2NUMA

Soluble domain of rieske iron-sulfur protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHFDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 35
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2numA00
2QPZA 3VMID 3L74E 3L72E 2E74D 2XSHA 5KLIC 2E75D 2ZYLA 2HMNA 4HM0A 3EQQA 3N0QA 1O7HA 2BMOA 5BOKA 4P1CH 1G8KB 2GBWA 2FYNC 2HMLA 4QDCA 1ULIA 3BCCE 2NVEA 4H44D 1VF5D 2E76D 1ULJA 4NBED 3FOUA 4NB9D 1KB9E 2A06E 2GBXA 2HMKA 2HMOA 1NYKA 2BMRA 4U3FE 4AAYB 3GL0A 2YIUC 4NB8D 1Q90C 1SQVE 4HJLA 4PV1D 2NUKA 3GKEA 3GTSA 2YFLA 3CWBE 1O7PA 2BMQA 3H1LE 1SQPE 2JZAA 4AIVA 2HMJA 4NBHD 3TGUE 2XRXA 3GZXA 2I7FA 2NWFA 1JM1A 5CXMA 1VM9A 1G8JB 1O7NA 4QDFA 1SJGA 4HM3A 2FYUE 1NDOA 1WQLA 3AZCA 4H13D 4QUQA 2QJPC 4QDFB 2NVGA 3H1JE 1VCKA 1O7MA 1EG9A 2B24A 1L0NE 3GCEA 4EMJB 4HM1A 2HMMA 2YFIA 1SQXE 1FQTA 3C0DA 3GTEA 2NUMA 4QUPA 3CXHE 1EZVE 4NBAD 1SQQE 2DE7D 4QCKA 2ZT9D 1NTKE 2JO6A 1O7GA 2IBZE 5KKZC 3EN1A 1NU1E 2NVFA 4NBBD 2XSOA 1RFSA 2YFJA 2BCCE 4PD4E 4QDDA 3VCAA 1KYOE 3GB4A 4NBGD 1RIEA 2XR8A 3DQYA 3CX5E 1BE3E 4NBFD 3L71E 3VMHD 3VMGD 1SQBE 2QJKC 4HM6A 4HM7A 5KLVE 4P1BH 3D89A 2QJYC 4QURA 1NTZE 1P84E 2DE6D 2E4QA 3GZYA 3L70E 4HM8A 4NBCD 5AEUA 1PP9E 3L73E 2DE5D 2B1XA 4NBDD 4HM5A 1ZRTE 3H1KE 2YVJB 4H0LD 1BCCE 1NTME 1UUVA 4OGQD 5AEWA 1L0LE 4HKVA 5HL4A 3H1IE 1O7WA 3L75E 1UUWA 3GL2A 4HM4A 1PPJE 4HM2A 2E4PA 2Q3WA 3H1HE 3VCPA 3GOBA 2D2CD 2CKFA
chains in the Genus database with same CATH superfamily
2QPZA 3VMID 3L74E 3L72E 2E74D 2XSHA 5KLIC 2E75D 2ZYLA 2HMNA 4HM0A 3EQQA 3N0QA 1O7HA 2BMOA 5BOKA 4P1CH 1G8KB 2GBWA 2FYNC 2HMLA 4QDCA 1ULIA 3BCCE 2NVEA 4H44D 1VF5D 2E76D 1ULJA 4NBED 3FOUA 4NB9D 1KB9E 2A06E 2GBXA 2HMKA 2HMOA 1NYKA 2BMRA 4U3FE 4AAYB 3GL0A 2YIUC 4NB8D 1Q90C 1SQVE 4HJLA 4PV1D 2NUKA 3GKEA 3GTSA 2YFLA 3CWBE 1O7PA 2BMQA 3H1LE 1SQPE 2JZAA 4AIVA 2HMJA 4NBHD 3TGUE 2XRXA 3GZXA 2I7FA 2NWFA 1JM1A 5CXMA 1VM9A 1G8JB 1O7NA 4QDFA 1SJGA 4HM3A 2FYUE 1NDOA 1WQLA 3AZCA 4H13D 4QUQA 2QJPC 4QDFB 2NVGA 3H1JE 1VCKA 1O7MA 1EG9A 2B24A 1L0NE 3GCEA 4EMJB 4HM1A 2HMMA 2YFIA 1SQXE 1FQTA 3C0DA 3GTEA 2NUMA 4QUPA 3CXHE 1EZVE 4NBAD 1SQQE 2DE7D 4QCKA 2ZT9D 1NTKE 2JO6A 1O7GA 2IBZE 5KKZC 3EN1A 1NU1E 2NVFA 4NBBD 2XSOA 1RFSA 2YFJA 2BCCE 4PD4E 4QDDA 3VCAA 1KYOE 3GB4A 4NBGD 1RIEA 2XR8A 3DQYA 3CX5E 1BE3E 4NBFD 3L71E 3VMHD 3VMGD 1SQBE 2QJKC 4HM6A 4HM7A 5KLVE 4P1BH 3D89A 2QJYC 4QURA 1NTZE 1P84E 2DE6D 2E4QA 3GZYA 3L70E 4HM8A 4NBCD 5AEUA 1PP9E 3L73E 2DE5D 2B1XA 4NBDD 4HM5A 1ZRTE 3H1KE 2YVJB 4H0LD 1BCCE 1NTME 1UUVA 4OGQD 5AEWA 1L0LE 4HKVA 5HL4A 3H1IE 1O7WA 3L75E 1UUWA 3GL2A 4HM4A 1PPJE 4HM2A 2E4PA 2Q3WA 3H1HE 3VCPA 3GOBA 2D2CD 2CKFA
chains in the Genus database with same CATH topology
2QPZA 3VMID 3L74E 3L72E 2E74D 2XSHA 5KLIC 2E75D 2ZYLA 2HMNA 4HM0A 3EQQA 3N0QA 1O7HA 2BMOA 5BOKA 4P1CH 1G8KB 2GBWA 2FYNC 2HMLA 4QDCA 1ULIA 3BCCE 2NVEA 4H44D 1VF5D 2E76D 1ULJA 4NBED 3FOUA 4NB9D 1KB9E 2A06E 2GBXA 2HMKA 2HMOA 1NYKA 2BMRA 4U3FE 4AAYB 3GL0A 2YIUC 4NB8D 1Q90C 1SQVE 4HJLA 4PV1D 2NUKA 3GKEA 3GTSA 2YFLA 3CWBE 1O7PA 2BMQA 3H1LE 1SQPE 2JZAA 4AIVA 2HMJA 4NBHD 3TGUE 2XRXA 3GZXA 2I7FA 2NWFA 1JM1A 5CXMA 1VM9A 1G8JB 1O7NA 4QDFA 1SJGA 4HM3A 2FYUE 1NDOA 1WQLA 3AZCA 4H13D 4QUQA 2QJPC 4QDFB 2NVGA 3H1JE 1VCKA 1O7MA 1EG9A 2B24A 1L0NE 3GCEA 4EMJB 4HM1A 2HMMA 2YFIA 1SQXE 1FQTA 3C0DA 3GTEA 2NUMA 4QUPA 3CXHE 1EZVE 4NBAD 1SQQE 2DE7D 4QCKA 2ZT9D 1NTKE 2JO6A 1O7GA 2IBZE 5KKZC 3EN1A 1NU1E 2NVFA 4NBBD 2XSOA 1RFSA 2YFJA 2BCCE 4PD4E 4QDDA 3VCAA 1KYOE 3GB4A 4NBGD 1RIEA 2XR8A 3DQYA 3CX5E 1BE3E 4NBFD 3L71E 3VMHD 3VMGD 1SQBE 2QJKC 4HM6A 4HM7A 5KLVE 4P1BH 3D89A 2QJYC 4QURA 1NTZE 1P84E 2DE6D 2E4QA 3GZYA 3L70E 4HM8A 4NBCD 5AEUA 1PP9E 3L73E 2DE5D 2B1XA 4NBDD 4HM5A 1ZRTE 3H1KE 2YVJB 4H0LD 1BCCE 1NTME 1UUVA 4OGQD 5AEWA 1L0LE 4HKVA 5HL4A 3H1IE 1O7WA 3L75E 1UUWA 3GL2A 4HM4A 1PPJE 4HM2A 2E4PA 2Q3WA 3H1HE 3VCPA 3GOBA 2D2CD 2CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPZ A;  3VMI D;  3L74 E;  3L72 E;  2E74 D;  2XSH A;  5KLI C;  2E75 D;  2ZYL A;  2HMN A;  4HM0 A;  3EQQ A;  3N0Q A;  1O7H A;  2BMO A;  5BOK A;  4P1C H;  1G8K B;  2GBW A;  2FYN C;  2HML A;  4QDC A;  1ULI A;  3BCC E;  2NVE A;  4H44 D;  1VF5 D;  2E76 D;  1ULJ A;  4NBE D;  3FOU A;  4NB9 D;  1KB9 E;  2A06 E;  2GBX A;  2HMK A;  2HMO A;  1NYK A;  2BMR A;  4U3F E;  4AAY B;  3GL0 A;  2YIU C;  4NB8 D;  1Q90 C;  1SQV E;  4HJL A;  4PV1 D;  2NUK A;  3GKE A;  3GTS A;  2YFL A;  3CWB E;  1O7P A;  2BMQ A;  3H1L E;  1SQP E;  2JZA A;  4AIV A;  2HMJ A;  4NBH D;  3TGU E;  2XRX A;  3GZX A;  2I7F A;  2NWF A;  1JM1 A;  5CXM A;  1VM9 A;  1G8J B;  1O7N A;  4QDF A;  1SJG A;  4HM3 A;  2FYU E;  1NDO A;  1WQL A;  3AZC A;  4H13 D;  4QUQ A;  2QJP C;  4QDF B;  2NVG A;  3H1J E;  1VCK A;  1O7M A;  1EG9 A;  2B24 A;  1L0N E;  3GCE A;  4EMJ B;  4HM1 A;  2HMM A;  2YFI A;  1SQX E;  1FQT A;  3C0D A;  3GTE A;  2NUM A;  4QUP A;  3CXH E;  1EZV E;  4NBA D;  1SQQ E;  2DE7 D;  4QCK A;  2ZT9 D;  1NTK E;  2JO6 A;  1O7G A;  2IBZ E;  5KKZ C;  3EN1 A;  1NU1 E;  2NVF A;  4NBB D;  2XSO A;  1RFS A;  2YFJ A;  2BCC E;  4PD4 E;  4QDD A;  3VCA A;  1KYO E;  3GB4 A;  4NBG D;  1RIE A;  2XR8 A;  3DQY A;  3CX5 E;  1BE3 E;  4NBF D;  3L71 E;  3VMH D;  3VMG D;  1SQB E;  2QJK C;  4HM6 A;  4HM7 A;  5KLV E;  4P1B H;  3D89 A;  2QJY C;  4QUR A;  1NTZ E;  1P84 E;  2DE6 D;  2E4Q A;  3GZY A;  3L70 E;  4HM8 A;  4NBC D;  5AEU A;  1PP9 E;  3L73 E;  2DE5 D;  2B1X A;  4NBD D;  4HM5 A;  1ZRT E;  3H1K E;  2YVJ B;  4H0L D;  1BCC E;  1NTM E;  1UUV A;  4OGQ D;  5AEW A;  1L0L E;  4HKV A;  5HL4 A;  3H1I E;  1O7W A;  3L75 E;  1UUW A;  3GL2 A;  4HM4 A;  1PPJ E;  4HM2 A;  2E4P A;  2Q3W A;  3H1H E;  3VCP A;  3GOB A;  2D2C D;  2CKF A; 
#chains in the Genus database with same CATH topology
 2QPZ A;  3VMI D;  3L74 E;  3L72 E;  2E74 D;  2XSH A;  5KLI C;  2E75 D;  2ZYL A;  2HMN A;  4HM0 A;  3EQQ A;  3N0Q A;  1O7H A;  2BMO A;  5BOK A;  4P1C H;  1G8K B;  2GBW A;  2FYN C;  2HML A;  4QDC A;  1ULI A;  3BCC E;  2NVE A;  4H44 D;  1VF5 D;  2E76 D;  1ULJ A;  4NBE D;  3FOU A;  4NB9 D;  1KB9 E;  2A06 E;  2GBX A;  2HMK A;  2HMO A;  1NYK A;  2BMR A;  4U3F E;  4AAY B;  3GL0 A;  2YIU C;  4NB8 D;  1Q90 C;  1SQV E;  4HJL A;  4PV1 D;  2NUK A;  3GKE A;  3GTS A;  2YFL A;  3CWB E;  1O7P A;  2BMQ A;  3H1L E;  1SQP E;  2JZA A;  4AIV A;  2HMJ A;  4NBH D;  3TGU E;  2XRX A;  3GZX A;  2I7F A;  2NWF A;  1JM1 A;  5CXM A;  1VM9 A;  1G8J B;  1O7N A;  4QDF A;  1SJG A;  4HM3 A;  2FYU E;  1NDO A;  1WQL A;  3AZC A;  4H13 D;  4QUQ A;  2QJP C;  4QDF B;  2NVG A;  3H1J E;  1VCK A;  1O7M A;  1EG9 A;  2B24 A;  1L0N E;  3GCE A;  4EMJ B;  4HM1 A;  2HMM A;  2YFI A;  1SQX E;  1FQT A;  3C0D A;  3GTE A;  2NUM A;  4QUP A;  3CXH E;  1EZV E;  4NBA D;  1SQQ E;  2DE7 D;  4QCK A;  2ZT9 D;  1NTK E;  2JO6 A;  1O7G A;  2IBZ E;  5KKZ C;  3EN1 A;  1NU1 E;  2NVF A;  4NBB D;  2XSO A;  1RFS A;  2YFJ A;  2BCC E;  4PD4 E;  4QDD A;  3VCA A;  1KYO E;  3GB4 A;  4NBG D;  1RIE A;  2XR8 A;  3DQY A;  3CX5 E;  1BE3 E;  4NBF D;  3L71 E;  3VMH D;  3VMG D;  1SQB E;  2QJK C;  4HM6 A;  4HM7 A;  5KLV E;  4P1B H;  3D89 A;  2QJY C;  4QUR A;  1NTZ E;  1P84 E;  2DE6 D;  2E4Q A;  3GZY A;  3L70 E;  4HM8 A;  4NBC D;  5AEU A;  1PP9 E;  3L73 E;  2DE5 D;  2B1X A;  4NBD D;  4HM5 A;  1ZRT E;  3H1K E;  2YVJ B;  4H0L D;  1BCC E;  1NTM E;  1UUV A;  4OGQ D;  5AEW A;  1L0L E;  4HKV A;  5HL4 A;  3H1I E;  1O7W A;  3L75 E;  1UUW A;  3GL2 A;  4HM4 A;  1PPJ E;  4HM2 A;  2E4P A;  2Q3W A;  3H1H E;  3VCP A;  3GOB A;  2D2C D;  2CKF A; 
#chains in the Genus database with same CATH homology
 2QPZ A;  3VMI D;  3L74 E;  3L72 E;  2E74 D;  2XSH A;  5KLI C;  2E75 D;  2ZYL A;  2HMN A;  4HM0 A;  3EQQ A;  3N0Q A;  1O7H A;  2BMO A;  5BOK A;  4P1C H;  1G8K B;  2GBW A;  2FYN C;  2HML A;  4QDC A;  1ULI A;  3BCC E;  2NVE A;  4H44 D;  1VF5 D;  2E76 D;  1ULJ A;  4NBE D;  3FOU A;  4NB9 D;  1KB9 E;  2A06 E;  2GBX A;  2HMK A;  2HMO A;  1NYK A;  2BMR A;  4U3F E;  4AAY B;  3GL0 A;  2YIU C;  4NB8 D;  1Q90 C;  1SQV E;  4HJL A;  4PV1 D;  2NUK A;  3GKE A;  3GTS A;  2YFL A;  3CWB E;  1O7P A;  2BMQ A;  3H1L E;  1SQP E;  2JZA A;  4AIV A;  2HMJ A;  4NBH D;  3TGU E;  2XRX A;  3GZX A;  2I7F A;  2NWF A;  1JM1 A;  5CXM A;  1VM9 A;  1G8J B;  1O7N A;  4QDF A;  1SJG A;  4HM3 A;  2FYU E;  1NDO A;  1WQL A;  3AZC A;  4H13 D;  4QUQ A;  2QJP C;  4QDF B;  2NVG A;  3H1J E;  1VCK A;  1O7M A;  1EG9 A;  2B24 A;  1L0N E;  3GCE A;  4EMJ B;  4HM1 A;  2HMM A;  2YFI A;  1SQX E;  1FQT A;  3C0D A;  3GTE A;  2NUM A;  4QUP A;  3CXH E;  1EZV E;  4NBA D;  1SQQ E;  2DE7 D;  4QCK A;  2ZT9 D;  1NTK E;  2JO6 A;  1O7G A;  2IBZ E;  5KKZ C;  3EN1 A;  1NU1 E;  2NVF A;  4NBB D;  2XSO A;  1RFS A;  2YFJ A;  2BCC E;  4PD4 E;  4QDD A;  3VCA A;  1KYO E;  3GB4 A;  4NBG D;  1RIE A;  2XR8 A;  3DQY A;  3CX5 E;  1BE3 E;  4NBF D;  3L71 E;  3VMH D;  3VMG D;  1SQB E;  2QJK C;  4HM6 A;  4HM7 A;  5KLV E;  4P1B H;  3D89 A;  2QJY C;  4QUR A;  1NTZ E;  1P84 E;  2DE6 D;  2E4Q A;  3GZY A;  3L70 E;  4HM8 A;  4NBC D;  5AEU A;  1PP9 E;  3L73 E;  2DE5 D;  2B1X A;  4NBD D;  4HM5 A;  1ZRT E;  3H1K E;  2YVJ B;  4H0L D;  1BCC E;  1NTM E;  1UUV A;  4OGQ D;  5AEW A;  1L0L E;  4HKV A;  5HL4 A;  3H1I E;  1O7W A;  3L75 E;  1UUW A;  3GL2 A;  4HM4 A;  1PPJ E;  4HM2 A;  2E4P A;  2Q3W A;  3H1H E;  3VCP A;  3GOB A;  2D2C D;  2CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...