2NUXA

2-keto-3-deoxygluconate aldolase from sulfolobus acidocaldarius, native structure in p6522 at 2.5 a resolution
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
288
structure length
288
Chain Sequence
MEIISPIITPFDKQGKVNVDALKTHAKNLLEKGIDAIFVNGTTGLGPALSKDEKRQNLNALYDVTHKLIFQVGSLNLNDVMELVKFSNEMDILGVSSHSPYYFPRLPEKFLAKYYEEIARISSHSLYIYNYPAATGYDIPPSILKSLPVKGIKDTNQDLAHSLEYKLNLPGVKVYNGSNTLIYYSLLSLDGVVASFTNFIPEVIVKQRDLIKQGKLDDALRLQELINRLADILRKYGSISAIYVLVNEFQGYDVGYPRPPIFPLTDEEALSLKREIEPLKRKIQELVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho gluconate a
publication title Biochemical and structural exploration of the catalytic capacity of Sulfolobus KDG aldolases
pubmed doi rcsb
source organism Sulfolobus acidocaldarius dsm 639
molecule tags Lyase
total genus 114
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2nuxA00
3NZ1A 3UXAA 5FEWA 2QCFA 1KW1A 5LSMA 1SR9A 5K9DA 1ZAHA 1FCVA 3L5MA 2GQAA 3F1QA 2Y88A 2X1UA 4N9BA 4UTTA 1GYLA 3IGXA 4WOZA 3P80A 4IGHA 3TAKA 3PS7A 3G3DA 4FB7A 3TSBA 4OGZA 1I2RA 5A5WA 3SR7A 3A9IA 3W7LA 1X1OA 3WJYA 1F73A 4HNVA 4BFAA 2FIQA 4NNBA 5G2HA 5D2YA 4ALDA 4RXGA 3QH2A 2R14A 2Y85A 4RZ4A 3MMTA 1PL9A 2GQ9A 3MYOA 2ZA3A 1WA3A 4NJJA 3MI3A 3LRLA 1H51A 2A21A 3VNDA 5DCEA 1OF8A 4NVTA 1K03A 1KM6A 1QR7A 1FXPA 4ADUA 4UTMA 4TO8A 2Q3RA 3W1LA 2ZDRA 5FEZA 1XUUA 4NX5A 3STCA 4PTNA 3A24A 4ORIA 3L9CA 2NXHA 1G4PA 1H1ZA 5HINA 1DJNA 2FJKA 5G2IA 3N9RA 3LXAA 2OX1A 4BI5A 4IUOA 3E12A 3O16A 4AAJA 2Z6IA 3BLEA 4FX8A 1VGAA 1OFAA 1UCWA 1XBYA 1ZENA 5D05A 5D32A 6TIMA 3G24A 3E0IA 1AL8A 2CW6A 2EHHA 4RLIA 4YL2A 3FIGA 5CZJA 3UY8A 3DI0A 1ZNNA 4UXDA 2Z0IA 3M9YA 3FYOA 5I3IA 1DQXA 2I1OA 2NV2A 3O6CA 3FEMA 3HBLA 3QSRA 1TPC1 1LBMA 8TIMA 3PUOA 3GKAA 5BMWA 1H7WA 3MJYA 3PWAA 3M43A 3TQKA 3C2EA 3MYPA 4TMCA 3FA5A 1RQHA 4NJHA 4K37A 4JTKA 3GIYA 1WXJA 3KVKA 4XQ6A 1YPIA 1JRCA 1EX5A 1HG3A 4LVBA 1IF2A 4IX0A 1R30A 5AHLA 2QJGA 1OHLA 5FEPA 3PC0A 4S2CA 2E6YA 1VCGA 3M7WA 2GOUA 1XBXA 3UWWA 3IEBA 2ABAA 2XN2A 2B7PA 3A5FA 1IIGA 1OX4A 2WSYA 3W1AA 4O19A 4E2DA 4MJZA 5LZLA 3E02A 3GR7A 3VCRA 1L6YA 3M44A 1RQEA 3VI2A 4FXRA 5TBOA 4J9JA 1EP2A 3W7OA 4RZ6A 3W1TA 4O13A 5J5RA 5K7JA 2BZNA 4Z1BA 1JQXA 1SSDA 1Q3NA 4RV8A 3RLVA 4LVDA 3NQMA 3L5LA 3KVMA 3GXTA 2PRMA 3INPA 5G1TA 3R2GA 4DF1A 4JYDA 3C4UA 4LTSA 2WV8A 2YR1A 3MP4A 3GXNA 4ZL1A 2KZHA 1OFQA 1WOBA 1S5VA 5K3VA 3QF0A 3WK0A 1LLZA 4MPQA 1TPUA 3SW6A 4LNYA 3S9YA 5TQLA 4O17A 5EPDA 1JQVA 1GT8A 1UB3A 1XCFA 3W86A 4IQLA 3IIPA 3KRUA 4O1DA 1EB3A 1GVFA 4OHQA 5HULA 2NXGA 4UFMA 3B0VC 1H60A 3TQVA 3S6DA 2HS8A 3TV8A 1VPXA 2A0NA 5K9CA 1JVNA 3OG3A 2OJPA 4Z0JA 3W7NA 1L9WA 2QCCA 1HUVA 2C18A 3W88A 2B7QA 2DJLA 1ZY9A 1TV5A 1EP1A 4XKYA 2X1RA 3W85A 3DFSA 1L6SA 3IVSA 4WY0A 2X1SA 5I3FA 4IJBA 3PB2A 3UNDA 5DBUA 2ZRVA 1Y0EA 5BOOA 3WJXA 3W1UA 5K4XA 2ZYFA 3N3MA 4MYXA 1VZWA 1IIHA 4FIRA 3B06A 3Q2DA 5AHFA 1W5OA 4WY0F 2BWGA 1ZAIA 4GUJA 5I3JA 2AGKA 2OCZA 4JTTA 1AW5A 5L9FA 3R8RA 2Z2UA 4OQVA 3CU2A 1G6CA 1RR2A 3AJXA 4HKPA 2CLFA 5I3GA 1K8ZA 3C56A 3S5ZA 4LRTA 3NXFA 2CLEA 3W6YA 3LXCA 1Z44A 3OA3A 3M47A 4L4LA 4WOQA 4PCFA 1ML1A 2V30A 1SQ7A 1T8XA 3THQA 3NPVA 1UJPA 3UPBA 2NX9A 1N7KA 2Y7DA 3BW2A 3HB9A 4E38A 1TREA 1SUXA 4HPXA 1LOQA 1H61A 4M6QA 1KTNA 2BX7A 3DBPA 4GUFA 3TC7A 1TV7A 1V5XA 4MVAA 3V1PA 4YMZA 4LW7A 3A5VA 3NR0A 4AVFA 5CZSA 1Z42A 4Y90A 3VFLA 3B8DA 1TPDA 3MI6A 1F05A 3W84A 2A7RA 4LOCA 4BI7A 5F1VA 4NJGA 3S5NA 4XTIA 3HPXA 2WPBA 2NX3A 1G4TA 2ZZ3A 4EIVA 2PRHA 1SO6A 2CU0A 4OV9A 1I2NA 3G1AA 1HL2A 4LV9A 1WDWA 3P8IA 2VEIA 3OVRA 4JIPA 4FHAA 2HMCA 2J24A 3S0CA 3TE9A 1QFEA 1F5ZA 4YCPA 2FLIA 4HIBA 1KLYA 1TJRA 3CLMA 3O15A 4FEZA 1QPOA 3W7DA 1XL9A 2YCEA 4MLJA 1LM1A 5U4NA 2DP3A 3W72A 2YZRA 1YTKA 5HR6A 3LLDA 3KXQA 2ABBA 1ONRA 4N2YA 4FNRA 1JUEA 3GLCA 3TFXA 1EUNA 5I3HA 4EOUA 1VLWA 4QIUA 2ZZ7A 3I68A 5G4EA 1Q6RA 5CSRA 1ZHAA 1F2JA 2NLIA 2O7QA 3O06A 1OFDA 1D9EA 1SW3A 5DN1A 4U4MA 4BR1A 3CC1A 5CZTA 1TPB1 4E0CA 3HGOA 2J9YA 4Y96A 4NUWA 3P81A 1S5WA 3HQ1A 4TR9A 2ISWA 2Y62A 3SIZA 1QPQA 1N55A 4AF0B 5FF0A 3DHDA 2E77A 1LORA 1ICQA 3W1PA 3TA6A 3LV5A 1I2QA 4JS3A 3M1ZA 1P5BA 3BLFA 3OIXA 4U28A 4WX2A 3RF9A 4PA8A 1LOLA 1GTEA 1HTIA 3P8JA 1YDOA 4CCCA 3E96A 4MLRA 1X7FA 2ALDA 2X16A 3MHUA 3VKJA 4CLMA 3LI0A 4TU1A 1KM5A 4CQ8A 2WNZA 3LHTA 3IIOA 3OVPA 2CLLA 1NVMA 3W7IA 4NXSA 3TAOA 2VFEA 4R53A 3G8EA 4KKXA 1W5MA 3TH6A 3TXZA 3EX3A 2G95A 5T26A 5D04C 5F2GA 3DGRA 3GAKA 3CTLA 4FNTA 3BG3A 2NZLA 4R7JA 5D2TA 1L2UA 2W79A 3LERA 3PBVA 3O6YX 3W73A 3O63A 5KINA 4PODA 1TQXA 4I7WA 3VE9A 1P0KA 3TJLA 4UTJA 1QPRA 2Q8ZA 3F03K 1OYBA 1Q6LA 3ZFHA 3FLUA 2E5DA 4KFOA 3QMTA 2OMAA 4NJKA 2X1TA 2ZTKA 1HO1A 3NQ8A 4MY8A 4DPQA 1KTCA 3W87A 4KFNA 4GWEA 4JTSA 3LLFA 5DY2A 4AHQA 1FWTA 3SY5A 3WK1A 3W1NA 1M6JA 4O52A 3O07A 3W7RA 1YTDA 3I7RA 5TIMA 5EMUA 2FPYA 4QISA 2EGZA 4LY8A 2CWNA 1OABA 3ATZA 4FX6M 1IXQA 4P61A 4UUIA 4JXCA 3WK2A 5LGXA 4M7TA 1TPFA 4K36A 4ZQPA 3PSWA 3O05A 1YTEA 3DFPA 3SZ8A 1I2PA 4UTTC 3LTSA 5LHFA 4JDYA 5AB3A 3TIMA 3A22A 4CQAA 1SZFA 1UUMA 3NL3A 5LNWA 3GDRA 1VS1A 3EEGA 4BK9A 3TROA 1RQBA 4K6AA 3IGUA 3PBYA 2CFFA 4ONVA 5AC7A 4JYFA 1SSGA 2NUXA 1DV7A 1KFCA 1WV2A 2QAPA 3LHUA 3QYQA 2P10A 3A23A 1T99A 3SJ3A 5AN7A 1OFRA 3CHVA 4UC5A 3UY7A 2J27A 2YYTA 1SW7A 2ZRWA 5EA9A 5HWJA 1QCWA 4MY9A 1D3GA 3SECA 2ZRYA 4A22A 2AQWA 1FWRA 3BARA 3H54A 2X2GA 1NFBA 2A6NA 3DFOA 3NL2A 3NPUA 3MP5A 1AW1A 1WYIA 4H4IA 3ABSA 3EWZA 1PS9A 1ZFJA 4BF9A 1W5NA 3W83A 1SW0A 4A2RA 1IGSA 2Y63A 1LDCA 4OBTA 5AYZA 2E09A 4LV4A 2P1FA 1D3HA 2ZQ0A 3L68A 3NM1A 5K9XA 1GYNA 3P7YA 4N9DA 2ZZ1A 2Y70A 1OYCA 2EF9A 1UASA 3IVTA 1I4NA 4Q4KA 1GZGA 4Z1AA 3EB2A 1GG1A 3NQDA 4RJEA 3DHFA 3PULA 4WJEA 1XBVA 3NQFA 2QJIA 4HSOA 1S3HA 5BRBA 5AOUA 1TO3A 4ZQRA 3QSTA 4IWWA 4N6FA 3R89A 5KTLA 3EX6A 4UR8A 4S1FA 5BMXA 3FJ6A 1T0OA 2YFOA 2GJNA 2HTMA 4YCOA 1DKWA 4QNEA 3FKRA 2H90A 4LUIA 1KFKA 1FWNA 2YFNA 3GAYA 3LCWA 2NXIA 2E1DA 3CIXA 1KM2A 2HSAA 2QCEA 3IIZA 5K4ZA 2H6RA 4GC4A 3NQ7A 3I65A 1F6PA 2BTMA 7TIMA 2LLEA 1Z41A 2W6RA 2C6QA 2BLEA 3GKFA 3ZWSA 2Q8LA 3W70A 2E6DA 1N8FA 1YLVA 2V5LA 4JGDA 3TQ0A 5LNSA 3E9AA 3RMJA 3GZ3A 3DI1A 2FB3A 4FO4A 2GVGA 2QEZA 2QF7A 4A2SA 1GVOA 3GNDA 2TYSA 3FYPA 1SO5A 3HGJA 4A21A 4HPJA 2CZFA 3DENA 1C9DA 2A4AA 2RDTA 3GYEA 2Q3OA 4YLWA 1H7PA 1TCDA 2V82A 4PFMA 3NZRA 4UFHA 2Y89A 4LS0A 4RX0A 3W9ZA 5J5DA 1TTQA 1XDLA 1TPH1 3A21A 2PE4A 3W75A 3L65A 2CLMA 3HGRA 4GFSA 2ZZ5A 3L0GA 3R5EA 2IQTA 2XFWA 3NAVA 2A1YA 1TSIA 3LRMA 2DZXA 4OWGA 4AH7A 3PUEA 5C6MA 3GX9A 4Q33A 1DQWA 2B0MA 3M16A 2JKPA 4BWLA 1TV8A 2BSLA 4XWUA 3W7JA 2H8XA 1F74A 3CQ0A 3W7GA 3UWUA 4K7YA 2A5HA 3GXPA 3P67A 2CLHA 1I2OA 1FCUA 3NO5A 1B9BA 1VH7A 3G1DA 1A5AA 4FF7A 1C8VA 4HNNA 4NJIA 4CCEA 3CEPA 1SPQA 2R94A 2C3ZA 4RKAA 2A7NA 4MOZA 3BG9A 1WAUA 1MO0A 1O5XA 3SGZA 4JY8A 2DZPA 1W3TA 3UPWA 2V9DA 4ADTA 1IXPA 1R47A 1RZMA 1QPNA 4QQ3A 2XN0A 1XC4A 2FPVA 2Y7FA 3I6RA 2RDUA 1YDNA 3BGGA 4UNKA 4WXYA 4ICNA 5D33A 1AMKA 1ADOA 4AMAA 4DO6A 3LHVA 2WJZA 1FUYA 3W3OA 1OFEA 4PH6A 4ZQMA 2E6FA 4FNPA 3M41A 1MZHA 4JTEA 2V81A 3WJSA 2C16A 2FPTA 3W7EA 1PCWA 4DQWA 3P74A 1H7NA 4KFPA 3TSDA 5DBTA 5HQEA 2X30A 2VEPA 3L2IA 4O54A 4HSNA 2ZFAA 1BTMA 1AL7A 2NV1A 3DXIA 4O57A 3PG8A 3W7HA 2Y7GA 5EYWA 2ZTJA 1WBHA 3G22A 2JGYA 4ZZ9A 1W8SA 4UMAA 2JKEA 4IPIA 4OU1A 5AFDA 5KZEA 1XFBA 1BKSA 3ANYA 4WXZA 2ATMA 3QRHA 3STEA 2AAMA 3QW4B 5EL1A 2FTPA 3P62A 3TX9A 1DL3A 4JN6A 1H7RA 3FS2A 5FESA 3S5YA 3RK8A 4AWUA 3HG4A 2TRSA 3DH7A 5L6UA 3PBUA 1OK4A 1YXYA 2ZZ6A 4RK8A 4O15A 1KM0A 1TYGA 5HWMA 3GDTA 1F6KA 1J5TA 5E93A 1GG0A 5G2WA 1M5WA 1KFBA 1VLIA 1G7UA 5AHMA 1TTPA 5CGQA 3DKLA 3L66A 3M5VA 4GE8A 1XUZA 2C0AA 2QCHA 2G96A 2RKXA 3EX2A 3L67A 3PR2A 1GEQA 1AW2A 4OE7A 3RFAA 2VEKA 2FB2A 1GOXA 3G3MA 4UMCA 3WFAA 5AYYA 5HJLA 1M7OA 2RH9A 5GVJA 2GVJA 5D37A 1MEHA 2V5BA 2QDHA 5LHEA 4NU7A 2GQ8A 4M19A 1QWGA 3AO0A 3VE7A 4QNWA 3C6CA 3U6WA 2WKJA 1W56A 4DEFA 1KLZA 4O0KA 4LUJA 3NG3A 4IMFA 4LS2A 3TFCA 3UWYA 1O5KA 1A50A 5CSSA 2O7SA 3LX9A 1PE1A 1P1XA 3HMJG 3HJZA 2ZA1A 4MKNA 4B5NA 5HWNA 3D0CA 1GTHA 1OX5A 2PCQA 3P5YA 5LGZA 4ZQCA 4MY1A 3L0KA 3W2LA 1NF0A 2R91A 3RU6A 1GWJA 4K7VA 4N9CA 2H3DA 4MIMA 1F76A 4A3UA 5AHIA 3LM7A 4JX6A 5MHBA 2DJXA 1VHCA 3KHJA 4UTHA 4UTKA 3K30A 2ZA2A 5F4SA 3W76A 3QMRA 3G18A 1TTJA 5LKYA 3MI2A 3PBWA 5HNRA 3BPWA 4LVGA 1NEYA 3UZ5A 3M5YA 4NNAA 4Y9AA 3P60A 2JKAA 3LDVA 1PVNA 4QJ1A 3P84A 5G5IA 3UWZA 3FKKA 1KA9F 3W1XA 2JK2A 3HPZA 2QCGA 3EX4A 4Y6GA 3HGSA 3QC3A 3YPIA 4TIMA 1OF6A 3TK7A 3ELFA 1TJPA 3QQ1A 1FDYA 4L4MA 5F4WA 2W0UA 4I7VA 3TU9A 5DELA 3F4WA 2UV8G 5IM51 1PHQA 3HF3A 3O8AA 3W1MA 1YXCA 3CT7A 4UIOA 3ABQA 5C2XA 1OYAA 1SZNA 3EWYA 3MW7A 1V7YA 1OFBA 3LB0A 3KRZA 1HO4A 1LBFA 3ABOA 3UXDA 3LCHA 1R2TA 2DZTA 5DXYA 1UBSA 4LVAA 5F2LA 2C15A 2TSYA 4P2VA 1OVDA 3W2UA 1FCBA 1YXDA 1Q45A 4HN4A 4O28A 1SFJA 2C1HA 1K7EA 1XBZA 4MUZA 1A53A 2B7OA 4UTWA 4X3ZA 2RDWA 4DO4A 5CZ0A 3QFEA 5CKSA 4D2JA 1DOSA 2QCDB 1HFBA 3DFTA 2YXGA 3B0PA 1TIMA 4GRSA 4R33A 1OX4B 3O1NA 1VC4A 3TC6A 1M7PA 1EWDA 3MUXA 3NQEA 1SO3A 3DFQA 2J9ZA 5KZMA 3G1XA 2Z1BA 5D2WA 4CNNA 4LC8A 5CPMA 1WX0A 5DY3A 2NUYA 1WOAA 3RLUA 1MEIA 5FI8A 1LLWA 2ATSA 3HG2A 2OT1A 4GNJA 3T40A 1O94A 2OT0A 2FDSA 4TX9A 4IMCA 1G4EA 1XM3A 4UFIA 3QM3A 4ZQNA 3SGUA 3N19B 1TRIA 1I8JA 2ISVA 4C1LA 1YDVA 4DF2A 2J88A 4GUGA 4O16A 2D73A 3T7VA 3B04A 1JJKA 1RV8A 3QMSA 1KM4A 2H8ZA 4WUIA 3LRKA 3QQ0A 4CNOA 4JTGA 3S8HA 3LTPA 5BW6A 5SWUA 1YADA 1X6UA 3U8GA 3G8RA 2XN1A 1QDSA 2NWSA 3HOJA 3EWUA 2WNNA 4IXXA 1LCOA 3JS3A 1TTIA 2YDAA 3S1UA 2JBMA 3UD6A 1EA0A 2HS6A 1WQ5A 5HUPA 1LP6A 1ZJIA 3LXBA 4XKYB 3MWAA 3LI1A 4NQ1A 4MZYA 2GJLA 1J4EA 2ZRUA 4UFLA 4O53A 1W3NA 4O4WA 5LNUA 4XBSA 1NSJA 1KTBA 3NYZA 5E1QA 4OT7A 1NF7A 4AHPA 1SZGA 1PCKA 1GQNA 2A7PA 1JCNA 1K3UA 2QDGA 3B05A 3NQ2A 4TMBA 1W3IA 1K8YA 2Y7EA 3BW4A 5G4WA 3NM3A 4N4QA 3W1QA 2V0TA 3C0JA 1U5JA 3QPYA 3NVTA 3C3NA 4IOTA 3QPZA 3MBDA 1FBAA 4YXGA 5EY5A 1LBLA 4Z1CA 1A5SA 3KVLA 1QMLA 3ZR4A 3G1YA 3QJAA 1VCVA 1W5PA 3O6DA 4Z0SA 2YW4A 3MBFA 3B0UX 3TUUA 4XZ9A 5H91A 3ZS4A 3EXSA 1THFD 5F1UA 1W5QA 3S1WA 1A5CA 4KWVA 3CWOX 3N2XA 5LNRA 1CW2A 1KFEA 3RNDA 3KX6A 4HHPA 4XUGA 2PC4A 4PC8A 5F2IA 2DZVA 3MHFA 3CM4A 3LGEA 4Z1DA 5HMSA 2CZ5A 2PURA 3G1FA 3G1VA 1W1ZA 3CPRA 4HNTA 3EXRA 3DFNA 3T55A 2EKCA 3P5ZA 4O11A 4X9SA 4XBKA 3IGSA 3L21A 5FF3A 4JICA 4DBDA 2CZDA 5F4XA 1AG1O 3CWNA 3GDLA 4IX2A 4JEQA 5D38A 2VFIA 5EBUA 2EAWA 3OEXA 3LV6A 5HUOA 3R12A 3LCXA 5D09A 3TNOA 1JCLA 4DELA 1P4CA 3MHGA 4DXVA 4K39A 4M6PA 4BWLC 3T44A 3S5OA 3TMQA 4GBUA 3W23A 4CCDA 5FEXA 4NX0A 4N6EA 3G1SA 3N73A 1VRDA 2YSWA 2YW3A 3PG9A 1EUAA 3STFA 5AC8A 1IXNA 2CLOA 3OBKA 1PV8A 2QUVA 5AC6A 2QUTA 5IBXA 3JR2A 1H5YA 5FF7A 3NL6A 2V8ZA 3LCGA 3C2OA 4ZQOA 1FDZA 3OVQA 1TRDA 2CLKA 3TSMA 2A6LA 2VEMA 2ZCGA 1BEUA 1TPVA 3GK0A 4WZHA 3G0XA 3IIXA 1JRBA 3R13A 4N02A 1JCXA 5AHEA 2VOMA 3LOTA 2H3BA 3ATYA 3T4CA 2NWRA 1DORA 4MFDA 4IXHA 3NDOA 1GVRA 4JYEA 4PL2A 1FWWA 4DO5A 4JTIA 3TJXA 3KAOA 4FNQA 5ABTA 3C8FA 3PUDA 4O50A 1ZALA 2I14A 3TW6A 1EWEA 3HPSA 3M5ZA 3UWVA 1JCYA 3UWQA 1GVQA 4WQ6A 4MFEA 1O4UA 1W31A 2G5WA 2R8WA 1Q6OA 4IPJA 3BVJA 4GUIA 1J2WA 2VKZG 1VYRA 5KITA 2NX1A 2V2CA 1R46A 2WO5A 2WNQA 4O10A 3SI9A 3IRDA 2GVLA 3TKFA 3ZWTA 1TPEA 1R2RA 3JRKA 3W2JA 4QSHA 1S5TA 4AF0A 2VXNA 3LHYA 1B4KA 4K8EA 1QOPA 2CZEA 4EWND 1LRNA 3THAA 2I9EA 1PIIA 4DF0A 3NQVA 1JCMP 1O60A 3DKJA 4EF8A 5G1YA 2EPHA 4PEKA 2QCDA 4UTIA 5KZDA 2E5BA 1FWSA 3C52A 3W2NA 3IIVA 1ZAJA 5KSWA 3CIWA 1L6WA 3ABRA 3C61A 4JX5A 1KFLA 4FX7A 1VR6A 2DU2A 3MO7A 2YYUA 2VFFA 3NPWA 5D2VA 5HR7A 4GJ1A 3TW7A 3P61A 3Q58A 3TR2A 4AWTA 2V2DA 2WOQA 4KWWA 3T78A 1SFLA 1X8FA 2RFGA 4JR5A 1G4SA 3S42A 5BNKA 3OHIA 4H3DA 4LC6A 3NOEA 3B4UA 2ISSA 1GVSA 5H2ZA 3W2KA 1SU5A 1W37A 1JUKA 4AHOA 5FF4A 4O1CA 3FJLA 1EEPA 1VQTA 1QO2A 3Q37A 2Z6JA 3LCLA 3USBA 3W2MA 4YWIA 1FY6A 3TMLA 1Q6QA 2DZUA 1OFPA 4C1KA 3W1RA 2DZWA 4Z08A 3UQNA 4GUHA 2YGYA 3NL5A 3PSVA 4UNLA 1KFJA 1TPWA 1EPXA 3LCFA 1MXSA 2E5CA 2J6XA 1KV8A 3Q94A 4JDBA 4H6KA 1RVGA 1VYPX 4HNUA 3GDMA 3KVJA 4I7UA 4HT3A 2TPSA 4AB4A 3NNTA 3QW3A 3PVFA 4RXFA 4POCA 4WD0A 3G0SA 2VFGA 1FXQA 3KFTA 1FDJA 4RCXA 5AYXA 1DJQA 1KV5A 2TMDA 3W7PA 1UUOA 3HG3A 5E0KA 4QITA 2Y6ZA 3W74A 3UYCA 1XDMA 1ME7A 2ZRZA 4ZVJA 3C2RA 6ALDA 1OJXA 4RZ5A 2QCNA 1Z48A 3EX1A 1TMHA 1ME8A 5D30A 4LRSA 1JR1A 3HO8A 1G67A 1FQ0A 4AXKA 2VENA 1H50A 2QKFA 3SFKA 3M6YA 3TCEA 5CPNA 3SSJA 2FFCA 5I3KA 1K7FA 4MYAA 3TXVA 1LZOA 4UFKA 3BK0A 4IMDA 3PY2A 4JIQA 2FQIA 3WK3A 4E2BA 5CG7A 1LROA 2A2IA 4GXMA 1H7OA 3GNNA 4UCGA 4ADSA 3QZEA 3PAJA 4PL1A 4RR4A 1G69A 1O95A 4JTHA 3NQ6A 1B4EA 1TQJA 4EF9A 1VJIA 1VHNA 1KM1A 4NZFA 4O18A 5U7SA 4UTWC 1MEWA 1OK6A 4ORMA 3NPXA 1BWKA 1W0MA 2DORA 4K38A 3W7MA 2PRLA 2CLIA 1OX6A 3EKZA 3G0UA 4W9TA 2YPIA 1SO4A 1ZCOA 2QCMA 5DCBA 2ZZ2A 1CX9A 1T96A 4MZ1A 2A85A 1C29A 2ZZ4A 3EWWA 1H7XA 2OZ0A 3H55A 3EWXA 3S1VA 3GVGA 4N9EA 3BO9A 1JUBA 1YYAA 4JX4A 2Y61A 3WJWA 1QAPA 4FIQA 4R34A 4M5PA 2C19A 3UZJA 1K8XA 3NQCA 4JD4A 3WJZA 4M7SA 2YX0A 5DCDA 1B57A 5CPLA 3LBMA 3FOKA 3L0NA 4O1BA 4AWSA 2ZBTA 4AEOA 1JCJA 2QJHA 2P0OA 2ZRXA 4NNCA 1DHPA 3N9SA 2WSRA 1H1YA 1WBJA 5F2MA 5FF2A 2QUUA 1EIXA 3S1XA 3W22A 1GPWA 4JY9A 3W7QA 3GDKA 1QO5A 1RPXA 1XKYA 4NZJA 3CB8A 4X22A 3I7QA 4UTUA 4NT0A 3TDFA 4G1KA 3LBCA 3L5AA 1VYSX 2GUUA 3GR8A 4A29A 4ZMGA 1ICPA 3DAQA 3IVUA 3I7SA 4JTLA 4UTLA 3P82A 4M6VA 3W07A 3STGA 1AK5A 1RD5A 5A8GA 4O0ZA 2RHGA 3M0ZA 4CQ9A 3NGJA 4LVFA 4Q32A 3W71A 3LHZA 4JTJA 1TB3A 4O14A 1QOQA 4DPPA 3MP3A 2JGQA 1U83A 3H53A 2QAFA 2C14A 4LS1A 4O8RA 1IXOA 3BW3A 1ALDA 4EVZA 4O12A 3EXTA 1CI1A 3LTYA 2WQPA 4LU0A 4X2RA 4O1AA 3BG5A 3NA8A 4JTFA 1LYXA 1H63A 4FNSA 5C55A 2VFHA 3M5XA 4OV4A 3HG5A 4Y8FA 2DZSA 3BV4A 1OFOA 5C5YA 1OG0A 4BI6A 4S2BA 3GB6A 5LNVA 3PB0A 3CEUA 1K7XA 1B3OA 1R2SA 3DZ1A 4XTDA 2VFDA 1KBJA 1XXXA 4CNPA 3QEZA 1ICSA 1YPFA 1G7VA 2BXVA 4NXKA 1W54A 3LCIA 1K02A 5D03A 3W7CA 1FX6A 3N14A 1SZEA 5CPOA 1EP3A 1MSSA 2VELA 4UR7A 4UFJA 3KOFA 3DU0A 5D02A 1NAL1 3HIJA 3BGJA 1GJPA 5C54A 1E51A 5EKYA 4IMEA 4WY0B 3PF3A 1A5BA 2E6AA 3BLIA 3E49A 3N34A 1H62A 2GPTA 1XI3A 1DBTA 4LWWA 1KBIA 2J9XA 3NQGA 5K2ZA 4FNUA 5KMYA 3EKLA 4FXSA 2F7FA 5DLCA 3C2VA 1LRQA 2B7NA 1F7BA 1JULA 5DXXA 3B03A 4MJMA 4JNMA 4N4PA 4I9AA 2NUWA 1FCQA 3N2MA 4K8HA 2B4GA 4LT9A 2QCLA 1PHWA 2V2HA 3EWBX 3KRSA 5D2XA 5IBXC 3NEVA 1LRTA 3F4NA 1ME9A 2WSQA 1I45A 4MZ8A 5AHNA 1DVJA 1VCFA 2F84A 3IV3A 1X1ZA 1QNVA 1P0NA 2QR6A 3PM6A 4ML9A 2C13A 4QAIA 3NQAA 3FFSA 3U2OA 3V75A 3LHWA 4QM1A 3C2FA 2G97A 4O4VA 1BWLA 3W7KA 4UMBA 2E68A 2VC6A 1LTDA 1KM3A 3G1HA 4DBEA 4JTUA 1LOSA 4IMGA
chains in the Genus database with same CATH superfamily
3T05A 3NZ1A 2J6VA 1KW1A 3M0KA 1OZMA 2WBKA 4CN4A 1XLBA 4N9BA 1GYLA 1O1HA 1RJRA 3G3DA 1I2RA 5HATA 4H83A 2FIQA 4NNBA 2W92A 4C6DA 1DXFA 3WD2A 3GZAA 3MKVA 1J0YA 1GVIA 4NJJA 3GNXA 3WLTA 1O1ZA 1DYSA 1GQJA 5DCEA 3UR5A 4JTQA 5CJNA 1TZ7A 1KM6A 3DFYA 1G01A 5FEZA 1XUUA 2NQHA 3STCA 4PTNA 5E9XA 3A24A 3VGEA 1H1ZA 3AS3A 2W61A 1K6AA 2FJKA 1M3UA 4D6HA 2BP1A 3O16A 4AAJA 2CEQA 3BDKA 4PSRA 1UCWA 5D05A 3AS2A 3G24A 1BF2A 3E0IA 1XIMA 5EBAA 1AL8A 2CW6A 3NCOA 5DRCA 3GH5A 1ZP4A 4PTWA 3UY8A 1ZNNA 1FRBA 2J75A 1DQXA 2E3ZA 3DYOA 4F9JA 2I1OA 3O6CA 3FEMA 3HBLA 3QSRA 1TPC1 4JNYA 1LBMA 8TIMA 1WDRA 3PUOA 4W5ZA 3OTRA 3LYEA 1H7WA 4MNMA 2EQDA 3PWAA 3MYPA 4TMCA 3FA5A 3HU7A 1R3TA 3UYIA 3V5FA 4JTKA 3GIYA 3KVKA 2BGNE 1Z7AA 2GGGA 1M7XA 1W1PA 1UR1A 3PPFA 1HG3A 4LVBA 1XSIA 1HGYA 2CITA 4DYJA 3KBMA 1V3IA 1VCGA 4HSHA 4A8NA 1JPDX 3N4FA 3UWWA 2XN2A 3UGVA 3A5FA 4MHBA 6CGTA 3SSZA 3VCRA 1L6YA 1XS2A 2IXUA 4FXRA 1QT1A 3W7OA 1XISA 5J5RA 1O5QA 1Q5MA 3B9NA 4ZOCA 4RV8A 3OQEA 1J12A 4RDYA 3R8GA 1ZLPA 3PPHA 3INPA 5GQBA 5I00A 1DJGA 2WV8A 2QMKA 3GXNA 3U48A 2Q01A 1OFQA 3T6CA 4B15A 5K3VA 3QF0A 1U1HA 1T8QA 1J18A 4LNYA 3SCUA 5EPDA 1UB3A 4IJCA 3OU8A 3W86A 3IIPA 4O1DA 1EB3A 1GVFA 1Y7VA 4OHQA 2EO7A 2CHNA 2NXGA 3IUDA 3GIQA 5F7UA 3NTYA 1VPXA 4MF4A 5K9CA 3WD4A 3OG3A 4XB3A 1TG7A 3BLLA 2BVTA 3L4XA 2C18A 4HA4A 2B7QA 4GYKA 3MMDA 1EP1A 3AJ7A 2X1RA 2Y8VA 2X1SA 3DHUA 2GSHA 1Y0EA 3BZJA 2ZX7A 4GVFA 2PI6A 1R9XA 3HQOA 4OUEA 3NUKA 1UKOA 3N3MA 2GGJA 1IIHA 1F61A 2WJEA 1Y5XA 1W5OA 5A8PA 3PZIA 4ZCWA 4JFVA 2OEMA 4GUJA 3IJ7A 1F8IA 2QUMA 1W1YA 2Z2UA 1YHTA 3RO8A 4OQVA 1G6CA 4HKPA 5I3GA 4X60A 3C56A 1CNVA 5LIKX 1BTCA 3AU2A 3NXFA 4JCLA 4A3RA 2CLEA 3V35A 5LA1A 3OA3A 1OGSA 4WOQA 2X1IA 1IEIA 5AYBA 1VBHA 4LAZA 2NX9A 3W01A 3OYXA 4YYFA 2XH7A 2ZXDA 4FAMA 3W26A 4W7UA 1KTNA 3K4WA 1IE7C 3V1PA 4H9TA 1P6CA 3H2EA 1R87A 1E4IA 5MF5A 3A5VA 4M56A 2PDUA 4AVFA 2Y5EA 5FJPA 2F2HA 1RCQA 3VFLA 1TPDA 1U33A 3MI6A 3CUZA 4BI7A 4LOCA 2DUZA 3S5NA 2C8NA 2WPBA 1S3TC 4EIVA 3G1AA 3K5XA 2X0SA 1DIKA 3RLGA 2G3IA 5T9CE 2J24A 1HNYA 3TN3A 4FEZA 4MKSA 1R3QA 1XL9A 2GVYA 5AYIA 1OQFA 4H9MA 4PEEA 3N9KA 3LLDA 3WUFA 5A2BA 3S83A 1JUEA 1EUNA 4HA3A 3WF1A 2XHYA 2FYMA 2ZZ7A 4FPSA 3I68A 4LBUA 5G4EA 1Q6RA 5CSYA 1ZHAA 1E9YB 1IZJA 2O7QA 1NJJA 1FFQA 1OFDA 1KCLA 1XYBA 1QASA 1UZDA 3KCLA 4BR1A 1TPB1 3GU1A 4IQJA 4TR9A 2Y62A 4J5NA 3VOHA 2E77A 4TUFA 2G41A 2HXUA 1ESWA 1B30A 1Q2SA 3SAZA 4EACA 3LV5A 4H9YA 4ZA0A 1A5LC 1PWLA 1P5BA 2PPGA 4NYUA 3GFYA 4U28A 4WX2A 3RM4A 4GXWA 4PA8A 2WVUA 2X2YA 4ZOBA 3SBFA 1BRLB 2D3LA 2XTKA 1MW0A 1X7FA 3MHUA 3LI0A 5M5DA 4CQ8A 4JFWA 2WNZA 3OVPA 1XH2A 3R10A 4E8DA 2RGMA 3CPGA 3TAOA 2OFJA 1XLDA 4R53A 3G8EA 3TH6A 3EX3A 3BZGA 4HCDA 9XIMA 5T26A 5F2GA 1ODUA 3CTLA 2XWDA 1PZ1A 1TX0A 4PODA 3TJLA 4HD5A 4Q22A 1OYBA 1Q6LA 4Z1YA 1JYWA 2FZMA 3N2TA 4R5EA 4D6GA 1VPYA 4NJKA 2ZTKA 1KTCA 4L65A 4FF5A 2ZX5A 5BRPA 1TJ1A 7XIMA 2AOSA 1QNOA 3W1NA 3SN1A 3O07A 3W7RA 1YTDA 2PF0A 5EMUA 1RJPA 2CWNA 3BXWA 4XVEA 4FX6M 2F2KA 4DHGA 1RA0A 3NOYA 1B3VA 4QX4A 4MWAD 1YTEA 3DFPA 1DJWA 2DV0A 3F5KA 1I2PA 3MTWA 4UTTC 3PTDA 3LTSA 4E8CA 3KUMA 4LUSB 3A22A 3LMYA 3P14A 4DM1A 5IFPA 3GDRA 1VS1A 5E70A 5AC7A 4DJEA 2DT1A 1UD4A 4QLKA 3A23A 3QGKC 3LBOA 1X38A 2PA6A 1HKIA 4EE9A 2OO0A 5HWJA 1QCWA 2OR2A 1D2KA 3NL2A 1ZL1A 4EAYA 1A4LA 1OC6A 1PKLA 4HMNA 4QLLA 3EEZA 4BJHA 1PIGA 1V08A 4HYRA 2YBVA 5DMLA 5D9OA 2Y63A 1BGAA 4I6KA 5E6YA 2HBXA 1B9ZA 3OZPA 3RPMA 3L68A 5K9XA 4N9DA 2Y70A 1OYCA 2BXZA 3PPCA 2PUZA 2DH2A 1GZGA 4YU1A 2D2GA 3NQDA 4WJEA 3DHFA 3SUSA 3NQFA 2QJIA 2VZOA 1S3HA 5BRBA 5AOUA 4ZQRA 3IUIA 2OSYA 3EX6A 4XIAA 5BMXA 5CPSA 3UERA 3CUXA 4YCOA 3FK4A 4OKDA 2H90A 3VD3A 1FWNA 3GAYA 3E0LA 1T41A 4A35A 1KM2A 4C5YA 4EK7A 4AZ6A 2BGQA 1S46A 4GNKB 4AZ7A 5JIPA 1EZWA 1F6PA 4REQB 4WDTA 3JZUA 2W6RA 1LWJA 1TV4A 3DHPA 5J04A 4JOMA 4R85A 2J7HA 3I3DA 3KTXA 3W70A 2P76A 3AC0A 3RMJA 3GZ3A 1S2VA 4W86A 1H41A 2QIWA 4XO7A 4CQCA 2IKHA 2PD9A 4A2SA 1X6NA 3GNDA 1KGUA 1F07A 4A21A 3GHTA 2CZFA 2R1LA 4GY1A 4D71A 1JXKA 2NT0A 3ARQA 2DSKA 2A3HA 3JUGA 3ZVIA 1H7PA 3C86A 4PFMA 4UFHA 4RX0A 3T9PA 4URIA 3F5JA 2VOTA 2CLMA 1REQB 3AUOA 2ADAA 2HPMA 2VR2A 3F2BA 5C2CA 2IQTA 2PDQA 2OOGA 2XFWA 2A1YA 4OWGA 4AH7A 4GCXA 5C6MA 4NRRA 1SJDA 1BXBA 1DQWA 2B0MA 4Q33A 1KO0A 2PWFA 2JKPA 4Q8MA 4HCHA 4XWUA 1F74A 2RAGA 2XZ7A 4LQ1A 3UWUA 3AIBA 2CLHA 1TFVA 1TWIA 2VGGA 5I3DA 1UBPC 2YBUA 1J01A 1B9BA 3UESA 4FF7A 3UXIA 1A5MC 4QAWA 3AIEA 2BV9A 2P3ZA 3BG9A 1VIWA 4H2HA 4GNVA 4PUWA 4Z2HA 1QW9A 5A8NA 3MSRA 2DZPA 1T6MA 4DAFA 3LPGA 3P0WA 4ADTA 1EHAA 3WBEA 3I6RA 2RDUA 3CZKA 4UNKA 3E3HA 3UG5A 1A3HA 4AMAA 4ZE4A 3LHVA 2WJZA 5AVNA 1AJ0A 2WJDA 2X40A 3VGDA 4JTEA 2V81A 2C16A 3QY6A 1GKQA 4DBSA 4DQWA 5LXEA 3KM8A 2GJXA 4R7WA 5HQEA 2X30A 3DXIA 3W7HA 3PG8A 1Y65A 5EYWA 1Q2RA 1WBHA 2FVKA 4ZZ9A 4UMAA 4IPIA 2D0FA 1XFBA 4WXZA 3TWBA 2QMJA 3GD6A 1E55A 1Y8BA 1V6XA 1GQIA 3UFYA 3MSDA 1WZAA 3O0KA 2WXDM 4JN6A 5FESA 4J4KA 2ZWZA 1GOIA 3L2LA 4L4PA 1KM0A 3GDTA 4M51A 3RPDA 1VFFA 3IPWA 1RP8A 4PBEA 4I9MA 3K8KA 4PB5A 1KFBA 1UD3A 2GWNA 1US2A 3M5VA 2QCHA 3EX2A 1AW2A 4RE3A 1IT7A 2FB2A 5JBEA 3WFAA 5AYYA 2ISFA 1DWHM 5GVJA 1ZJAA 2V5BA 2FTYA 4XO6A 3CUHA 1QWGA 4HJFA 1LL7A 3U6WA 2WKJA 4I9TA 1NOUA 4DEFA 2EG7A 4O0KA 3AAMA 1NWRA 2VZTA 3TFCA 4JFTA 3UWYA 4YN5A 1O5KA 4QROA 1A50A 4D8LA 1R9ZA 3LX9A 4F0SA 4AD2A 1JI1A 1PE1A 2G4FA 6REQB 3VKKA 4HBKA 1MXDA 3FXYA 4ZQCA 3L0KA 3LM3A 3I6EA 3AIVA 5GNYA 3NDYA 4IIEA 3W6MA 5AHIA 4S39A 1CXIA 5MHBA 1KXTA 4UOZA 3M0YA 5F4SA 3IRSA 3OIHA 1TTJA 3MI2A 4JPGA 5HNRA 4PULA 4P7NA 2HDJA 1NEYA 3T1GA 4L6OA 4NNAA 3WLLA 1PVNA 4P8XA 1TVPA 4QJ1A 4W87A 1FHUA 3FKKA 1KA9F 1P7TA 2JK2A 5A6JA 4Z2LA 1TR1A 4W8BA 3EX4A 4AG0A 3TK7A 3SCTA 2CZVA 3QQ1A 1J0ZA 1JAEA 2VUNA 3O8AA 2NSOA 2NQ5A 3W1MA 4DZHA 2Z2AA 2OKTA 1J0HA 3ABQA 5DT7A 4V33A 1ZJHA 4KRTA 1OBAA 3LB0A 4KCTA 1HO4A 4ROPA 1LBFA 4PMRA 1EQPA 2AKZA 5DXYA 2PTYA 2Z1SA 4Z17A 1DJYA 4QR6A 4E3VA 5F2LA 3QR3A 7CGTA 2TSYA 4P2VA 1FCBA 4MNKA 3RCMA 2C1HA 4FLSA 4DWSC 2PODA 4X3ZA 3WG6A 3NWRA 4QCFA 1HFBA 4GRSA 3O1NA 2C7FA 1EWDA 1KRMA 4Z2KA 4KERA 1PTDA 1XJBA 5KZMA 5CH9A 1LT7A 1WXZA 2R1NA 1HW6A 4A3YA 4J7RA 4XAYA 4Q8TA 4LC8A 1MW2A 1XLEA 2I7GA 2A3AA 5FI8A 4D6FA 2WVTA 1JAKA 4TX9A 4IMCA 1BFNA 3WZ0E 3RRAA 3N19B 4GUGA 1Z3NA 2WZIA 2NVCA 4EP8C 5CC3A 2BODX 3ZT6A 3WNOA 3IS4A 1XIGA 4U3CA 4DI9A 3RCNA 3B04A 3T7VA 1JJKA 4F0LA 1KM4A 3LRKA 4JTGA 1M03A 1S38A 3LTPA 1YADA 1I9CB 1NOFA 1WZKA 4P8UA 3HQPA 1EBHA 4DUVA 3BAXA 3PZOA 1JD7A 4I8YA 3S1UA 1YX1A 3PBMA 1BD0A 5HUPA 1XDJA 1NWTA 2PDIA 7REQA 5CJMA 3TNBA 3WQEA 3ARVA 4DM2A 4L9YA 2ZRUA 3BUVA 4O53A 4XBSA 4OT7A 2GZXA 1XH1A 3WFLA 4GKLA 2O9TA 2F61A 3LS9A 1K8YA 3NM3A 4N4QA 3W1QA 3TYAA 5FAJA 4NKCA 1U5JA 3OGVA 3QPYA 3NVTA 4HHMA 3K1DA 3W53A 3OVGA 4ASTA 1FBAA 1LBLA 5HPCA 6XIAA 1OT1A 4G2DA 3ISIX 1QMLA 4QGCA 3FSUA 2YW4A 3MBFA 3B0UX 1UQYA 3UCQA 2J25A 2TAAA 4Z2GA 1WKFA 1W5QA 5F1UA 2WKGA 3S1WA 3N2XA 5IDIA 4AUBA 2CXGA 1KFEA 1GCYA 4XUGA 1OINA 3MHFA 5HQMA 3WDIA 2CZ5A 4PCTA 3PJWA 1OG6A 2PBOA 3CZJA 4MDPA 3EXRA 3H4GA 3T55A 4GACA 1W2VA 4LF2A 3P5ZA 1R5YA 4X9SA 1YRRA 3GDLA 3VIGA 4IX2A 4NZCA 1JCLA 2EG6A 2X42A 2W3ZA 4GQGA 2PEVA 5BXRA 1F3TA 4PTMA 4R3UA 3GG0A 1HL9A 3STPA 3T44A 3ZIZA 2VEFA 3H26A 1OC5A 4N6EA 4NX0A 4XIMA 5LIYX 1DIOA 3N73A 1VRDA 2YSWA 2EPKX 3T0AA 3STFA 1FWAC 2CLOA 2FZNA 2QUTA 4JL1A 2V8ZA 4JKMA 3C2OA 4C1NB 1H11A 1UH3A 3G6MA 2DUXA 4ZODA 2O9OA 3ARSA 5I23A 2VEMA 2ZCGA 4PMQA 2Y8UA 4C6FA 2DGAA 4WZHA 3G0XA 3IIXA 3MS8A 4XISA 2O4MA 3DERA 1XYFA 2E9BA 3LOTA 3T4CA 3ATYA 4MFDA 4IXHA 3NDOA 4PL2A 2QIIA 1XSJA 5I07A 1JL8A 1GZJA 1ZALA 2VUYA 3CT2A 3TW6A 3WLOA 3ONCA 1FTXA 4D8AA 5B7ZA 3UWVA 1JCYA 1GVQA 4XD3A 1XYLA 1VYRA 3DG7A 2HROA 3F5LA 5KITA 3BH4A 1DXEA 3GTFA 1ONXA 1R46A 4O10A 4HMEA 3SI9A 2GVLA 3ZWTA 3VPLA 4AMCA 1S5TA 3LHYA 4HGXA 2Y8KA 5EU9A 1MW3A 3THAA 1M41A 2D2JA 1MUMA 3GVRA 3CNYA 2JEPA 3DKJA 2DZBA 2EPHA 2QCDA 1J93A 4UTIA 4NZ1A 1FWSA 3C52A 4LCRA 3W2NA 2VX4A 2DSZA 1L6WA 4JX5A 1HGWA 4FX7A 1VFHA 1M68A 2YYUA 4B9YA 1B3YA 4GJ1A 3TW7A 1WKEA 3MU7A 2X09A 4LH8A 4AWTA 3RPTA 1MUCA 2WOQA 3UETA 3WQWA 3W4RA 3CTTA 1TWSA 1A47A 3I10A 4H3DA 2ISSA 3W2KA 1H1NA 3V3WA 2IPJA 4AHOA 4RDWA 5DANA 5M3WA 2VJXA 3AROA 4P5UA 1B5TA 3WQ8A 2DZUA 4C1KA 2C1GA 4C6LA 1GHSA 4J35A 3SCQA 2DZWA 3UQNA 3R58A 2WWDA 2YGYA 3PSVA 1KFJA 1TPWA 1HQTA 2GSEA 4TX6A 2OSXA 5XIMA 3LCFA 3RR4A 4IP7A 2WYSA 2OLSA 1ITXA 3A6OA 1X8CA 1ENUA 1LLOA 4ILSA 4B5UA 3XIMA 4WD0A 3O6AA 1FXQA 3KFTA 4RCXA 1DJQA 4Q4QA 3TLLA 1FWEC 1W9PA 3O7UA 3TA9A 3W74A 2VEGA 4UQ9A 2HQAA 1XDMA 1ME7A 1AZ2A 4GQRA 3CB3A 1ZPTA 3C2RA 6ALDA 3MWCA 4JHMA 4RZ5A 1TMHA 5D30A 2C79A 1JR1A 3HO8A 3H7RA 1J0KA 4AXKA 3WEZA 3ITGA 3BMVA 3M6YA 3VUSA 1J96A 1XKJA 4IIHA 2Z29A 1K7FA 1XIIA 4RE0A 4PMYA 3UR7A 4GH1A 4K1WA 1Q6FA 3OW1A 2FQIA 2VM8A 5JU6A 3IJLA 1H7OA 5H8MA 4S3BA 2HCVA 3M07A 2IPFA 2WSPA 3UZYA 4PL1A 3FN9A 4EXBA 5C70A 1XF0A 1TQJA 3ID7A 1VJIA 5HDRA 4NZFA 4O18A 3GU9A 5JH2A 5AZ0A 1OK6A 4S3CA 1GVEA 4IICA 4QHRA 1C7TA 1PZ3A 3W7MA 1PIFA 2PRLA 3CUFA 2CLIA 1XD1A 3G0UA 1RA5A 1ZCOA 4BY3A 2QCMA 2VYOA 1PUDA 5DCBA 1F3WA 4NHVA 1DE6A 3PPGA 1XGDA 4HHLA 4GC3A 3S1VA 1ECEA 4N9EA 3BO9A 3VM5A 4FIQA 2UY3A 4R34A 4W89A 3MMWA 4M5PA 2PDGA 1K8XA 3C5QA 2V67A 3S2NA 1QUMA 1B57A 3QPEA 1XYMA 5CPLA 4PSPA 4WHBA 3RITA 1LQ0A 5GJPA 4RNIA 2QJHA 5E0FA 2PTXA 2JFEX 3BV7A 1PZ0A 5F2MA 3SY1A 3W22A 3A3XA 1GPWA 1LUCB 2G50A 4LPCA 3GRIA 1RPXA 1XKYA 3W6LA 3KOYA 2QPSA 1IT0A 4X22A 3QKZA 3LBCA 4IIBA 1W6TA 1VYSX 4BEUA 4A29A 1JPIA 4H1ZA 1ICPA 4D6IA 4WF7A 2XFRA 3P82A 1V77A 1HL8A 4A05A 2RHGA 3M0ZA 4U5KA 5JBDA 1CGXA 5HAOA 1XPYA 2E67A 1FHDA 3MP3A 2JGQA 1A5UA 3UVAA 3IK2A 3H53A 4U5IA 3VX0A 1IXOA 1ZUAX 3QHNA 1ALDA 1W32A 2AL2A 3EXTA 2VL4A 3LTYA 4O8AA 3BG5A 3OZYA 3EOUA 4JTFA 2YL8A 4D8ZA 3U57A 4FNSA 2XFFA 3NFUA 4FLQA 3HG5A 3DBNA 9RUBA 1XSKA 1QTWA 3GB6A 5LNVA 2OOFA 2IPGA 3WDPP 1A0CA 2VFDA 2ZICA 3CH0A 1I1WA 2BASA 1UYQA 1IEWA 1G7VA 1W54A 2X8RA 3AYRA 4NASA 3IJIA 2INZA 4AY7A 2QPXA 1SZEA 2QS8A 3MUZ1 1MYRA 3N3TA 3B9AA 4G7EB 5E0CA 2PDLA 3BGJA 3RX4A 5FCZA 1A5BA 4TVUA 3E2SA 4P7RA 3HZ3A 3GW3A 4QCEA 1XI3A 2CYGA 3ARPA 5M17A 4LWWA 3NQGA 5K2ZA 1V03A 5KMYA 5LIWX 4FXSA 2F7FA 3BAIA 4TQTA 5CG0A 3C2VA 1J10A 3WDJA 4HU4A 1FWIC 4JNMA 4MJMA 2CKSA 2NUWA 1FCQA 3N2MA 4HOZA 3V0UA 4K8HA 4Q7BA 5BROA 1VIZA 3PZGA 3WNPA 1EF2A 3M46A 4CU8A 4FK9A 3B8WA 2BOEX 4PCSA 3F4NA 3AXIA 3PK7A 1AH0A 2WSQA 1IV8A 3WQ6A 4ACYA 4GINA 4IPLA 4XAPA 1WUEA 1E5NA 2Y2WA 1NTHA 1V6TA 3T4WA 2WVVB 2OGJA 2XIJA 4AXNA 4NRSA 1V3HA 2L5HA 1CXHA 3O0FA 5DO8A 3KP0A 4LB4A 2FHFA 4JTUA 3PFRA 1LOSA 4IMGA 5FEWA 4CD5A 1HP5A 3G1RA 3R25A 1FCVA 4OJYA 2BY0A 3KWXA 5BU9A 4B2DA 1R86A 2IQ0A 1O12A 1W1B1 3IGXA 4WOZA 3WUGA 4IGHA 3TAKA 3PS7A 2E9MA 4GIYA 4OGZA 5A5WA 4TX8A 4LFYA 4AWEA 3SR7A 4HNVA 1SR0A 3VZXA 1UA3A 4BFAA 2WZTA 3GG1A 3VKBA 2I5GA 2Y85A 1IYXA 2GQ9A 1WA3A 2IUZA 5AY7A 3BLDA 4CVWA 4D1IA 4GY0A 3LRLA 1K03A 3A3HA 1XLIA 4FS9A 3W1LA 3AYTA 3H70A 1UPMB 4NX5A 4B5XA 1VFSA 4ORIA 3GVVA 3FXGA 1DJNA 2J78A 3N9RA 3LXAA 4BI5A 1IR2A 4FX8A 1JPHA 2PDHA 1VGAA 1XBYA 2ALRA 4W8LA 1C8QA 1BPLB 5M03A 2FHCA 4YL2A 3DI0A 4UXDA 2OXNA 5I3IA 3R4IA 1UWSA 3VD9A 5I77A 1NWSA 2VCBA 1OCNA 4NP7A 5BMWA 5KZ6A 3LQLA 4QLJA 3WQFA 1R3WA 1P0EA 4AZBA 1ZB5A 4K37A 1R7AA 1WXJA 1YPIA 5DMYA 3EA1A 3CZGA 1IF2A 4IX0A 3T0TA 3WIJA 1GONA 2CXEA 1YMYA 2Y0FA 2XVGA 1RY0A 2PP3A 4X0NA 3U5UA 3M7WA 2GOUA 1XBXA 3WDQA 2OEJA 1V6YA 2ABAA 2OU4A 1UD8A 1EEXA 1KRBC 1OX4A 3QR1A 4PMXA 3FAXA 4MJZA 2HEJA 3E02A 2E25A 1JNEA 1DJZA 1RQEA 2Q8XA 2DT2A 2XIIA 5CQ1A 4J9JA 5HANA 2R24A 1EP2A 2IW0A 3U4AA 2HISA 4O13A 1BG4A 2HE8A 1XD0A 5K7JA 2BZNA 4MB1A 1HP4A 1UR4A 1JQXA 1SSDA 1Q3NA 3EDJA 3RLVA 3NQMA 3L5LA 1A5NC 1QBAA 3WQ5A 1YQ2A 5BXTA 1AODA 1YEYA 4JYDA 3WLQA 3C4UA 1UA7A 4ZL1A 1V93A 1S5VA 3TP4A 3T07A 3WK0A 4G6CA 1UH4A 4MPQA 2JE8A 3S9YA 1Z6KA 4O0QA 1JQVA 1GT8A 2FFIA 4IQLA 3WX7A 4EANA 4JHZA 1KB3A 5HULA 2FVMA 3PBGA 1NQKA 1JF5A 4ZOAA 3B0VC 1H60A 4G1NA 2WCGA 1PPIA 2HS8A 4BKNA 2BOGX 2W91A 3COTA 2ZE0A 3EGJA 4DUXA 1L9WA 2QCCA 1E9ZB 2DJLA 3ZLGA 4YNGA 3DFSA 3JU2A 4RNHA 3PB2A 1FOBA 4Q4PA 3UJ2A 3TWAA 5DBUA 5EGRA 4AZGA 5H8PA 3W1UA 2XIMA 1XLFA 1VZWA 4MNJA 2GGEA 3B06A 4N7QA 3QLDA 1UR9A 4WY0F 2BWGA 1ZAIA 3FDKA 4B16A 1RR2A 1UKPA 3QXBA 1FWFC 1XIBA 1YBQA 3QV8A 3WH6A 4XZIA 5REQB 3W6YA 3LXCA 4YVPA 3M47A 1PYFA 4PCFA 4S3EA 1T8XA 3THQA 1UJPA 3LNMA 3BW2A 1ONWA 1TREA 2YBTA 1SUXA 1V3KA 1R3YA 1LOQA 1IEQA 1UWAA 3MVTA 3CPUA 2CESA 1SFTA 1TV7A 1FWCC 1V5XA 3E5PA 4YMZA 4EXAA 5CSUA 1A4MA 1EDGA 3DUGA 3NR0A 5A8QA 1ODZA 5CZSA 2OTDA 1S1RA 3ALFA 4R88A 3B8DA 3K2GA 4DWSD 4JQ3A 2DQXA 2OLHA 1F05A 3W84A 5F1VA 3W02A 3LA4A 4BQ5A 4CEUC 3F2CA 2NX3A 1G4TA 2ZZ3A 1V3MA 1I2NA 4L56A 3AMCA 2CIPA 3FEQA 5CGTA 3OVRA 4JIPA 4C6OA 1SM9A 3UF9A 4GLEA 3TE9A 1F5ZA 4HIBA 1XINA 3O15A 1XCXA 2PLCA 4GKTA 5D9PA 3W7DA 1LM1A 4BF7A 4WR3A 4FNRA 3TFXA 5I3HA 4EOUA 4DWDA 2DT3A 4AD1A 1OGGA 2NLIA 5I2UA 3KCJA 1SW3A 5DN1A 4U4MA 1PWMA 1UKTA 3CC1A 5CZTA 3HGOA 2J9YA 3NSXA 4PMOA 1S5WA 2ISWA 3SIZA 1QPQA 1XIJA 1N55A 4AF0B 5FF0A 1LORA 1S2CA 5A6BA 5C9XA 3EOSA 1I2QA 4JS3A 2C1IA 1O68A 4EXQA 4NAFA 3CAVA 1LOLA 1GTEA 1HTIA 3PTQA 1E1EA 2WHJA 1JIBA 4CCCA 3VKJA 4CLMA 3F2DA 1NDYA 4TU1A 1KM5A 3THUA 3NURA 3CV6A 3I3EA 1CGYA 3U2EA 1W5MA 2GJXB 1WO2A 1U1JA 3S5SA 4F66A 4R7JA 3BG3A 2NZLA 5D2TA 1L2UA 3PBVA 3O6YX 4B91A 1P0KA 3SB0A 4ZFMA 1RK6A 1B90A 2XH2A 2GGIA 2E8YA 3PZMA 1TKKA 3BICA 4KFOA 3N1AA 5B80A 3EMQA 1UWQA 2X1TA 4ERAA 4JAWA 3CUGA 1DWIM 3SY5A 4O52A 3LPOA 3T0DA 2FPYA 4QISA 2EGZA 4LY8A 1J6OA 2OX4A 4GABA 3M0XA 3BGAA 4JXCA 2EPMX 1P48A 2EXOA 3LY0A 3K1GA 5HXMA 4XSLA 2XM2A 3FY1A 5LHFA 4JDYA 4CQAA 1RPKA 2Z1WA 3NL3A 2D2HA 3EEGA 4QFUA 3S6OA 4BK9A 3TROA 4YHEA 4NY2A 2OZ3A 4K6AA 1EPVA 5HMEA 4NL1A 2V6AA 1E73M 4DJFC 4HU8A 4JYFA 3SURA 1SSGA 3GUWA 1WV2A 2BHUA 1ZBWA 1T99A 1BWVA 4RW3A 4UC5A 4AVOA 3UY7A 4NZ3A 3BMXA 2QULA 4A22A 2AQWA 1FWRA 3H54A 1VF8A 2X2GA 1KXHA 1CENA 1TA3A 1AQHA 1AW1A 1WYIA 2F6XA 4H4IA 3PWGA 5A2AA 3NSMA 1PS9A 1ZFJA 4BF9A 1TWWA 3W83A 1SW0A 1YDYA 4OBTA 3CHFA 3M6DA 1W8GA 1D3HA 3HA1A 1EJ7L 2ZZ1A 1E72M 3MA8A 1N8WA 1UASA 2QVNA 3IVTA 3EDDA 2OQYA 4Q4KA 4RDZA 3EB2A 1WB0A 4F79A 2WC3A 3RYSA 4RJEA 2YXXA 3PULA 3W82A 3WKZA 6TAAA 3QGAC 1GOMA 4QEEA 3QSTA 4ICMA 1U30A 1VEPA 1P7TB 3SO7A 3FA3A 2PWEA 3R89A 4UR8A 5KTLA 5C8BB 3BANA 2VX7A 2YFOA 4J2PA 1DKWA 3FKRA 4LUIA 4GIAA 4WCJA 1ZJBA 1E56A 1MDLA 2H6RA 1E1FA 3I65A 5T9BG 2BTMA 2LLEA 4J1OA 3CO4A 3CQIA 2C6QA 4EPEC 4AZ5A 3ZWSA 2Q8LA 2E6DA 4DUWA 5LNSA 2PDBA 1WP6A 3ZR5A 4HZ6A 1ISXA 1RP9A 2QEZA 2QF7A 4XBJA 3W29A 1DQUA 2WQDA 3FYPA 4S3FA 4ML4A 5HJXA 3WLIA 3T42A 3HGJA 3NZGA 1BYBA 3WH7A 4HPJA 2HWGA 3DENA 4C90A 2DEPA 2ACUA 3ARXA 3C3UA 4QS6A 3WLHA 4EAMA 1EJUC 3APTA 2E4TA 3W9ZA 5J5DA 1EFZA 4LS0A 4JBRA 4YTQA 4N0RA 3PFMA 3IJ6A 1YW1A 3W75A 3BE7A 2B81A 2PP0A 3R5EA 5FACA 3NAVA 1EL3A 3LRMA 2DZXA 3CHDA 3GHSA 1RUSA 4UQCA 1HVQA 2QW5A 1L6GA 2BSLA 3W7JA 1F4HA 2H8XA 4M6UA 3CQ0A 3VDHA 3AHYA 3W7GA 3K13A 4PMVA 2A79A 4L1GA 3P67A 1I2OA 1FCUA 5BWAA 1VH7A 1CXFA 3VCNA 3WUBA 4GI8A 6XIMA 1PAMA 3DG3A 1SPQA 4C6MA 1IQ8A 4C5ZA 4KCUA 1JF6A 2P88A 2R94A 1O5XA 2FZDA 4MNLA 5I0DA 2QF8A 4CQBA 1PO9A 2J8GA 2V9DA 4QQ3A 2XN0A 2FGZA 4P8VA 4ZSTA 1ADOA 3VKCA 4DO6A 3W3OA 1OFEA 3HPAA 4ZQMA 2E6FA 3M41A 1V0LA 3A4WA 4QP0A 1XRTA 1ZRQA 2FPTA 2VP8A 3W7EA 3P74A 1H7NA 4K3ZA 4Q4RA 3ABXA 4LALA 2VEPA 3MKKA 1B3XA 4O57A 4H8NA 2ZTJA 2JGYA 1XYCA 5BYWA 4IISA 5FJTA 1W8SA 4M1BA 3GH4A 5AFDA 3DEQA 2ATMA 4L1WA 3SM0A 2AAMA 3F4DA 5FJJA 4PYSA 2FTPA 3LLXA 1DL3A 2PWDA 3FS2A 5CC6A 3S5YA 4DVOA 1NARA 4JCMA 4MSSA 3ZJ7A 5HWMA 4FOUA 1QNPA 2BB0A 5XIAA 1EJXC 1GG0A 5G2WA 2QHAA 3AU6A 3ZJKA 5GJNA 4Q4MA 1XUZA 2C0AA 2G96A 2RKXA 5AECA 3TR9A 3PR2A 4IQEA 1NDZA 4OE7A 1S1PA 4GIEA 3RFAA 3DDMA 4PMNA 3TYUA 2YDQA 3WH5A 5HJLA 4GYPA 1M7OA 2RH9A 2PC8A 1MEHA 1E6SM 3EZ4A 1FVPA 1UHVA 4NU7A 2GQ8A 4Q8QA 1K6WA 3AO0A 3LG3A 4QNWA 1R3VA 1S39A 1IZCA 2VX6A 3VZZA 5HNTA 1QXLA 2J7CA 3MZ2A 3RN6A 1JZ5A 1UP2A 1WUFA 4L61A 1JI2A 5KEZA 4S3GA 1MUWA 3RILA 5HWNA 2XIOA 3QYSA 3P2VA 2PCQA 4MUPA 2VQTA 1JZ3A 4MY1A 1NF0A 2R91A 2Y5JA 3RJYA 3RU6A 2Y24A 1GWJA 2QUNA 4N9CA 1CZ1A 1F76A 4A3UA 1W3HA 4TTUA 3H7UA 3WELA 2Q09A 3NZQA 3LM7A 5H8UA 2I56A 3KHJA 4BHYA 3K30A 2XGZA 3W76A 3QMRA 3G18A 3R11A 4TTGA 1YE4A 3M5YA 2XSBA 2XPKA 4M1RA 1OB0A 3P84A 3UWZA 1X7IA 1GEHA 4QDMA 3QOMA 4L1XA 4Q8OA 1RLCL 2XJ7A 3ICJA 3OB8A 1Z9AA 4GGHA 4LBRA 1OF6A 3ELFA 3KLKA 4WKFA 4PCPA 3PZQA 3VMPA 4GIRA 5DMMA 4I7VA 3TU9A 5D9MA 2DUAA 5IM51 3BURA 4DYEA 4LNCA 1M01A 3OO2A 3MW7A 1MNZA 1V7YA 3AALA 3KRZA 1EO7A 3VOGA 2YDRA 3UXDA 2VVSA 3ARWA 1TR9A 4LVAA 3MPGA 2ZXBA 1Q45A 3BAJA 1SFJA 4O28A 1K7EA 1U5HA 1J0IA 4MUZA 1A53A 2PWUA 3VIJA 3CIVA 3V0SA 4UTWA 5IHRA 5CZ0A 1BYAA 4D2JA 1DOSA 2QCDB 4L4OA 3DFTA 3MANA 4R33A 1KBLA 1CPUA 1VC4A 5A6LA 4FR6A 4MB3A 3NQEA 1SO3A 2FZBA 3DFQA 2J9ZA 4LX4A 2Z1BA 1IWAA 3MCOA 4CNNA 1YE6A 5CPMA 1WX0A 3GTHA 1WOAA 1LLWA 3HG2A 5ECUA 2OT0A 1O7AA 4UZSA 1XM3A 4UFIA 3SGUA 3HFTA 1YDVA 2J88A 2J7EA 4KCWA 3KRBA 2XSAA 3KLLA 3UJRA 2ZUNA 2O9PA 3QMSA 2H8ZA 3LNPA 4WUIA 4DBUA 5BW6A 2PTZA 2F38A 3VCCA 1KBKA 1DTNA 4ICCX 3SUVA 3H2MA 1E0UA 2CERA 2DY3A 4I9JA 3M0MA 4FR1A 3CWHA 3RLHA 3VNLA 2YDAA 1TUFA 1OCBA 4JKLA 2HS6A 1WQ5A 1ZJIA 4BQ2A 4XKYB 3MWAA 3LI1A 1X39A 5CPQA 4B5WA 2MNRA 4E4PA 4PGLA 5LNUA 2ISDA 5E1QA 2KAUC 4IM4A 5FKYA 1GQNA 2A7PA 4IHCA 1K3UA 2QDGA 3H2NA 4H01A 4TMBA 1W3IA 4W85A 3BW4A 2Y7EA 5G4WA 1KR0A 1VAHA 3U2ZA 4CNTA 1Q4WA 3W37A 1WAWA 2XWEA 3BLOA 1EGZA 1VP5A 2J47A 4BQ3A 3MBDA 4YXGA 3MSYA 5EY5A 4Z1CA 5JIWA 4JZ5A 1PDYA 4V1YA 4LEFA 3ZR4A 1VCVA 1V4YA 1W5PA 5FSDC 2PDYA 3TUUA 1Y5WA 4LSBA 3CQJA 1HVXA 1A5CA 4IG2B 4KWVA 3BSMA 1A49A 5CZKA 4U31A 2PC4A 4PC8A 3RM9A 5F2IA 4JN8A 3LGEA 4Q3MA 2WVSA 5HMSA 1K1DA 2PURA 3XISA 1EOMA 2FZ8A 1W1ZA 1KGWA 3WF0A 4G56A 3GM8A 4GPNA 2Z7KA 4QG8A 3AISA 1V02A 2CC0A 1N2VA 7PTDA 3FHAA 2ZUUA 5D38A 2VFIA 1BXNA 3UCCA 3OEXA 3LV6A 3AOFA 5I09A 3CZLA 4ZSUA 1GUVA 1P4CA 4MDOA 3MHGA 3VMOA 4J40A 2HBVA 4M6PA 2R9RA 4BWLC 4RL3A 1R6WA 2PDJA 2Z24A 3TMQA 3W23A 5EMMA 3PZNA 3L7RA 2YW3A 3KTCA 5AC8A 1IXNA 2QUVA 5IBXA 1OCJA 3VIMA 3V4BA 1FDZA 1TRDA 2PP1A 4UQEA 3KWSA 4KPLA 1BEUA 1TVLA 3WQOA 3SFWA 3GK0A 1W91A 1JYXA 1JRBA 2GGHA 3R13A 1FFRA 1J11A 2H3BA 3QKEA 2NWRA 1HKMA 3OLDA 1B54A 1P43A 4XAGA 2PB1A 3IANA 4DO5A 3QN3A 3KAOA 2YB1A 3C8FA 3PUDA 4C60A 2WMJA 3ERPA 2I14A 5I24A 1EWEA 3M5ZA 1I1XA 4GO8A 4GZJA 4X9YA 3MQTA 1W31A 2G5WA 3H7VA 1XC6A 1HKVA 3PWIA 3WFZA 1Q6OA 5J8LA 4GUIA 4PBGA 3J7HA 2VKZG 2OELA 1B1YA 2GK1B 3VA8A 3CMJA 4KWOA 2NX1A 2WO5A 3PJTA 1TPEA 3VAVA 5A6KA 3JRKA 1E4NA 2VXNA 1PXGA 4K8EA 3K8LA 3NSNA 4C6QA 1JCTA 2AAAA 4FLOA 1F3XA 3N18A 3TN6A 1DWGM 4EF8A 1JDEA 5G1YA 4FA3A 3CL6A 3FDGA 3OBAA 1W1VA 1QU4A 3SRDA 1ITUA 4WGHA 3SN4A 5KSWA 3MCMA 2D1ZA 3C61A 1DJHA 2WHMA 4X2PA 3EDFA 3EMZA 5D2VA 2OGYA 3CYVA 1EC9A 3CAWA 3Q58A 4ECLA 4NI8A 1SFLA 2RFGA 4XD6A 3CMFA 3N2OA 2OPJA 1V3JA 2C91A 4LC6A 3EYPA 3B4UA 1XR2A 1RY8A 2GQ3A 1SU5A 1JPKA 1K77A 5FF4A 2CKRA 1EEPA 1XLLA 1QO2A 2GOKA 1PKNA 3W2MA 1E9IA 1FY6A 4V27A 2VD9A 1Q6QA 3RG6A 4ATDA 4W93A 4Z08A 2XM1A 4GUHA 1JZ4A 4UNLA 1EPXA 3TYDA 1UR0A 2BY3A 3NVDA 3QGVA 1OEPA 4H8VA 8RUCA 1MXSA 2E5CA 4JQAA 2O0TA 2Q71A 4LAOA 1SJAA 4IUGA 4HNUA 4HOXA 5A6BD 4LJ3A 4I7UA 4AB4A 3BLPX 3VNJA 3PVFA 4RXFA 2PFHA 3USZA 3D6NA 3AICA 3G0SA 1UKSA 3BL3A 1FDJA 3GR4A 3WBYA 1UR8A 4LUSA 4RPPA 5AYXA 1KV5A 2HK0A 5C71A 4CNUA 5E0KA 3RAOA 4PRWA 1IWBA 3UYCA 2O56A 3QV6A 2ZRZA 4ZVJA 2VGIA 4RUBA 1OJXA 3MDUA 1U1UA 1FQ0A 1EC8A 4EPKA 3K46A 3C0QA 1DWJM 4GG9A 3QR0A 1CLKA 3TCEA 4LGXA 1D3CA 4XAFA 3SSJA 3URAA 3GBDA 1W9BM 4AVNA 1LZOA 3L4UA 4HQVA 4CCZA 4IMDA 3WK3A 4E2BA 1LROA 1Q7ZA 4GXMA 3GNNA 5ABFB 4ADSA 3RR1A 4S3DA 4AZCB 4RR4A 3WQCA 1PX3A 1B4EA 4M29A 5U7SA 2FZ9A 4QJ4B 1MEWA 9XIAA 5EFFA 1UWRA 3NPXA 1BWKA 2DORA 2IKJA 3EKZA 2Z00A 2ZE3A 1MVYA 3T2QA 1XQLA 2GDUA 3G77A 2ZZ2A 1CX9A 4BQ4A 4MZ1A 2ZZ4A 3EWWA 5AVHA 2OZ0A 3GTXA 3VOCA 1JUBA 3WJWA 2Z1VA 3UZJA 1AD1A 1YNQA 4MB5A 3NQCA 4JD4A 4O1FA 3VNIA 4LEQA 2YX0A 4G9PA 3BCDA 4M8UA 4AWSA 2ZBTA 4AEOA 4OOUA 2Y4SA 1B3WA 4WKHA 2J8TA 1JCJA 7TAAA 2ZRXA 4NNCA 4GZEA 1BAGA 3M4HA 3IAPA 1H1YA 3E0WA 4GYFA 3ZYZA 2QUUA 3QZ6A 3NXLA 3S1XA 5FAGA 1J9YA 2GUYA 1A0DA 3W7QA 3GDKA 4YYCA 3ZT5A 5HNUA 3HTWA 4NZJA 3CB8A 2VDHA 1PDZA 2I16A 4AYSA 4TVCA 2IS7A 2GUUA 3GR8A 2VGFA 4Y9OA 1HXJA 4D6JA 4ZMGA 4CN1A 3IVUA 3I7SA 4JTLA 3VIFA 3V5CA 4M6VA 2VWSA 2F8QA 1RD5A 4W88A 4ZB5A 3P6LA 1E4LA 3NGJA 3GTNA 4AEEA 1XX1A 4LVFA 3LHZA 1REQA 1QOQA 1XW8A 2W66A 1TMQA 4F0RA 3G5EA 3TYEA 1SFSA 3HJEA 3TOYA 3OQ8A 2JIWA 4LS1A 3AWNA 4KRUA 4O8RA 1J5SA 4DJFD 1W3KA 1F6YA 4H6RA 1ECQA 1C8XA 3ITYA 3WLPA 2DSUA 4LU0A 4XK2A 3NA8A 3A13A 4DLMA 4DJDC 1H63A 5EMLA 1QATA 1XH0A 3JZEA 4Y8FA 2DZSA 5FJRA 5C5YA 1OG0A 2P0IA 2YKKA 3CQKA 2OYKA 1DE5A 3CEUA 1X1NA 1K7XA 4JIIX 3DZ1A 1YPFA 3WBWA 1FKWA 2BXVA 4NXKA 4AIUA 4E8GA 5C9ZA 3AMGA 1L8NA 1FX6A 2HZGA 4LF1A 3N14A 2IXVA 3VNMA 4B92A 1HIZA 4H7VA 4J3XA 4UFJA 3WF4A 2Y5SA 3KOFA 3VNZA 4IGSA 4IIDA 1OIFA 4PUUA 4HCLA 3FNDA 1EQCA 1E51A 5EKYA 4IMEA 4KBXA 1KNWA 1JDCA 2E6AA 3BLIA 3WUEA 3E49A 4D72A 5I6SA 1G0CA 4W4QA 1HN1A 4FNUA 4QJ3B 1UWTA 2HRWA 3U5YA 4HVXA 1LRQA 3VZYA 3RMEA 1JULA 1CCWB 4M80A 4E4FA 3B03A 3QLLA 2IKGA 1JGIA 2ZUTA 2B4GA 1YBQB 4F48A 4PMZA 4YJ5A 1X97A 2PGFA 4ZE5A 4F0MA 3QY7A 3VDAA 4CU6A 4MTVA 1QK2A 3NEVA 1I60A 1BQGA 5E09A 4JL2A 3N2CA 4P7OA 4B5VA 1IWPA 1IT8A 5AHNA 4IP5A 2F84A 4CD8A 3IV3A 2DH3A 3Q45A 3VC6A 1X1ZA 1QNVA 1P0NA 4ML9A 3KBNA 4FLRA 3U2OA 4RNJA 3LQGA 2G97A 3W7KA 1CYGA 4KGJA 3T0CA 4A3QA 2VC6A 3NQBA 1LTDA 4MWAC 4J3UA 1ZSXA 1E6PA 3UP8A 3UXAA 2DW7A 3FYYA 1MQQA 3D46A 4DY1A 1SR9A 1DIDA 1AD4A 4UBPC 4M24A 3L5MA 2X1UA 2NLYA 2Z7GA 3U7BA 2CLPA 4UTTA 4Y7EA 1EJTC 3P80A 2QYGA 4F2UA 2JIEA 1KKRA 2VGBA 3MSGA 3B9EA 2P5NA 3KL5A 3W7LA 1X1OA 1UJQA 3R1ZA 4WSKA 5G2HA 3C0SA 4RXGA 4G7FA 3CV7A 2R14A 4QE4A 3VD5A 3MMTA 2W5FA 1PL9A 3MYOA 2ZA3A 3H4WA 3OP2A 3UG3A 1GOWA 3MI3A 5HMFA 3B8UA 1FWHC 3WMBA 1UOKA 3LENA 3SCOA 3MZNA 2EPNA 3VNDA 1OF8A 3OZOA 1V3LA 1FXPA 4ADUA 2Q3RA 2OLAA 4QQUA 2OG9A 4IIFA 4RE2A 1N8IA 3U4FA 3TEVA 2NXHA 5HINA 1E6NA 4DRSA 5G2IA 1HJSA 1V6UA 4IUOA 3E12A 4WK9A 1O6IA 3BLEA 1OFAA 1ZENA 5D32A 4MPKA 3KL0A 2B31A 6TIMA 2ZKMX 2EHHA 4Q7IA 3T2PA 1AH3A 2WB5A 2ONEA 3FYOA 1NU5A 2D24A 1LT8A 2FKPA 3L12A 3R79A 3MJYA 4KWUA 3CUJA 3SJNA 3C2EA 1EC7A 2GYIA 4NJHA 2GFTA 2QV5A 1UIOA 1JRCA 3OBEA 5IDZA 3PZVA 6ENLA 3L4ZA 1R0MA 1J2BA 3H22A 1GW9A 1R30A 5AHLA 1OHLA 5DFAA 5FEPA 3PC0A 4HZ7A 4QBXA 4YTRA 1KFWA 2CNCA 1P0DA 3N12A 3ES8A 4JTCA 1H5VA 2B7PA 1AVAA 3W1AA 4E2DA 3W38A 1J79A 4KGLA 3AHTA 4AEFA 3CMGA 4WDUA 3DGBA 2P53A 2IMRA 2OEKA 1QHPA 1W9VA 4HMCA 4RZ6A 5HBFA 3N29A 4KH2A 1QVBA 4LVDA 4S23A 3S1GA 1C8YA 3GXTA 3PAOA 4Z2JA 2PRMA 4US6A 1NOWA 5G1TA 3R2GA 2ZXQA 5G1MA 2OO6A 4V28A 2XG9A 1GQLA 2V5DA 3EOOA 3K4AA 3UG8A 1UR3M 5TQLA 4O17A 4HMDA 4QDWA 3D3AA 1H0IA 3LZ3A 4HNCA 1GGOA 3KRUA 4HTBA 1NELA 3AXXA 4UFMA 2NV9A 5JMUA 3S6DA 4Q4SA 2A3EA 1MMFA 2OJPA 4Z0JA 3NYDA 1V6VA 2ZWYA 1TELA 1GKRA 2OYLA 4PN2A 3ZLHA 1ZY9A 1TV5A 2BDQA 3UNDA 4C65A 2ZRVA 1QHOA 2UBPC 3DIPA 5BOOA 2ZYFA 4MYXA 3D5HA 4DXKA 2WK2A 1XFCA 4FIRA 1XYAA 3B3DA 3BAKA 3Q2DA 3V1HA 1HKJA 2AGKA 4PRTA 1E1CA 2OCZA 5L9FA 4EWJA 3NO1A 3R8RA 3GG8A 4KEVA 4LYKA 1WDPA 2J8FA 1K8ZA 3T8QA 3S5ZA 1VJZA 3CUIA 5HPOA 4Y9MA 4R7OA 1W17A 5EMYA 4L4LA 2G3FA 2VC9A 5I06A 1E43A 3IJ8A 2WLZA 2V30A 3UVIA 1Q7MA 3TTYA 3NPVA 1IR1A 1N7KA 1C92A 2Y7DA 4E38A 2HK1A 1GORA 4M6QA 3DBPA 3TC7A 4YPJA 1L6FA 3MCNA 2XU2A 1A3WA 4IJRA 1XWYA 4LW7A 4PTXA 3ZVHB 4YTSA 1EHNA 3GHUA 4RDVA 3M7SA 3R6IA 4D6EA 3PZUA 1Z42A 2D0GA 1H2JA 2TODA 3VOJA 4PRRA 4K1GA 2A7RA 4CD7A 4I5RA 4XTIA 1UMLA 2POZA 3HPXA 2PRHA 1GYMA 3AXKA 4HNLA 4OV9A 3IJDA 4ERGA 5KETA 2V63A 3VTRA 1RJQA 1WDWA 4ZR8A 2H9AB 1PYMA 4PUKA 4FHAA 1HT6A 1DP0A 4GZIA 3ARZA 1KLYA 4MWAB 4NZ5A 4HYWA 4MLJA 4R27A 2QNEA 2DP3A 2YZRA 4HNOA 3KXQA 1ONRA 2J79A 3GYCA 4N2YA 1E0XA 4MKVA 1ITCA 5CBBA 1SMAA 4C1NA 2CHRA 3CJPA 4LCQA 3MUIA 2ICSA 1Q4NX 5CSRA 1NQ6A 2O92A 1B2YA 1D9EA 2QJMA 3GO2A 1PKYA 3GXDA 4HPNA 1JZ7A 1ZCCA 3OLIA 4NUWA 4Y96A 2WAGA 4I8DA 3HQ1A 4WRHA 3W24A 5C9UA 2RJHA 3TYCA 3WF2A 2D20A 3DHDA 1ICQA 4I90A 3WY1A 3WLRA 3W1PA 3VIHA 4AD3A 3TA6A 2REQA 3OLGA 5A6MA 1DWFM 4IMAA 2R1PA 3BLFA 1WDSA 3MVIA 4D9PA 5A2CA 4ZTYA 3GNRA 1Y5VA 1YDOA 3UZXA 4MLRA 2ALDA 3MB9A 4JTRA 2X16A 1A5OC 1V7AA 1QBBA 3B8IA 2WBGA 3LHTA 3IIOA 3EB3A 2HJPA 3KL3A 4RV3A 4YTTA 3KS6A 3OJGA 3WSUA 3FGCA 5D04C 3ZMRA 2BBFA 3DGRA 2ZUMA 2PGRA 4FNTA 2W79A 3LERA 5KINA 3W73A 2ZUSA 1TQXA 1MFVA 2WJFA 1QPRA 3F03K 2EJAA 2E5DA 3IK4A 1TX2A 1CB2A 3PP7A 2JF7A 1HO1A 4DPQA 4MY8A 3W87A 3DCPA 4GWEA 4JTSA 3THDA 4B3KA 1EDQA 3ITLA 1M6JA 4J27A 5CPTA 2WW5A 3RRXA 5TIMA 3ATZA 1OABA 5DQPA 2WLYA 2FMNA 3WK2A 4XZNX 3E2QA 5A8MA 5EMJA 3GC2A 4I6VA 4DWSA 3SZ8A 1LJYA 1EH9A 3KBWA 1ZZMA 3UEQA 1TWDA 4DBWA 5AB3A 3TIMA 3C8NA 4OECA 2UY5A 3BWWA 1UUMA 1KXVA 4UQBA 3TYBA 1RQBA 3WO8A 4BS0A 3IGUA 1IEXA 3PBYA 4ONVA 3WLKX 4GK8A 3V16A 3LZ5A 2NUXA 4YTUA 1TWZA 3QZAA 1UZ1A 1OD8A 3ITTA 5AN7A 3CHVA 3UWEA 3OGRA 1WE5A 1SW7A 3D3FA 5EA9A 2YL5A 1D3GA 3SECA 2PDXA 3B8VA 5FIPA 2E40A 3GH7A 2A6NA 5M2FX 4GX9A 3ABSA 3N6QA 2GDQA 4A2RA 2G0WA 3WQ4A 2E09A 2ZQ0A 3VX1A 2BFGA 4DNMA 3NM1A 2C71A 1GYNA 2Q02A 3TYZA 4LCSA 2VD8A 5IHSA 1I4NA 2YCKX 3BAYA 4HSOA 2V5CA 3TLQA 1H4PA 1VFOA 4S1FA 3EPOA 3LMZA 1T0OA 3UGRA 1Q7QA 4E2VA 4PMDA 2GJNA 4K68A 4QNEA 4PZVA 1KFKA 2YFNA 2V5JA 3LCWA 1IEVA 1UWIA 2NXIA 3Q65A 4EX4A 1OM0A 2QCEA 2VTFA 5K4ZA 4GC4A 3H2AA 3QHOA 1RD6A 4UCFA 4MGGA 1N82A 2BLEA 3GKFA 3UZZA 1N8FA 1YLVA 3M0VA 4LAMA 3TQ0A 3E9AA 2Z4GA 4QG6A 4KCVA 1CGVA 1AA1B 2Z25A 1FWBC 3DI1A 3REQA 2SFPA 3BC9A 2FB3A 1S2UA 4I3GA 1W9DM 1GVOA 1UD5A 4UOJA 2TYSA 3WMCA 4GVGA 1NFGA 2WHKA 4ACZA 4ZXLA 4IFKA 3VIIA 2A4AA 2RDTA 3GYEA 4YLWA 2EPOA 2Z1KA 1E0TA 4B4FA 2V82A 4A3HA 3NZRA 2XZ9A 1XDLA 1TPH1 4BEQA 2CBIA 3A21A 2PE4A 3WLSA 2PWHA 3GNPA 2XGBA 3L65A 3ME3A 4GFSA 3L0GA 3SY8A 3DYPA 3BSGA 1TSIA 4ZENA 4JQ4A 1GQKA 3RX2A 3ZT7A 3GC4A 3AZTA 1LUCA 1E5JA 3WNLA 3M16A 1ZGDA 2W63A 4S3KA 1EJRC 1TV3A 4J3TA 2OB3A 5TD4A 4MADA 3TVAA 1A5AA 4NJIA 4JEJA 3IGHX 5CJ5A 2C0HA 4JKKA 1A3XA 2C3ZA 2AMXA 4MOZA 1MO0A 3DC0A 2PTDA 5LIXX 3DN5A 4JTAA 3SGZA 2PLMA 4JY8A 1W3TA 3UPWA 2YJQA 1Q8JA 1QJWA 1QPNA 1S5NA 2ZDSA 1BYCA 3OHMB 1RBOB 1OWQA 2ZC8A 3SUWA 5D33A 1E71M 4ICNA 1AMKA 1R3SA 4Y8EA 2OODA 4KQNA 5A6TC 2OVLA 3UXLA 3HFYA 3WLNA 3VYLA 1FWGC 4JIHA 4PH6A 5ABGA 3LPFA 3L4WA 1NM9A 4FNPA 5TNVA 3KZPA 4ENLA 4OZOA 2VO5A 3MMUA 4FP1A 5GPRA 4KFPA 3TTSA 4LAKA 1ONEA 3TSDA 1A5KC 1HKKA 1ZTVA 5DBTA 1S2AA 3L2IA 1HF6A 3W25A 1BTMA 1QNQA 4Z42C 2NV1A 1CGTA 1XLAA 4PUDA 4LYRA 3G22A 1C7SA 1CGWA 4V2XA 1CT5A 2DZAA 1V51A 1NDVA 3UXKA 3ANYA 1AJ2A 1QOXA 2OWCA 2RJGA 2Z2BA 3ARUA 1Q85A 1K4GA 3RU8X 1H09A 5EL1A 3P62A 3RIKA 2RDXA 1H7RA 2YXOA 4G7EA 4HA1A 1AFSA 3RK8A 4AWUA 3HG4A 9CGTA 5L6UA 1YXYA 2ZZ6A 3SRKA 2UZ9A 3BSHA 3TTOA 1UC4A 4NZ4A 2G8ZA 4HZMA 1B31A 1VLIA 1G7UA 5AHMA 1TTPA 4LXFA 2G3JA 4GE8A 1SGJA 3EKGA 1EJSC 1P1MA 1W1A1 3S2LA 2OSWA 1IZKA 2VEKA 4YHGA 3PTKA 1XLGA 2PDFA 3PJXA 3CASA 1UD6A 2GVJA 4IQDA 4F0KA 2QDHA 5DMNA 2CETA 4M19A <