RT5A 3CWJA 2HMIA 3H59A 2GO8A 4WE1A 1FKOA 1HBOA 3N5BA 4IDKA 2DNZA 1XMOF 1FT8A 4XO0A 3GYNA 2O01C 3I4PA 2PT0A 2XSJA 2HRYA 2CQ3A 4ZPCA 1R8HA 2QA1A 3EZ5A 4UQTA 3NNAA 4IQXA 3NS6A 1WEXA 1WHWA 3KLIB 4I64A 4M63A 1NJIT 1NKEA 3S7RA 3H40A 2YWGA 3KMSA 1DZ5A 3IG1A 5D4OA 1LK5A 1S0MA 1MSWD 2DNQA 3MHYA 4YR3A 1WG4A 2LA6A 1FD8A 1R8AA 2MKJA 2AD9A 4KR0B 2FLLA 2KFZA 3BGFA 5CA5A 1KSPA 2NPFA 2DH7A 3VAMA 4RW8B 4C8LA 2EBGA 4OLPA 5E3PA 3BF4A 1BQNA 4F3QA 3O5TB 2JEFA 2R2TA 5EWGA 3CGIA 5KG1A 5KFYA 2RQMA 3GMGA 3EXYA 4KC5A 4JI0F 1HBUB 1S72S 4XK8C 1KHWA 5G0RA 1U6ZA 3CF5Q 2Q1LA 4YR2A 2B7BB 5J2NB 1S9EB 1RYRA 1HPZA 2RH3A 1GXLA 5KFUA 3MEDB 1TL5A 4RW4A 3O2IA 1DURA 4KT0C 2N7YA 3QWPA 5CYQA 4HTJA 1Q1KA 3Q22A 4O0IA 5B0DA 2PC6A 4U67Q 1EETB 3M6WA 2F8MA 3DHXA 3MMJA 4DEZA 3KLHB 4LVNP 2RDIA 2LQJA 3R5DA 1TKTB 4I7FB 2OAUA 3RBDA 2K7JA 4DR2F 3TAPA 2BANA 1WEZA 2YNGA 4YQWA 2CPHA 2QE5A 3PW7A 2FJVA 5F9NA 4JOUA 2V4JA 2ADCA 2PMHA 2DR8A 2DNOA 5E2QA 2EI5A 4OI1A 1XTZA 3JAMY 5DG8A 4RNOA 3G8SA 4O44B 4ETXA 4DJBA 3GR0A 3MD3A 3GWCA 2RRNA 2ZKUA 1S1VB 2FLNA 1RYSA 2F40A 2NLWA 2EC0A 1R89A 2JRSA 3W2VB 2DGOA 4KHMA 1N34F 2EVZA 3TR5A 1RKJA 3VAIA 5HP1B 4DFPA 2AYGA 2ASJA 4JYAF 1KQFB 4B3OA 4URSA 3WC0A 1DLOA 4O3OA 4J9NA 1RT4B 1RQ0A 3P5TL 1HWLA 1PILA 1VBYA 3LP2B 1YJRA 1UJ4A 3PFEA 3POTB 2W9CA 2CQ1A 2DNRA 3CCMS 1UWBA 1HNWF 2C22A 4PWDB 4ES2A 1F60B 5DJBA 2FC8A 5EUHA 5HO4A 5A8KB 1VK3A 1YSJA 2CPDA 4J37A 2GFFA 2LEBA 1Y5LB 2ZE2B 3K0JA 4ZOSA 4JI5F 3TUZC 4CH1A 4DWIA 3WX4A 4ZP8A 4OX9F 3SQGA 2OIHA 3NP5A 2KN4A 4FN5A 1RTDB 4C0OC 4HL9A 1L3UA 2YKNB 4V19X 4X84A 2DTJA 5K14A 3U1MA 3KK3A 1DQ8A 1QVGR 3ZZOA 2Y1IA 4AL5A 4K4YA 3KHGA 1YRUA 2GMHA 5CCMA 1T95A 2B4PA 2L48A 3GIKA 4HDGA 2MKSA 2Y1RI 3SCIE 2J76E 3H98A 2RQ4A 3QGPA 3AQPA 3H2UB 5AXNA 2CPYA 2ALZA 1TZ0A 3VR1A 1WHXA 4JI3F 4FS1A 3MAQA 4X2BA 1D8ZA 2VL1A 3R3TA 1GX6A 1R43A 1L3VA 2FVPA 3QJPA 1JLBB 4KFBB 5KFQA 1PGZA 4KBIA 1LWEA 1K0TA 2KXNB 1UP1A 2M9KA 4QYRA 5K9FA 5M2PA 3CC2S 4CTAA 4NYOA 4TY8A 3RRKA 3MMAB 3DLKA 1U6BA 3MM5B 1RISA 2W9AA 3W7BA 3HHDA 2ZZMA 2V8GA 3OXGA 3NLCA 2MPUA 3MUMP 2HGLA 1RGVA 3N01A 2DCUB 1FRHA 5KFGA 1T05B 4A8MP 1EP4A 4RW9B 4RUHA 3I0SA 3UQSA 3NWGA 2MY8A 3D2WA 4AXIA 2QA4G 2YNFB 2MQPA 4ECVA 2XB2D 3N28A 1YIJS 3BSNA 2D41A 2JEJA 3FSYA 3THVA 2YKPA 4C0BA 4C97A 3V4MA 3BREA 3R5BA 4F02A 2JH3A 5C5JA 3ZFVA 3OTDA 5HLFB 1KOOA 1S48A 5B0CA 3SCLE 3LAMA 2ZZNA 1Y5IB 2CG4A 3CCRS 4DG1A 3TAMB 5ITHA 2CQPA 1JLFA 1G3OA 2LXIA 3ENWA 4AFFA 3NMRA 4NRUA 6FD1A 3T5HA 3HVRA 4DV6F 3DYAA 5J2QB 3HI9A 2RMLA 1FK9B 2HQ3A 2WB1D 2FIUA 4HH0A 1FE4A 3MD1A 2DPIA 5CHCB 1UW4A 2DNYA 4DLGA 2OPQB 1IKWB 2K1RB 1FDAA 1S76D 5DG7A 1O0PA 2A2DA 3I96A 3UDCA 1XK8A 5KOXA 1WTBA 2DGVA 4GC7A 5G4DA 2KJWA 5GMKa 1U47A 2LVWA 1LFPA 5SUHA 2R4FA 5JXSA 3G6ES 1J5OB 4B3MF 4WFZA 3IRXB 5M2UA 4IKAA 1P6TA 1LXJA 4LJMA 1U24A 2MSTA 3IBWA 3FDSA 1LWFA 2XY5A 1ZH5A 5GADU 2ZHAA 2V94A 4LQ9A 4R0JA 1X8DA 3TYTA 3LW5C 2XULA 4TNOA 3BB5A 2QA2A 5L1LA 3IWXA 1QUPA 3IWNC 2PD1A 2HWHA 1CEZA 4IO1A 2FJDB 4ZHRB 1A9NB 2XLKA 1N52B 1U8SA 4Q45A 2NXUA 2FD2A 1FEHA 2XSFA 1WHVA 3BS9A 3TANA 1QVFR 4DQSA 4R5PA 1XNQF 4Y2CA 1N56A 2EFOA 4PG5A 3OW2R 1U1KA 2V0NA 5C42B 2VG5B 3V6DB 4UY8T 4N8OA 5IFMA 3OHAA 4KHPF 1L3KA 2P6TA 3OFHA 4CNZA 2ZH4A 2H5EA 1JKHB 4F4ZA 2YWKA 4DSIA 2W25A 2HNYB 5LXRA 3I5AA 4B02A 1FRMA 2XY7A 4C4WA 2R8IA 2FJAB 4IOBA 1X5PA 3L09A 3V6KA 1ZZNA 1R0AA 3JYTA 5F3ZA 3AA9A 4JV5F 2HHHF 4O3PA 3O44A 1FHTA 4NLQA 5KT7A 5CH7B 2C2DA 3KWMA 1OQ6A 4HYKA 3DCAA 1JB0C 2G4BA 4QPXA 2YY3A 1SKSA 2YKMB 5KFXA 5CD4H 2W9BB 2EK1A 1ROFA 2OJ3A 2RT3A 5HBMA 3VF0B 5A8WA 3LWMA 2IC3A 3DI6B 3FSIA 2GV1A 1KTQA 1N8RT 1RKIA 2F9JA 5KT3A 3SZ2A 4JV0A 1JLAA 3AY0A 2XZWA 3DRSA 2CJQA 2M8DB 1XR6A 4DF8A 3C6UA 4IO9Q 3LQVA 1N6QA 3JTOA 2XMJA 3TRGA 2MGZB 3F41A 3WC2A 3AA8A 1YVFA 1S9GB 2JX2A 3K8VA 2A2CA 4CCHA 4F3OA 2PSZA 1NK9A 2CPFA 3KFWX 1YJTA 1IUJA 3CEDA 4FVMA 2M2BA 4WZMA 1VQ5S 2L9DA 2WCXA 2B9WA 4PXEA 1B7FA 4MIWA 1KEKA 1SJ4P 3SDEA 1T02A 1HWIA 5DQGA 1UVNA 2IVMA 2XGQA 1QAIA 1X4GA 1E6VB 2DT9A 2MZQA 4KV8A 2VG7A 3EGWB 3MTKA 1FVQA 2YKAA 4GKKF 4IH5A 1F2GA 1VRTB 4DBQA 1X9WA 3HT3A 1GAOA 3K59A 3JSMA 2XC9A 1P9QC 4WYLA 3GV8B 2BYCA 3H5SA 3KK2A 2CQ2A 4IH6A 1FKAF 5D4NA 2CRLA 2M70A 4HI2A 3HKWA 2XMTA 1RT3B 4YDDB 1ZAWA 4IFYB 1UJ5A 2LU1A 2V2KA 4ZCMA 2KH9A 3DRRB 4YOEA 4U9RA 3FFIB 3CD7A 3OL9A 1B0PA 1REVA 5KFZA 3J80Y 4QWAA 4N56A 2ILZA 3W2WB 1WTFA 3SXLA 5GAHI 1JMTA 4URGA 2ZOMA 1NJXA 4FVCA 3IR7B 4DSKA 2MKCA 2VFRA 2KU7A 1D3WA 1FJEB 4MK7A 4JV2A 2W8LA 1H7XA 2G0CA 2VKZG 3BO2A 2D74B 1VQ4S 1NH7A 1SJQA 4R25A 4BWMA 2OMOA 2JFKA 4F2RA 3QIDA 2LEAA 2IJNA 4KHRA 1X5OA 3CXCR 2SXLA 5GAGU 2HFNA 2HWTA 2FGCA 4H54A 4IG3A 4CO2A 3QZ8A 1FF2A 1T3NA 1H7WA 5I4MA 4FZVA 3M2RB 3M8PA 3RR7A 3TNVA 1HARA 1Y5NB 1YJUA 3LOUA 2X1FA 3M9MB 3K5NA 2EWHA 2OPSB 1RT1B 2EW9A 4G1QA 2BJEA 2V5HG 2LCWA 4YB6A 3FQKA 3MM7A 1OPIA 2DNNA 3HZEA 4EYHB 1SL2A 2XS5A 4NWBA 3VALA 3CSKA 5F8NA 3HK2A 3I55S 3Q23A 3D5MA 1XN9A 3K8WA 2NR0A 3BGLA 2WTFA 2E66A 4ERDA 1SC6A 1K1SA 2R7WA 2A3JA 3CB4A 3CD6S 4C8OA 1H0HB 1JK9B 4QU6A 2BRLA 5GAHU 5ADZA 2MQOA 3MFIA 2GW8A 5KG3A 3TO8A 2IVFB 2QA4S 4EBDA 2PI4A 2R8GA 1RT7B 2DBBA 2QV6A 4C2MA 1IKXA 1QE1B 2CJBA 4O4GB 2B9XA 2PO4A 5DGAA 4DL6A 3KLFB 3RRHA 1C0TA 2JEGA 3DM2A 1HFEL 4A47A 4PR6A 1WF2A 4YB1P 4H4OB 1T03A 4F67A 5LJ3Y 2W4PA 5CYMB 4X65F 3N6NA 2DGSA 4M5DA 5T7LB 3OR1B 2ZH7A 2OPRB 1FDBA 3D0HE 5J1EA 3EPGA 4ID5A 2V9KA 1U48A 2Z2MA 3IS9B 5IM0A 1QY7A 3CJ2A 3QYYA 4WU3A 3G6YA 3MOZA 3EX7B 2WSFC 3OHBA 5KG2A 2GIRA 5JJBA 4DL7A 3K5PA 4CH0S 2HNDB 1IKYB 2HS0A 3KMQA 1H2TZ 1FNMA 5D4LA 1F5BA 2DHGA 3F56A 3Q8RB 2J6UA 3PJXA 2X51A 1FJGF 1X0PA 1NJYA 1TKXA 2AF6A 4X4VA 2LQ9A 1RTIB 3V5RA 5F8MA 3I87A 1RT6A 1TL1A 3JTPA 1YBAA 3IFEA 2DIUA 5KFIA 2YNHB 3DLHA 1GTEA 3A1YG 2O67A 5KFCA 3L7OA 2BA9A 2JC0A 1RTJB 3MEEA 2MZ1A 4OI6A 2KRBA 4R0EA 4TY9A 1TFWA 4Z37A 1GTHA 4ILRA 4DQRA 3NNCA 1T8EA 2NQPA 3HPOA 4EO8A 4CT9A 4LQ3A 2XG8A 4QW9A 4ICLB 2N82B 5J2MB 4WFBQ 4E0DA 4WKRA 3P49B 3GQCA 2NS1B 1UVIA 2VBXA 3CIZA 3M8QA 5JVGQ 3T1HF 3EZUA 4NCGA 2B0GA 1WELA 4ZPVR 4X4TA 2GMLA 4A8XA 3GV7B 1S6QA 2C2RA 3QO9A 1UEVA 1HI1A 1SJRA 3QLHB 1T94A 1C1CB 3D1QA 4A8OA 2KG0A 3G6VA 2FLPA 1FTCA 1TVRB 4U7UK 3RAQA 2E5LF 3QIPB 3M30B 5KFNA 2P6SA 2VG6A 1DTQA 1IQTA 2C28A 2IBOA 3ZZUA 4K4XA 1G7CB 3GFHA 4OJGA 1ULRA 4NZ0A 1CC7A 3KJVB 3SEOA 4G6VB 1S1TB 2Q66A 3MI7X 4A8FA 2A1BA 2O1PA 4ZPDA 4MYUA 3QAEA 2ERRA 3FNNA 2MJNA 4AYBD 3EPIA 3NCPA 5LJ5Y 1R6YA 3M8RA 4I4BA 4HKQA 4X4NA 1KONA 3UCGA 1NK7A 2FDNA 5LXYA 2CJKA 4QWBA 1G2EA 1ZAXA 3C6TA 2OMLA 3I0RA 4OQJA 4YY3F 5F8GA 1HBNB 1IXKA 1WG5A 3I31A 2R7SA 4AL6A 3M32B 2CPJA 2VPYB 4DV5F 5D3GB 1S77D 2MMYA 2IRYA 2O66A 3BGRA 4EBEA 1VQNS 1M0SA 2GGPB 3GYXB 2KXHA 4C8KA 2AGOA 2HZCA 4LF8F 4DFMA 1VI7A 3B8HA 3M2UA 1B0TA 4WFXA 4Y65A 2I0XA 3H25A 2BBEA 1NK0A 2DNPA 2UVVA 1S0VA 3RB3A 1S6PA 4CH7A 5KFFA 1X4AA 1HQEB 2ATLA 1RI7A 5KFJA 1H6KX 3BGUA 1IJEB 1HNVA 4Y34A 2AYEA 3C66A 4DHVA 4X4OA 3HMJG 3GV5B 1TK5A 4IH7A 3LPYA 4K4UA 5HROB 2UUTA 1U4BA 2E7XA 2J7KA 2CYYA 3KK1A 2BDPA 2R7RA 1HW9A 1KOHA 1NAQA 4OX7A 4PQUB 2CQHA 2YH0A 5CQGA 5CZXA 2DR9A 1JLEB 2KYXA 5GVQA 2YNIB 2CPXA 2N3LA 5IT4A 2B6AB 2ASDA 3EGZA 3DU6A 3GILA 2RF2A 3CUNA 1TKZB 4B3TF 4DQPA 3TARA 2FC9A 3MTJA 2MKKA 2J6TA 3RW6A 2WONB 1QJHA 1H2UX 2DK2A 4Q2MA 5AE3A 5A6WA 3PX6A 1YWXA 1IR0A 1HW8A 2RQCA 1KRPA 3MXHP 1GX5A 3CC4S 3KLIA 1P1LA 3PRDA 3ENVA 2DRAA 4ZA1A 3MM9B 1LKZA 3DOLB 4RW7B 2QEXS 2XWYA 2HHUA 2DVIA 4I67A 1YJVA 3UFCX 3SSSA 3PX0A 2DRBA 2E1MC 2MQLA 3T6JA 3R1HA 2MZRA 5DS7A 2XGPA 3CCQS 4DSFA 4RW8A 2KG1A 2JDJA 2DJWA 1SB6A 1CQMA 4PUOB 1KN6A 5E3RA 5L1KA 2UXBF 5D8HB 4OMFG 3SSQA 2LU2A 3HHLA 4RBTA 3TOQA 3U1LA 3V81B 1R3NA 1QAJA 4Q8EA 2Y0SD 3OXLA 4OFZA 3OVSA 2FTRA 2NUUG 2W7AA 4GO5X 1CVJA 3G71S 2R7QA 3FEZA 2IA6A 3MF5A 1NRKA 5J2PA 1HBUA 1FTRA 2ZUGA 3OUYB 5C25A 5F3TA 2BOPA 4KPYA 5J2NA 3PRBA 2HS4A 2ZNYA 4PCQA 5A6PA 3Q2SC 2AYBA 1VQYA 3AB2B 2O3DA 1U2FA 3BQ2A 2KHCA 4M94A 2EKYA 1NJWA 1KLMB 2PEHA 1Y7PA 1F9FA 2D1CA