2NUKA

Soluble domain of the rieske iron-sulfur protein from rhodobacter sphaeroides
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
b'LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 36
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nukA00
1O7NA 4QURA 2I7FA 3H1LE 2DE6D 3C0DA 4NB9D 2GBXA 3L74E 3GTSA 4NBAD 4NBHD 2YVJB 4EMJB 2A06E 2HMLA 3CXHE 4HM0A 4OGQD 4HKVA 2ZYLA 4NBDD 4P1BH 4U3FE 1KYOE 2FYNC 3L73E 1SQQE 5AEWA 3H1JE 4HM3A 4H44D 2XSHA 4QDFB 3VMID 1P84E 3FOUA 2CKFA 3L70E 4HM5A 2D2CD 4QDCA 4HM1A 2B1XA 1SQBE 5KLVE 2HMKA 1NTZE 5KKZC 2YFIA 4NBFD 4HM2A 1ULIA 4QDFA 4NBCD 2XR8A 2DE7D 2YIUC 2E75D 1RIEA 2YFJA 1EG9A 1O7MA 2HMJA 2YFLA 2XSOA 5AEUA 3L72E 4H13D 2NVFA 3AZCA 1KB9E 2HMNA 2Q3WA 1VF5D 2JO6A 2ZT9D 2E76D 2NVGA 2NVEA 2DE5D 1Q90C 2BMQA 1G8KB 1SQXE 3GZYA 1NTKE 1O7GA 2IBZE 4NB8D 3CX5E 1EZVE 1SJGA 2QJKC 3D89A 1NYKA 3H1KE 1BCCE 4QUPA 1ULJA 2JZAA 4HM8A 1O7WA 3L75E 4HM6A 4QDDA 3GZXA 4P1CH 4NBBD 1O7PA 5KLIC 4PD4E 1RFSA 4PV1D 4AAYB 2XRXA 2QPZA 3CWBE 5CXMA 1JM1A 4HM7A 1BE3E 1PP9E 4QUQA 1WQLA 2E4PA 3TGUE 2BMOA 1L0NE 3GOBA 4H0LD 2NUKA 3GB4A 1ZRTE 1L0LE 3VMHD 2B24A 3EN1A 1NU1E 4AIVA 1UUWA 2GBWA 2E74D 1SQVE 4NBGD 1NDOA 1PPJE 2E4QA 3VCAA 2BMRA 3EQQA 1FQTA 3H1HE 3N0QA 3L71E 2QJPC 2NUMA 3DQYA 5HL4A 4HJLA 5BOKA 3BCCE 4QCKA 1VM9A 2QJYC 2FYUE 3GL2A 2HMMA 3VCPA 3GCEA 3H1IE 1G8JB 3GKEA 1O7HA 1SQPE 4NBED 1NTME 1UUVA 4HM4A 1VCKA 3GTEA 3VMGD 3GL0A 2NWFA 2HMOA 2BCCE
chains in the Genus database with same CATH superfamily
1O7NA 4QURA 2I7FA 3H1LE 2DE6D 3C0DA 4NB9D 2GBXA 3L74E 3GTSA 4NBAD 4NBHD 2YVJB 4EMJB 2A06E 2HMLA 3CXHE 4HM0A 4OGQD 4HKVA 2ZYLA 4NBDD 4P1BH 4U3FE 1KYOE 2FYNC 3L73E 1SQQE 5AEWA 3H1JE 4HM3A 4H44D 2XSHA 4QDFB 3VMID 1P84E 3FOUA 2CKFA 3L70E 4HM5A 2D2CD 4QDCA 4HM1A 2B1XA 1SQBE 5KLVE 2HMKA 1NTZE 5KKZC 2YFIA 4NBFD 4HM2A 1ULIA 4QDFA 4NBCD 2XR8A 2DE7D 2YIUC 2E75D 1RIEA 2YFJA 1EG9A 1O7MA 2HMJA 2YFLA 2XSOA 5AEUA 3L72E 4H13D 2NVFA 3AZCA 1KB9E 2HMNA 2Q3WA 1VF5D 2JO6A 2ZT9D 2E76D 2NVGA 2NVEA 2DE5D 1Q90C 2BMQA 1G8KB 1SQXE 3GZYA 1NTKE 1O7GA 2IBZE 4NB8D 3CX5E 1EZVE 1SJGA 2QJKC 3D89A 1NYKA 3H1KE 1BCCE 4QUPA 1ULJA 2JZAA 4HM8A 1O7WA 3L75E 4HM6A 4QDDA 3GZXA 4P1CH 4NBBD 1O7PA 5KLIC 4PD4E 1RFSA 4PV1D 4AAYB 2XRXA 2QPZA 3CWBE 5CXMA 1JM1A 4HM7A 1BE3E 1PP9E 4QUQA 1WQLA 2E4PA 3TGUE 2BMOA 1L0NE 3GOBA 4H0LD 2NUKA 3GB4A 1ZRTE 1L0LE 3VMHD 2B24A 3EN1A 1NU1E 4AIVA 1UUWA 2GBWA 2E74D 1SQVE 4NBGD 1NDOA 1PPJE 2E4QA 3VCAA 2BMRA 3EQQA 1FQTA 3H1HE 3N0QA 3L71E 2QJPC 2NUMA 3DQYA 5HL4A 4HJLA 5BOKA 3BCCE 4QCKA 1VM9A 2QJYC 2FYUE 3GL2A 2HMMA 3VCPA 3GCEA 3H1IE 1G8JB 3GKEA 1O7HA 1SQPE 4NBED 1NTME 1UUVA 4HM4A 1VCKA 3GTEA 3VMGD 3GL0A 2NWFA 2HMOA 2BCCE
chains in the Genus database with same CATH topology
1O7NA 4QURA 2I7FA 3H1LE 2DE6D 3C0DA 4NB9D 2GBXA 3L74E 3GTSA 4NBAD 4NBHD 2YVJB 4EMJB 2A06E 2HMLA 3CXHE 4HM0A 4OGQD 4HKVA 2ZYLA 4NBDD 4P1BH 4U3FE 1KYOE 2FYNC 3L73E 1SQQE 5AEWA 3H1JE 4HM3A 4H44D 2XSHA 4QDFB 3VMID 1P84E 3FOUA 2CKFA 3L70E 4HM5A 2D2CD 4QDCA 4HM1A 2B1XA 1SQBE 5KLVE 2HMKA 1NTZE 5KKZC 2YFIA 4NBFD 4HM2A 1ULIA 4QDFA 4NBCD 2XR8A 2DE7D 2YIUC 2E75D 1RIEA 2YFJA 1EG9A 1O7MA 2HMJA 2YFLA 2XSOA 5AEUA 3L72E 4H13D 2NVFA 3AZCA 1KB9E 2HMNA 2Q3WA 1VF5D 2JO6A 2ZT9D 2E76D 2NVGA 2NVEA 2DE5D 1Q90C 2BMQA 1G8KB 1SQXE 3GZYA 1NTKE 1O7GA 2IBZE 4NB8D 3CX5E 1EZVE 1SJGA 2QJKC 3D89A 1NYKA 3H1KE 1BCCE 4QUPA 1ULJA 2JZAA 4HM8A 1O7WA 3L75E 4HM6A 4QDDA 3GZXA 4P1CH 4NBBD 1O7PA 5KLIC 4PD4E 1RFSA 4PV1D 4AAYB 2XRXA 2QPZA 3CWBE 5CXMA 1JM1A 4HM7A 1BE3E 1PP9E 4QUQA 1WQLA 2E4PA 3TGUE 2BMOA 1L0NE 3GOBA 4H0LD 2NUKA 3GB4A 1ZRTE 1L0LE 3VMHD 2B24A 3EN1A 1NU1E 4AIVA 1UUWA 2GBWA 2E74D 1SQVE 4NBGD 1NDOA 1PPJE 2E4QA 3VCAA 2BMRA 3EQQA 1FQTA 3H1HE 3N0QA 3L71E 2QJPC 2NUMA 3DQYA 5HL4A 4HJLA 5BOKA 3BCCE 4QCKA 1VM9A 2QJYC 2FYUE 3GL2A 2HMMA 3VCPA 3GCEA 3H1IE 1G8JB 3GKEA 1O7HA 1SQPE 4NBED 1NTME 1UUVA 4HM4A 1VCKA 3GTEA 3VMGD 3GL0A 2NWFA 2HMOA 2BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7N A;  4QUR A;  2I7F A;  3H1L E;  2DE6 D;  3C0D A;  4NB9 D;  2GBX A;  3L74 E;  3GTS A;  4NBA D;  4NBH D;  2YVJ B;  4EMJ B;  2A06 E;  2HML A;  3CXH E;  4HM0 A;  4OGQ D;  4HKV A;  2ZYL A;  4NBD D;  4P1B H;  4U3F E;  1KYO E;  2FYN C;  3L73 E;  1SQQ E;  5AEW A;  3H1J E;  4HM3 A;  4H44 D;  2XSH A;  4QDF B;  3VMI D;  1P84 E;  3FOU A;  2CKF A;  3L70 E;  4HM5 A;  2D2C D;  4QDC A;  4HM1 A;  2B1X A;  1SQB E;  5KLV E;  2HMK A;  1NTZ E;  5KKZ C;  2YFI A;  4NBF D;  4HM2 A;  1ULI A;  4QDF A;  4NBC D;  2XR8 A;  2DE7 D;  2YIU C;  2E75 D;  1RIE A;  2YFJ A;  1EG9 A;  1O7M A;  2HMJ A;  2YFL A;  2XSO A;  5AEU A;  3L72 E;  4H13 D;  2NVF A;  3AZC A;  1KB9 E;  2HMN A;  2Q3W A;  1VF5 D;  2JO6 A;  2ZT9 D;  2E76 D;  2NVG A;  2NVE A;  2DE5 D;  1Q90 C;  2BMQ A;  1G8K B;  1SQX E;  3GZY A;  1NTK E;  1O7G A;  2IBZ E;  4NB8 D;  3CX5 E;  1EZV E;  1SJG A;  2QJK C;  3D89 A;  1NYK A;  3H1K E;  1BCC E;  4QUP A;  1ULJ A;  2JZA A;  4HM8 A;  1O7W A;  3L75 E;  4HM6 A;  4QDD A;  3GZX A;  4P1C H;  4NBB D;  1O7P A;  5KLI C;  4PD4 E;  1RFS A;  4PV1 D;  4AAY B;  2XRX A;  2QPZ A;  3CWB E;  5CXM A;  1JM1 A;  4HM7 A;  1BE3 E;  1PP9 E;  4QUQ A;  1WQL A;  2E4P A;  3TGU E;  2BMO A;  1L0N E;  3GOB A;  4H0L D;  2NUK A;  3GB4 A;  1ZRT E;  1L0L E;  3VMH D;  2B24 A;  3EN1 A;  1NU1 E;  4AIV A;  1UUW A;  2GBW A;  2E74 D;  1SQV E;  4NBG D;  1NDO A;  1PPJ E;  2E4Q A;  3VCA A;  2BMR A;  3EQQ A;  1FQT A;  3H1H E;  3N0Q A;  3L71 E;  2QJP C;  2NUM A;  3DQY A;  5HL4 A;  4HJL A;  5BOK A;  3BCC E;  4QCK A;  1VM9 A;  2QJY C;  2FYU E;  3GL2 A;  2HMM A;  3VCP A;  3GCE A;  3H1I E;  1G8J B;  3GKE A;  1O7H A;  1SQP E;  4NBE D;  1NTM E;  1UUV A;  4HM4 A;  1VCK A;  3GTE A;  3VMG D;  3GL0 A;  2NWF A;  2HMO A;  2BCC E; 
#chains in the Genus database with same CATH topology
 1O7N A;  4QUR A;  2I7F A;  3H1L E;  2DE6 D;  3C0D A;  4NB9 D;  2GBX A;  3L74 E;  3GTS A;  4NBA D;  4NBH D;  2YVJ B;  4EMJ B;  2A06 E;  2HML A;  3CXH E;  4HM0 A;  4OGQ D;  4HKV A;  2ZYL A;  4NBD D;  4P1B H;  4U3F E;  1KYO E;  2FYN C;  3L73 E;  1SQQ E;  5AEW A;  3H1J E;  4HM3 A;  4H44 D;  2XSH A;  4QDF B;  3VMI D;  1P84 E;  3FOU A;  2CKF A;  3L70 E;  4HM5 A;  2D2C D;  4QDC A;  4HM1 A;  2B1X A;  1SQB E;  5KLV E;  2HMK A;  1NTZ E;  5KKZ C;  2YFI A;  4NBF D;  4HM2 A;  1ULI A;  4QDF A;  4NBC D;  2XR8 A;  2DE7 D;  2YIU C;  2E75 D;  1RIE A;  2YFJ A;  1EG9 A;  1O7M A;  2HMJ A;  2YFL A;  2XSO A;  5AEU A;  3L72 E;  4H13 D;  2NVF A;  3AZC A;  1KB9 E;  2HMN A;  2Q3W A;  1VF5 D;  2JO6 A;  2ZT9 D;  2E76 D;  2NVG A;  2NVE A;  2DE5 D;  1Q90 C;  2BMQ A;  1G8K B;  1SQX E;  3GZY A;  1NTK E;  1O7G A;  2IBZ E;  4NB8 D;  3CX5 E;  1EZV E;  1SJG A;  2QJK C;  3D89 A;  1NYK A;  3H1K E;  1BCC E;  4QUP A;  1ULJ A;  2JZA A;  4HM8 A;  1O7W A;  3L75 E;  4HM6 A;  4QDD A;  3GZX A;  4P1C H;  4NBB D;  1O7P A;  5KLI C;  4PD4 E;  1RFS A;  4PV1 D;  4AAY B;  2XRX A;  2QPZ A;  3CWB E;  5CXM A;  1JM1 A;  4HM7 A;  1BE3 E;  1PP9 E;  4QUQ A;  1WQL A;  2E4P A;  3TGU E;  2BMO A;  1L0N E;  3GOB A;  4H0L D;  2NUK A;  3GB4 A;  1ZRT E;  1L0L E;  3VMH D;  2B24 A;  3EN1 A;  1NU1 E;  4AIV A;  1UUW A;  2GBW A;  2E74 D;  1SQV E;  4NBG D;  1NDO A;  1PPJ E;  2E4Q A;  3VCA A;  2BMR A;  3EQQ A;  1FQT A;  3H1H E;  3N0Q A;  3L71 E;  2QJP C;  2NUM A;  3DQY A;  5HL4 A;  4HJL A;  5BOK A;  3BCC E;  4QCK A;  1VM9 A;  2QJY C;  2FYU E;  3GL2 A;  2HMM A;  3VCP A;  3GCE A;  3H1I E;  1G8J B;  3GKE A;  1O7H A;  1SQP E;  4NBE D;  1NTM E;  1UUV A;  4HM4 A;  1VCK A;  3GTE A;  3VMG D;  3GL0 A;  2NWF A;  2HMO A;  2BCC E; 
#chains in the Genus database with same CATH homology
 1O7N A;  4QUR A;  2I7F A;  3H1L E;  2DE6 D;  3C0D A;  4NB9 D;  2GBX A;  3L74 E;  3GTS A;  4NBA D;  4NBH D;  2YVJ B;  4EMJ B;  2A06 E;  2HML A;  3CXH E;  4HM0 A;  4OGQ D;  4HKV A;  2ZYL A;  4NBD D;  4P1B H;  4U3F E;  1KYO E;  2FYN C;  3L73 E;  1SQQ E;  5AEW A;  3H1J E;  4HM3 A;  4H44 D;  2XSH A;  4QDF B;  3VMI D;  1P84 E;  3FOU A;  2CKF A;  3L70 E;  4HM5 A;  2D2C D;  4QDC A;  4HM1 A;  2B1X A;  1SQB E;  5KLV E;  2HMK A;  1NTZ E;  5KKZ C;  2YFI A;  4NBF D;  4HM2 A;  1ULI A;  4QDF A;  4NBC D;  2XR8 A;  2DE7 D;  2YIU C;  2E75 D;  1RIE A;  2YFJ A;  1EG9 A;  1O7M A;  2HMJ A;  2YFL A;  2XSO A;  5AEU A;  3L72 E;  4H13 D;  2NVF A;  3AZC A;  1KB9 E;  2HMN A;  2Q3W A;  1VF5 D;  2JO6 A;  2ZT9 D;  2E76 D;  2NVG A;  2NVE A;  2DE5 D;  1Q90 C;  2BMQ A;  1G8K B;  1SQX E;  3GZY A;  1NTK E;  1O7G A;  2IBZ E;  4NB8 D;  3CX5 E;  1EZV E;  1SJG A;  2QJK C;  3D89 A;  1NYK A;  3H1K E;  1BCC E;  4QUP A;  1ULJ A;  2JZA A;  4HM8 A;  1O7W A;  3L75 E;  4HM6 A;  4QDD A;  3GZX A;  4P1C H;  4NBB D;  1O7P A;  5KLI C;  4PD4 E;  1RFS A;  4PV1 D;  4AAY B;  2XRX A;  2QPZ A;  3CWB E;  5CXM A;  1JM1 A;  4HM7 A;  1BE3 E;  1PP9 E;  4QUQ A;  1WQL A;  2E4P A;  3TGU E;  2BMO A;  1L0N E;  3GOB A;  4H0L D;  2NUK A;  3GB4 A;  1ZRT E;  1L0L E;  3VMH D;  2B24 A;  3EN1 A;  1NU1 E;  4AIV A;  1UUW A;  2GBW A;  2E74 D;  1SQV E;  4NBG D;  1NDO A;  1PPJ E;  2E4Q A;  3VCA A;  2BMR A;  3EQQ A;  1FQT A;  3H1H E;  3N0Q A;  3L71 E;  2QJP C;  2NUM A;  3DQY A;  5HL4 A;  4HJL A;  5BOK A;  3BCC E;  4QCK A;  1VM9 A;  2QJY C;  2FYU E;  3GL2 A;  2HMM A;  3VCP A;  3GCE A;  3H1I E;  1G8J B;  3GKE A;  1O7H A;  1SQP E;  4NBE D;  1NTM E;  1UUV A;  4HM4 A;  1VCK A;  3GTE A;  3VMG D;  3GL0 A;  2NWF A;  2HMO A;  2BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...