2NVMA

Crystal structure of fdxn element excision controlling factor xisi (yp_321976.1) from anabaena variabilis atcc 29413 at 2.19 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
104
Chain Sequence
DKLTHYRHTIQEIIKKYYDLSNSLPDTVGDRLIIDEQRDQYLWLCCGWDGKKRVQHIILYLQIQNGKIWIEEDSTNLAIVDEMLVAGIPQTDIILGFHHPSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FdxN element excision controlling factor XisI
publication title Site-specific recombination of nitrogen-fixation genes in cyanobacteria by XisF-XisH-XisI complex: Structures and models.
pubmed doi rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Structural genomics/unknown function
total genus 28
structure length 104
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08869 XisI XisI protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.110 Alpha Beta 2-Layer Sandwich TATA-Binding Protein XisI-like 2nvmA00
2NVMA 3D7QA 2NLVA 2NWVA
chains in the Genus database with same CATH superfamily
1PCMX 5HSHA 4QG5A 1QN7A 3OLPA 2QR1A 3VN5A 5AN4A 3OSMA 1YQRA 1RM1A 3C04A 2Y8QA 1DIZA 2NOLA 3HS8A 2QRCA 3CWUA 2HZSA 2LAEA 1PCJX 2IV8A 3ASMA 2XHIA 3OH6A 1JDYA 2D0AA 3CVTA 3OH9A 3CWTA 4Q11A 4RODB 4CFFA 1QNAA 3DPUA 4D7QA 4D7RA 1HU0A 1KYFA 1MPGA 2H4LX 1EBMA 2V92A 1QNCA 3TE5A 2NOIA 3OSEA 4EAKA 3D7QA 4EAJA 3EIKA 1XSZA 2V9JA 1LWVA 3RPJA 1J3MA 2PWWA 1Q9UA 2YA3A 3CVSA 1N39A 1M3HA 1QN4A 5BMNA 1TBPA 1WJWA 2HL8A 3SNSA 2D0CA 1PVSA 3OGDA 3HS9A 3ENCA 1NVPA 3RSMA 3PMGA 3T4NA 1K35A 2FKMX 4WX8A 2D0BA 3PDKA 4EAIA 2V8QA 3EAYA 1CDWA 1YTFA 2NOZA 2F7LA 1VTOA 1V5SA 4TPSA 1YQLA 2JHNA 1JFIC 4ROCB 3OC3C 1FN7A 1AISA 1QNBA 2NOBA 1LXTA 1N3CA 1MP9A 1VOKA 2G30A 2DKCA 4I8OA 4B0AA 1UT7A 1VKLA 5KL0A 3UW2A 1KFIA 2HKPA 3KRMA 3I0WA 2EHBD 2OOYA 1NGMA 2OOXA 3DPTA 5JN5A 5IYCP 5JMVD 2VJ0A 3I0XA 1KO9A 2Z8UA 1C4GA 2NOFA 4C7PA 1QN8A 2O3OA 2FUVA 2QLVA 3KTUA 3OSTA 3NA5A 4EJYA 3BKQX 1M3QA 1TBAB 1P5DX 1C9BB 1VTLE 2JPIA 1KY6A 2FKFA 1NH2A 2NLVA 1WQAA 4EALA 1TUOA 4BJUA 2Y8LA 4HJHA 1KYUA 1W80A 3ULXA 2NVMA 1D3UA 3OCIA 4PY5A 1QN6A 3ENOC 2FGTA 1T6AA 2H5AX 2HZMA 2QRDA 3F0ZA 1KYDA 3I3WA 3F10A 5IYBP 2DKDA 3H1ZA 4DULA 2NWVA 2HL9A 1M5Q1 4ROEB 4EJZA 1QN9A 1PZDA 1PCZA 5IYDP 2Z0FA 1QN5A 1YQMA 4WXAA 1TGHA 5F9CA 1YQKA 2ZFDB 2NOEA 1B9KA 1E42A 2JHJA 1KY7A 1UT4A 2YH5A 1EUVA 5BMPA 1VOLB 2IV9A 3IH7A 1P5GX 1QTPA 2JOIA 4WZSD 1N3AA 2MJ7A 4IL8A 3CWAA 3D4VA 2DKAA 2I5WA 3TDHA 4MRQA 1KFQA 3CWSA 1C47A 2MZ8A 3CW7A 1QTSA 1R4XA 4EAGA 1QNEA 1QN3A 1YTBA 3N89A 2NOHA 2R5XA 5EPCA 1UL7A 2QREA 1LWYA 1K2YX 1LWWA
chains in the Genus database with same CATH topology
2NVMA 3D7QA 2NLVA 2NWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVM A;  3D7Q A;  2NLV A;  2NWV A; 
#chains in the Genus database with same CATH topology
 1PCM X;  5HSH A;  4QG5 A;  1QN7 A;  3OLP A;  2QR1 A;  3VN5 A;  5AN4 A;  3OSM A;  1YQR A;  1RM1 A;  3C04 A;  2Y8Q A;  1DIZ A;  2NOL A;  3HS8 A;  2QRC A;  3CWU A;  2HZS A;  2LAE A;  1PCJ X;  2IV8 A;  3ASM A;  2XHI A;  3OH6 A;  1JDY A;  2D0A A;  3CVT A;  3OH9 A;  3CWT A;  4Q11 A;  4ROD B;  4CFF A;  1QNA A;  3DPU A;  4D7Q A;  4D7R A;  1HU0 A;  1KYF A;  1MPG A;  2H4L X;  1EBM A;  2V92 A;  1QNC A;  3TE5 A;  2NOI A;  3OSE A;  4EAK A;  3D7Q A;  4EAJ A;  3EIK A;  1XSZ A;  2V9J A;  1LWV A;  3RPJ A;  1J3M A;  2PWW A;  1Q9U A;  2YA3 A;  3CVS A;  1N39 A;  1M3H A;  1QN4 A;  5BMN A;  1TBP A;  1WJW A;  2HL8 A;  3SNS A;  2D0C A;  1PVS A;  3OGD A;  3HS9 A;  3ENC A;  1NVP A;  3RSM A;  3PMG A;  3T4N A;  1K35 A;  2FKM X;  4WX8 A;  2D0B A;  3PDK A;  4EAI A;  2V8Q A;  3EAY A;  1CDW A;  1YTF A;  2NOZ A;  2F7L A;  1VTO A;  1V5S A;  4TPS A;  1YQL A;  2JHN A;  1JFI C;  4ROC B;  3OC3 C;  1FN7 A;  1AIS A;  1QNB A;  2NOB A;  1LXT A;  1N3C A;  1MP9 A;  1VOK A;  2G30 A;  2DKC A;  4I8O A;  4B0A A;  1UT7 A;  1VKL A;  5KL0 A;  3UW2 A;  1KFI A;  2HKP A;  3KRM A;  3I0W A;  2EHB D;  2OOY A;  1NGM A;  2OOX A;  3DPT A;  5JN5 A;  5IYC P;  5JMV D;  2VJ0 A;  3I0X A;  1KO9 A;  2Z8U A;  1C4G A;  2NOF A;  4C7P A;  1QN8 A;  2O3O A;  2FUV A;  2QLV A;  3KTU A;  3OST A;  3NA5 A;  4EJY A;  3BKQ X;  1M3Q A;  1TBA B;  1P5D X;  1C9B B;  1VTL E;  2JPI A;  1KY6 A;  2FKF A;  1NH2 A;  2NLV A;  1WQA A;  4EAL A;  1TUO A;  4BJU A;  2Y8L A;  4HJH A;  1KYU A;  1W80 A;  3ULX A;  2NVM A;  1D3U A;  3OCI A;  4PY5 A;  1QN6 A;  3ENO C;  2FGT A;  1T6A A;  2H5A X;  2HZM A;  2QRD A;  3F0Z A;  1KYD A;  3I3W A;  3F10 A;  5IYB P;  2DKD A;  3H1Z A;  4DUL A;  2NWV A;  2HL9 A;  1M5Q 1;  4ROE B;  4EJZ A;  1QN9 A;  1PZD A;  1PCZ A;  5IYD P;  2Z0F A;  1QN5 A;  1YQM A;  4WXA A;  1TGH A;  5F9C A;  1YQK A;  2ZFD B;  2NOE A;  1B9K A;  1E42 A;  2JHJ A;  1KY7 A;  1UT4 A;  2YH5 A;  1EUV A;  5BMP A;  1VOL B;  2IV9 A;  3IH7 A;  1P5G X;  1QTP A;  2JOI A;  4WZS D;  1N3A A;  2MJ7 A;  4IL8 A;  3CWA A;  3D4V A;  2DKA A;  2I5W A;  3TDH A;  4MRQ A;  1KFQ A;  3CWS A;  1C47 A;  2MZ8 A;  3CW7 A;  1QTS A;  1R4X A;  4EAG A;  1QNE A;  1QN3 A;  1YTB A;  3N89 A;  2NOH A;  2R5X A;  5EPC A;  1UL7 A;  2QRE A;  1LWY A;  1K2Y X;  1LWW A; 
#chains in the Genus database with same CATH homology
 2NVM A;  3D7Q A;  2NLV A;  2NWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...