2NVQK

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
molecule tags Transcription,transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvqK00
1ZYRA 5C4JC 1K83K 4BY1C 3GTMK 4KMUA 3M4OK 3HOXK 5FLMC 4C3JK 4A3CC 4XLNA 3HOVC 3K7AC 4XSZA 2NVXK 1TWAC 3H0GK 1R9TK 3S14C 1TWHK 3S2DK 4LK0A 4A3LK 1XPPA 3I4MC 4YFXA 4LLGA 3I4NC 4Y52K 4Y7NK 1I6HC 2JA6K 3S17K 1HQMA 1WCMC 5TMFA 4BXXC 4A93K 1TWCK 4QJVA 5C4JK 4BY1K 4OINA 3GTGC 5IYCC 5FLMK 3S1RK 4A3CK 1K83C 4MQ9A 3PO3C 3HOXC 1TWAK 3RZDC 1Y1WC 4A3IK 3S14K 1YNNA 5D4DA 3GTKK 3I4MK 1R9TC 4C2MK 3FKIK 5FJ8K 3I4NK 4A3DK 4C3HK 4A3LC 1WCMK 2NVTK 4BXXK 5IP7C 4BBRC 2R7ZC 3GTLC 3PO2C 3GTGK 3GTOK 5IYCK 4C3IK 5TMCA 2O5JA 3PO3K 1SFOC 5M5WK 1Y1WK 3RZDK 4X6AC 3S1RC 2R93C 4YFNA 4A3EC 3HOZC 4A3JC 4XLPA 4A3IC 4NOIA 3GTKC 3HOUK 3FKIC 2WAQL 2A6EA 4A3DC 5IP7K 4BBRK 3GTLK 2R7ZK 2PA8L 4XSXA 2NVTC 3S1NC 3PO2K 3RZOC 1TWGC 2Y0SL 2VUMC 4Q5SA 1SFOK 3GTOC 2JA8C 4X6AK 2R93K 3M3YC 3GTJK 4A3EK 3HOZK 4A3JK 4A3BC 5M5YK 1SMYA 2NVYC 2WB1L 2A68A 2PMZL 4G7HA 1Y1VC 2JA7C 4ZH4A 5M5XK 3S16C 3HOWC 5C4XC 3S1NK 3HOUC 5IYBC 3RZOK 2JA5C 1TWGK 2WAQD 4OIPA 4OIQA 3EQLA 5IP9C 2VUMK 2PA8D 2JA8K 3M3YK 4AYBL 2Y0SD 4A3BK 3S15C 2NVYK 4MEYA 3GTJC 3GTPC 3WODA 5C4XK 2JA7K 1Y1VK 3S16K 4BBSK 3HOWK 2NVQC 3S1QC 3GTQC 5IYDC 2YU9K 5IYBK 2WB1D 2JA5K 2PMZD 2E2JC 1TWFC 4YFKA 4JK1A 2E2IC 4QIWL 5IP9K 2E2HC 2PPBA 1BDFA 4OIOA 4A3KC 2B63C 2CW0A 3S15K 3GTPK 1I3QC 2R92C 4BY7C 4YG2A 3HOYC 1I50C 4AYBD 4A3MC 3HKZL 3DXJA 2NVQK 3GTQK 3H3VL 3S1QK 4LJZA 5IYDK 1IW7A 2E2JK 1TWFK 4BBSC 4QJVB 1YNJA 2A6HA 2E2IK 5C3EC 4G7OA 2E2HK 3S1MK 4KN4A 3S2HK 4A3KK 4A3GK 3CQZK 2B63K 5M3MK 4QIWD 4GZYA 5C44C 4BY7K 1I3QK 5M3FK 4MEXA 2R92K 3HOYK 2A69A 1I50K 4A3MK 4LK1A 4G7ZA 4A3FC 5C3EK 3HKZD 3H3VD 1I6VA 2O5IA 2YU9C 4KN7A 3GTMC 3M4OC 3HOVK 3K7AK 3S1MC 3S2HC 4OIRA 4A3GC 2BE5A 5C44K 3CQZC 2NVXC 3H0GC 1TWHC 3S2DC 1I6HK 4Y52C 4Y7NC 2JA6C 3S17C 4A3FK 4A93C 1TWCC 4Q4ZA
chains in the Genus database with same CATH superfamily
4O2DA 1ZYRA 5C4JC 3GTMK 4BY1C 4KMUA 4XSZA 1TWAC 3H0GK 1AB4A 3HXAA 3S14C 1X31C 3GSIA 3JSTA 4C3HC 2JA6K 1WCMC 3LAJA 1USOA 3GTGC 3AD8C 5FLMK 4A3CK 1WOPA 4KC6A 1Y1WC 4A3IK 2E2IA 3I4MK 4C2MK 3FKIK 4A3DK 3CQZA 4WJ4A 1B4BA 3GDZA 2NVTK 5IP7C 1XZPB 4GTLA 3PO2C 4XCHA 2O5JA 5M5WK 4DDQA 1ZQ1C 2EBBA 2CFAB 4A3IC 3FKIC 4A3DC 1XXBA 2R7ZK 4XSXA 2NVTC 1WIHA 4GTCA 2Y0SL 4LQYA 4X6AK 3GTJK 3HOZK 3TTGA 4A3BC 1K83A 1WORA 2JA7C 5M5XK 3MMLB 1TWHA 4PABA 2JA5C 3RZOK 1HI9A 1WQGA 3CAGA 4OIPA 1IL2A 5IP9C 2VUMK 4J3NA 3OREA 1TWCA 2Y0SD 3VA7A 2D6FC 3TFIA 3GTJC 1SFOA 3HOWK 3GTQC 1TWFC 1JQWA 2E2HC 1DCOA 4KM8A 4OIOA 1WCMA 1PJ7A 2GSOA 4GFQA 1F93A 4YG2A 3DXJA 2NVQK 3T01A 5IYDK 2E2JK 4QJVB 2E2IK 3AH5A 3S1MK 4A3KK 3CQZK 4KATA 1VH2A 1I3QK 5M3FK 4A3MK 3G4CA 4LK1A 3FOEA 3NUHA 4A3FC 5C3EK 1I6VA 4KN7A 1BS2A 3GEHA 2RGRA 3S1MC 2W7VA 1PJ6A 5C44K 3CQZC 3FOFA 2GSNA 3S2DC 4C45A 1XZQB 3GEEA 5E68A 1I50A 4A93C 1EI6A 2JA7A 3M4OK 1K83K 2NVXK 1TWHK 1XPPA 3N3YA 4YFXA 3I4NC 4Y52K 4Y7NK 3S17K 4BXXC 1DCPA 1TWCK 5C4JK 4BY1K 1J6WA 5IYCC 3GTQA 1K83C 1TWFA 1DD5A 1TWAK 1VJEA 3RZDC 3S14K 5D4DA 2E2HA 2P8TA 4C3HK 2KWAA 1WCMK 5L46A 2V6UA 3QX3A 3GTGK 4GTDA 1SFOC 1Y1WK 1BJTA 4A3EC 1O2FB 1O2BA 4GTFA 1RU0A 2PHCB 1F9NA 1EFWA 3HOUK 2WAQL 2A6EA 5EGEA 5IP7K 3S1NC 3N0BA 3PO2K 3L4KA 4Q5SA 1XXAA 3FHZA 4KM9A 2GAHC 2WB1L 3IPJA 2PMZL 5C4XC 1Y1VC 4ILDA 1WSRA 3HOUC 1IBAA 2WAQD 4OIQA 3EQLA 3GTLA 4P5BA 4AYBL 4A3BK 4MEYA 4RMFA 2JA7K 4GTAA 2R93A 4BBSK 1DCHA 2WB1D 2JA5K 2GAGC 2PMZD 1XZPA 5IP9K 1VRQC 3GTOA 2R92C 2CFAA 3HOYC 1I50C 4AYBD 3HKZL 3N0CA 3GTQK 4LJZA 1IW7A 1UV7A 1TWFK 2NVYA 4BBSC 2E2HK 1JOEA 5CHPA 5M3MK 4MEXA 5IORA 3TFHA 3AD7C 4FM9A 3OPFA 3GTPA 3BUEA 4G7ZA 1J6VA 3HKZD 5JFEA 4M1XA 3HOVK 4C3JC 1I6HK 1O28A 1J6XA 3BP8C 2FQOA 4A3FK 1Y1VA 3S0XA 3HOXK 3Q3QA 2RH6A 4XLNA 3HOVC 4KMHA 3S2DK 4A3LK 1I6HC 1HQMA 3AQOA 4A93K 4G0WA 4WJ3M 3G4AA 4QJVA 4OINA 4C3IC 4KARA 1IE0A 4MQ9A 4KDDA 3PO3C 1ZBSA 3HOXC 3GTMA 4G0UA 1YNNA 2ZUFA 3I4NK 4A3LC 3H0GA 4BXXK 3AQPA 1VGXA 4BBRC 3GTLC 2R92A 3GTOK 2JA6A 5IYCK 5TMCA 2Y3PA 1EQRA 3RZDK 2R93C 5HL8A 4YFNA 4A3JC 4XLPA 2ZUEA 4NOIA 4KMDA 5EGHA 1TWGC 1SFOK 4GTEA 2FQTA 2JA8C 3GTOC 3M3YC 4A3EK 2ZFZA 2NVYC 1C0AA 2A68A 4G7HA 3S16C 1ZVUA 4ZH4A 4BLBA 4KAWX 3S1NK 1R9TA 5IYBC 3SZYA 3T00A 5JVOA 2GSUA 2V6TA 3S15C 3GTPC 2V6SA 5C4XK 1Y1VK 1WSVA 3S1QC 5IOQA 3SZZA 2YU9K 1BGWA 3GTKA 1YX2A 4KASA 4QIWL 2PPBA 2B63C 5TJ3A 4BY7C 3H3VL 1ISEA 1KQ4A 1EK8A 1YNJA 3GIRA 2A6HA 1L0WA 3LAPA 1YCLA 4GT9A 4LR2A 4QIWD 1WOOA 3GEIA 4GZYA 2R92K 3HOYK 2A69A 1I50K 4BLAA 2P5MA 1VLOA 3H3VD 2O5IA 2YU9C 3GTMC 3K7AK 1XXCA 1TWGA 3H0GC 2JH3A 2XCRB 3AD9C 1I3QA 2JA6C 4Q4ZA 5IOSA 5CJ9A 5FLMC 4C3JK 4A3CC 3K7AC 1R9TK 1GE9A 1WQFA 4GTBA 4LK0A 3I4MC 5IOTA 4C2MC 4LLGA 5TMFA 1O25A 3LPXA 3L4JA 4LOWA 1G51A 1IQ0A 3S1RK 1O29A 1O24A 3ADAC 1O2AA 3GTKK 1J98A 3TFJA 1R9TC 5FJ8K 2B63A 2NVXA 2XCOA 2R7ZC 4C3IK 3PO3K 4X6AC 3S1RC 1USMA 1IS1A 3HOZC 1EH1A 3V4GA 3GTKC 1TWAA 3ERED 3GTLK 4BBRK 2PA8L 3RZOC 1F7VA 4AH6A 2VUMC 2R93K 3GTGA 2YU9A 4A3JK 5M5YK 1SMYA 1Y1WA 4FZBA 3HOWC 1TWGK 1WQHA 4KB2A 3BP3A 1F7UA 2PA8D 4KMAA 2JA8K 3A8JA 3M3YK 2NVYK 3WODA 3S16K 1PJ5A 1XZQA 2NVQC 5IYDC 5IYBK 2E2JC 4KB4A 4YFKA 3A8KA 4JK1A 2E2IC 3FKIA 1BDFA 4WILA 4A3KC 1B4AA 2CW0A 3A8IA 3OEPA 3S15K 3GTPK 1I3QC 4A3MC 3S1QK 1ZXOA 4G7OA 4PAAA 1WOSA 5C3EC 1JVIA 4KN4A 3S2HK 1V5VA 4A3GK 2JA5A 4P9SA 2B63K 1INNA 2R7ZA 5C44C 4BY7K 2XCQA 3GTJA 1O26A 4G0VA 3M4OC 3S2HC 4OIRA 4A3GC 2BE5A 2NVXC 1TWHC 2VUMA 4Y52C 4Y7NC 4P5AA 3S17C 3T02A 1O27A 1TWCC 4BKWA
chains in the Genus database with same CATH topology
1ZYRA 5C4JC 1K83K 4BY1C 3GTMK 4KMUA 3M4OK 3HOXK 5FLMC 4C3JK 4A3CC 4XLNA 3HOVC 3K7AC 4XSZA 2NVXK 1TWAC 3H0GK 1R9TK 3S14C 1TWHK 3S2DK 4LK0A 4A3LK 1XPPA 3I4MC 4YFXA 4LLGA 3I4NC 4Y52K 4Y7NK 1I6HC 2JA6K 3S17K 1HQMA 1WCMC 5TMFA 4BXXC 4A93K 1TWCK 4QJVA 5C4JK 4BY1K 4OINA 3GTGC 5IYCC 5FLMK 3S1RK 4A3CK 1K83C 4MQ9A 3PO3C 3HOXC 1TWAK 3RZDC 1Y1WC 4A3IK 3S14K 1YNNA 5D4DA 3GTKK 3I4MK 1R9TC 4C2MK 3FKIK 5FJ8K 3I4NK 4A3DK 4C3HK 4A3LC 1WCMK 2NVTK 4BXXK 5IP7C 4BBRC 2R7ZC 3GTLC 3PO2C 3GTGK 3GTOK 5IYCK 4C3IK 5TMCA 2O5JA 3PO3K 1SFOC 5M5WK 1Y1WK 3RZDK 4X6AC 3S1RC 2R93C 4YFNA 4A3EC 3HOZC 4A3JC 4XLPA 4A3IC 4NOIA 3GTKC 3HOUK 3FKIC 2WAQL 2A6EA 4A3DC 5IP7K 4BBRK 3GTLK 2R7ZK 2PA8L 4XSXA 2NVTC 3S1NC 3PO2K 3RZOC 1TWGC 2Y0SL 2VUMC 4Q5SA 1SFOK 3GTOC 2JA8C 4X6AK 2R93K 3M3YC 3GTJK 4A3EK 3HOZK 4A3JK 4A3BC 5M5YK 1SMYA 2NVYC 2WB1L 2A68A 2PMZL 4G7HA 1Y1VC 2JA7C 4ZH4A 5M5XK 3S16C 3HOWC 5C4XC 3S1NK 3HOUC 5IYBC 3RZOK 2JA5C 1TWGK 2WAQD 4OIPA 4OIQA 3EQLA 5IP9C 2VUMK 2PA8D 2JA8K 3M3YK 4AYBL 2Y0SD 4A3BK 3S15C 2NVYK 4MEYA 3GTJC 3GTPC 3WODA 5C4XK 2JA7K 1Y1VK 3S16K 4BBSK 3HOWK 2NVQC 3S1QC 3GTQC 5IYDC 2YU9K 5IYBK 2WB1D 2JA5K 2PMZD 2E2JC 1TWFC 4YFKA 4JK1A 2E2IC 4QIWL 5IP9K 2E2HC 2PPBA 1BDFA 4OIOA 4A3KC 2B63C 2CW0A 3S15K 3GTPK 1I3QC 2R92C 4BY7C 4YG2A 3HOYC 1I50C 4AYBD 4A3MC 3HKZL 3DXJA 2NVQK 3GTQK 3H3VL 3S1QK 4LJZA 5IYDK 1IW7A 2E2JK 1TWFK 4BBSC 4QJVB 1YNJA 2A6HA 2E2IK 5C3EC 4G7OA 2E2HK 3S1MK 4KN4A 3S2HK 4A3KK 4A3GK 3CQZK 2B63K 5M3MK 4QIWD 4GZYA 5C44C 4BY7K 1I3QK 5M3FK 4MEXA 2R92K 3HOYK 2A69A 1I50K 4A3MK 4LK1A 4G7ZA 4A3FC 5C3EK 3HKZD 3H3VD 1I6VA 2O5IA 2YU9C 4KN7A 3GTMC 3M4OC 3HOVK 3K7AK 3S1MC 3S2HC 4OIRA 4A3GC 2BE5A 5C44K 3CQZC 2NVXC 3H0GC 1TWHC 3S2DC 1I6HK 4Y52C 4Y7NC 2JA6C 3S17C 4A3FK 4A93C 1TWCC 4Q4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR A;  5C4J C;  1K83 K;  4BY1 C;  3GTM K;  4KMU A;  3M4O K;  3HOX K;  5FLM C;  4C3J K;  4A3C C;  4XLN A;  3HOV C;  3K7A C;  4XSZ A;  2NVX K;  1TWA C;  3H0G K;  1R9T K;  3S14 C;  1TWH K;  3S2D K;  4LK0 A;  4A3L K;  1XPP A;  3I4M C;  4YFX A;  4LLG A;  3I4N C;  4Y52 K;  4Y7N K;  1I6H C;  2JA6 K;  3S17 K;  1HQM A;  1WCM C;  5TMF A;  4BXX C;  4A93 K;  1TWC K;  4QJV A;  5C4J K;  4BY1 K;  4OIN A;  3GTG C;  5IYC C;  5FLM K;  3S1R K;  4A3C K;  1K83 C;  4MQ9 A;  3PO3 C;  3HOX C;  1TWA K;  3RZD C;  1Y1W C;  4A3I K;  3S14 K;  1YNN A;  5D4D A;  3GTK K;  3I4M K;  1R9T C;  4C2M K;  3FKI K;  5FJ8 K;  3I4N K;  4A3D K;  4C3H K;  4A3L C;  1WCM K;  2NVT K;  4BXX K;  5IP7 C;  4BBR C;  2R7Z C;  3GTL C;  3PO2 C;  3GTG K;  3GTO K;  5IYC K;  4C3I K;  5TMC A;  2O5J A;  3PO3 K;  1SFO C;  5M5W K;  1Y1W K;  3RZD K;  4X6A C;  3S1R C;  2R93 C;  4YFN A;  4A3E C;  3HOZ C;  4A3J C;  4XLP A;  4A3I C;  4NOI A;  3GTK C;  3HOU K;  3FKI C;  2WAQ L;  2A6E A;  4A3D C;  5IP7 K;  4BBR K;  3GTL K;  2R7Z K;  2PA8 L;  4XSX A;  2NVT C;  3S1N C;  3PO2 K;  3RZO C;  1TWG C;  2Y0S L;  2VUM C;  4Q5S A;  1SFO K;  3GTO C;  2JA8 C;  4X6A K;  2R93 K;  3M3Y C;  3GTJ K;  4A3E K;  3HOZ K;  4A3J K;  4A3B C;  5M5Y K;  1SMY A;  2NVY C;  2WB1 L;  2A68 A;  2PMZ L;  4G7H A;  1Y1V C;  2JA7 C;  4ZH4 A;  5M5X K;  3S16 C;  3HOW C;  5C4X C;  3S1N K;  3HOU C;  5IYB C;  3RZO K;  2JA5 C;  1TWG K;  2WAQ D;  4OIP A;  4OIQ A;  3EQL A;  5IP9 C;  2VUM K;  2PA8 D;  2JA8 K;  3M3Y K;  4AYB L;  2Y0S D;  4A3B K;  3S15 C;  2NVY K;  4MEY A;  3GTJ C;  3GTP C;  3WOD A;  5C4X K;  2JA7 K;  1Y1V K;  3S16 K;  4BBS K;  3HOW K;  2NVQ C;  3S1Q C;  3GTQ C;  5IYD C;  2YU9 K;  5IYB K;  2WB1 D;  2JA5 K;  2PMZ D;  2E2J C;  1TWF C;  4YFK A;  4JK1 A;  2E2I C;  4QIW L;  5IP9 K;  2E2H C;  2PPB A;  1BDF A;  4OIO A;  4A3K C;  2B63 C;  2CW0 A;  3S15 K;  3GTP K;  1I3Q C;  2R92 C;  4BY7 C;  4YG2 A;  3HOY C;  1I50 C;  4AYB D;  4A3M C;  3HKZ L;  3DXJ A;  2NVQ K;  3GTQ K;  3H3V L;  3S1Q K;  4LJZ A;  5IYD K;  1IW7 A;  2E2J K;  1TWF K;  4BBS C;  4QJV B;  1YNJ A;  2A6H A;  2E2I K;  5C3E C;  4G7O A;  2E2H K;  3S1M K;  4KN4 A;  3S2H K;  4A3K K;  4A3G K;  3CQZ K;  2B63 K;  5M3M K;  4QIW D;  4GZY A;  5C44 C;  4BY7 K;  1I3Q K;  5M3F K;  4MEX A;  2R92 K;  3HOY K;  2A69 A;  1I50 K;  4A3M K;  4LK1 A;  4G7Z A;  4A3F C;  5C3E K;  3HKZ D;  3H3V D;  1I6V A;  2O5I A;  2YU9 C;  4KN7 A;  3GTM C;  3M4O C;  3HOV K;  3K7A K;  3S1M C;  3S2H C;  4OIR A;  4A3G C;  2BE5 A;  5C44 K;  3CQZ C;  2NVX C;  3H0G C;  1TWH C;  3S2D C;  1I6H K;  4Y52 C;  4Y7N C;  2JA6 C;  3S17 C;  4A3F K;  4A93 C;  1TWC C;  4Q4Z A; 
#chains in the Genus database with same CATH topology
 4O2D A;  1ZYR A;  5C4J C;  3GTM K;  4BY1 C;  4KMU A;  4XSZ A;  1TWA C;  3H0G K;  1AB4 A;  3HXA A;  3S14 C;  1X31 C;  3GSI A;  3JST A;  4C3H C;  2JA6 K;  1WCM C;  3LAJ A;  1USO A;  3GTG C;  3AD8 C;  5FLM K;  4A3C K;  1WOP A;  4KC6 A;  1Y1W C;  4A3I K;  2E2I A;  3I4M K;  4C2M K;  3FKI K;  4A3D K;  3CQZ A;  4WJ4 A;  1B4B A;  3GDZ A;  2NVT K;  5IP7 C;  1XZP B;  4GTL A;  3PO2 C;  4XCH A;  2O5J A;  5M5W K;  4DDQ A;  1ZQ1 C;  2EBB A;  2CFA B;  4A3I C;  3FKI C;  4A3D C;  1XXB A;  2R7Z K;  4XSX A;  2NVT C;  1WIH A;  4GTC A;  2Y0S L;  4LQY A;  4X6A K;  3GTJ K;  3HOZ K;  3TTG A;  4A3B C;  1K83 A;  1WOR A;  2JA7 C;  5M5X K;  3MML B;  1TWH A;  4PAB A;  2JA5 C;  3RZO K;  1HI9 A;  1WQG A;  3CAG A;  4OIP A;  1IL2 A;  5IP9 C;  2VUM K;  4J3N A;  3ORE A;  1TWC A;  2Y0S D;  3VA7 A;  2D6F C;  3TFI A;  3GTJ C;  1SFO A;  3HOW K;  3GTQ C;  1TWF C;  1JQW A;  2E2H C;  1DCO A;  4KM8 A;  4OIO A;  1WCM A;  1PJ7 A;  2GSO A;  4GFQ A;  1F93 A;  4YG2 A;  3DXJ A;  2NVQ K;  3T01 A;  5IYD K;  2E2J K;  4QJV B;  2E2I K;  3AH5 A;  3S1M K;  4A3K K;  3CQZ K;  4KAT A;  1VH2 A;  1I3Q K;  5M3F K;  4A3M K;  3G4C A;  4LK1 A;  3FOE A;  3NUH A;  4A3F C;  5C3E K;  1I6V A;  4KN7 A;  1BS2 A;  3GEH A;  2RGR A;  3S1M C;  2W7V A;  1PJ6 A;  5C44 K;  3CQZ C;  3FOF A;  2GSN A;  3S2D C;  4C45 A;  1XZQ B;  3GEE A;  5E68 A;  1I50 A;  4A93 C;  1EI6 A;  2JA7 A;  3M4O K;  1K83 K;  2NVX K;  1TWH K;  1XPP A;  3N3Y A;  4YFX A;  3I4N C;  4Y52 K;  4Y7N K;  3S17 K;  4BXX C;  1DCP A;  1TWC K;  5C4J K;  4BY1 K;  1J6W A;  5IYC C;  3GTQ A;  1K83 C;  1TWF A;  1DD5 A;  1TWA K;  1VJE A;  3RZD C;  3S14 K;  5D4D A;  2E2H A;  2P8T A;  4C3H K;  2KWA A;  1WCM K;  5L46 A;  2V6U A;  3QX3 A;  3GTG K;  4GTD A;  1SFO C;  1Y1W K;  1BJT A;  4A3E C;  1O2F B;  1O2B A;  4GTF A;  1RU0 A;  2PHC B;  1F9N A;  1EFW A;  3HOU K;  2WAQ L;  2A6E A;  5EGE A;  5IP7 K;  3S1N C;  3N0B A;  3PO2 K;  3L4K A;  4Q5S A;  1XXA A;  3FHZ A;  4KM9 A;  2GAH C;  2WB1 L;  3IPJ A;  2PMZ L;  5C4X C;  1Y1V C;  4ILD A;  1WSR A;  3HOU C;  1IBA A;  2WAQ D;  4OIQ A;  3EQL A;  3GTL A;  4P5B A;  4AYB L;  4A3B K;  4MEY A;  4RMF A;  2JA7 K;  4GTA A;  2R93 A;  4BBS K;  1DCH A;  2WB1 D;  2JA5 K;  2GAG C;  2PMZ D;  1XZP A;  5IP9 K;  1VRQ C;  3GTO A;  2R92 C;  2CFA A;  3HOY C;  1I50 C;  4AYB D;  3HKZ L;  3N0C A;  3GTQ K;  4LJZ A;  1IW7 A;  1UV7 A;  1TWF K;  2NVY A;  4BBS C;  2E2H K;  1JOE A;  5CHP A;  5M3M K;  4MEX A;  5IOR A;  3TFH A;  3AD7 C;  4FM9 A;  3OPF A;  3GTP A;  3BUE A;  4G7Z A;  1J6V A;  3HKZ D;  5JFE A;  4M1X A;  3HOV K;  4C3J C;  1I6H K;  1O28 A;  1J6X A;  3BP8 C;  2FQO A;  4A3F K;  1Y1V A;  3S0X A;  3HOX K;  3Q3Q A;  2RH6 A;  4XLN A;  3HOV C;  4KMH A;  3S2D K;  4A3L K;  1I6H C;  1HQM A;  3AQO A;  4A93 K;  4G0W A;  4WJ3 M;  3G4A A;  4QJV A;  4OIN A;  4C3I C;  4KAR A;  1IE0 A;  4MQ9 A;  4KDD A;  3PO3 C;  1ZBS A;  3HOX C;  3GTM A;  4G0U A;  1YNN A;  2ZUF A;  3I4N K;  4A3L C;  3H0G A;  4BXX K;  3AQP A;  1VGX A;  4BBR C;  3GTL C;  2R92 A;  3GTO K;  2JA6 A;  5IYC K;  5TMC A;  2Y3P A;  1EQR A;  3RZD K;  2R93 C;  5HL8 A;  4YFN A;  4A3J C;  4XLP A;  2ZUE A;  4NOI A;  4KMD A;  5EGH A;  1TWG C;  1SFO K;  4GTE A;  2FQT A;  2JA8 C;  3GTO C;  3M3Y C;  4A3E K;  2ZFZ A;  2NVY C;  1C0A A;  2A68 A;  4G7H A;  3S16 C;  1ZVU A;  4ZH4 A;  4BLB A;  4KAW X;  3S1N K;  1R9T A;  5IYB C;  3SZY A;  3T00 A;  5JVO A;  2GSU A;  2V6T A;  3S15 C;  3GTP C;  2V6S A;  5C4X K;  1Y1V K;  1WSV A;  3S1Q C;  5IOQ A;  3SZZ A;  2YU9 K;  1BGW A;  3GTK A;  1YX2 A;  4KAS A;  4QIW L;  2PPB A;  2B63 C;  5TJ3 A;  4BY7 C;  3H3V L;  1ISE A;  1KQ4 A;  1EK8 A;  1YNJ A;  3GIR A;  2A6H A;  1L0W A;  3LAP A;  1YCL A;  4GT9 A;  4LR2 A;  4QIW D;  1WOO A;  3GEI A;  4GZY A;  2R92 K;  3HOY K;  2A69 A;  1I50 K;  4BLA A;  2P5M A;  1VLO A;  3H3V D;  2O5I A;  2YU9 C;  3GTM C;  3K7A K;  1XXC A;  1TWG A;  3H0G C;  2JH3 A;  2XCR B;  3AD9 C;  1I3Q A;  2JA6 C;  4Q4Z A;  5IOS A;  5CJ9 A;  5FLM C;  4C3J K;  4A3C C;  3K7A C;  1R9T K;  1GE9 A;  1WQF A;  4GTB A;  4LK0 A;  3I4M C;  5IOT A;  4C2M C;  4LLG A;  5TMF A;  1O25 A;  3LPX A;  3L4J A;  4LOW A;  1G51 A;  1IQ0 A;  3S1R K;  1O29 A;  1O24 A;  3ADA C;  1O2A A;  3GTK K;  1J98 A;  3TFJ A;  1R9T C;  5FJ8 K;  2B63 A;  2NVX A;  2XCO A;  2R7Z C;  4C3I K;  3PO3 K;  4X6A C;  3S1R C;  1USM A;  1IS1 A;  3HOZ C;  1EH1 A;  3V4G A;  3GTK C;  1TWA A;  3ERE D;  3GTL K;  4BBR K;  2PA8 L;  3RZO C;  1F7V A;  4AH6 A;  2VUM C;  2R93 K;  3GTG A;  2YU9 A;  4A3J K;  5M5Y K;  1SMY A;  1Y1W A;  4FZB A;  3HOW C;  1TWG K;  1WQH A;  4KB2 A;  3BP3 A;  1F7U A;  2PA8 D;  4KMA A;  2JA8 K;  3A8J A;  3M3Y K;  2NVY K;  3WOD A;  3S16 K;  1PJ5 A;  1XZQ A;  2NVQ C;  5IYD C;  5IYB K;  2E2J C;  4KB4 A;  4YFK A;  3A8K A;  4JK1 A;  2E2I C;  3FKI A;  1BDF A;  4WIL A;  4A3K C;  1B4A A;  2CW0 A;  3A8I A;  3OEP A;  3S15 K;  3GTP K;  1I3Q C;  4A3M C;  3S1Q K;  1ZXO A;  4G7O A;  4PAA A;  1WOS A;  5C3E C;  1JVI A;  4KN4 A;  3S2H K;  1V5V A;  4A3G K;  2JA5 A;  4P9S A;  2B63 K;  1INN A;  2R7Z A;  5C44 C;  4BY7 K;  2XCQ A;  3GTJ A;  1O26 A;  4G0V A;  3M4O C;  3S2H C;  4OIR A;  4A3G C;  2BE5 A;  2NVX C;  1TWH C;  2VUM A;  4Y52 C;  4Y7N C;  4P5A A;  3S17 C;  3T02 A;  1O27 A;  1TWC C;  4BKW A; 
#chains in the Genus database with same CATH homology
 1ZYR A;  5C4J C;  1K83 K;  4BY1 C;  3GTM K;  4KMU A;  3M4O K;  3HOX K;  5FLM C;  4C3J K;  4A3C C;  4XLN A;  3HOV C;  3K7A C;  4XSZ A;  2NVX K;  1TWA C;  3H0G K;  1R9T K;  3S14 C;  1TWH K;  3S2D K;  4LK0 A;  4A3L K;  1XPP A;  3I4M C;  4YFX A;  4LLG A;  3I4N C;  4Y52 K;  4Y7N K;  1I6H C;  2JA6 K;  3S17 K;  1HQM A;  1WCM C;  5TMF A;  4BXX C;  4A93 K;  1TWC K;  4QJV A;  5C4J K;  4BY1 K;  4OIN A;  3GTG C;  5IYC C;  5FLM K;  3S1R K;  4A3C K;  1K83 C;  4MQ9 A;  3PO3 C;  3HOX C;  1TWA K;  3RZD C;  1Y1W C;  4A3I K;  3S14 K;  1YNN A;  5D4D A;  3GTK K;  3I4M K;  1R9T C;  4C2M K;  3FKI K;  5FJ8 K;  3I4N K;  4A3D K;  4C3H K;  4A3L C;  1WCM K;  2NVT K;  4BXX K;  5IP7 C;  4BBR C;  2R7Z C;  3GTL C;  3PO2 C;  3GTG K;  3GTO K;  5IYC K;  4C3I K;  5TMC A;  2O5J A;  3PO3 K;  1SFO C;  5M5W K;  1Y1W K;  3RZD K;  4X6A C;  3S1R C;  2R93 C;  4YFN A;  4A3E C;  3HOZ C;  4A3J C;  4XLP A;  4A3I C;  4NOI A;  3GTK C;  3HOU K;  3FKI C;  2WAQ L;  2A6E A;  4A3D C;  5IP7 K;  4BBR K;  3GTL K;  2R7Z K;  2PA8 L;  4XSX A;  2NVT C;  3S1N C;  3PO2 K;  3RZO C;  1TWG C;  2Y0S L;  2VUM C;  4Q5S A;  1SFO K;  3GTO C;  2JA8 C;  4X6A K;  2R93 K;  3M3Y C;  3GTJ K;  4A3E K;  3HOZ K;  4A3J K;  4A3B C;  5M5Y K;  1SMY A;  2NVY C;  2WB1 L;  2A68 A;  2PMZ L;  4G7H A;  1Y1V C;  2JA7 C;  4ZH4 A;  5M5X K;  3S16 C;  3HOW C;  5C4X C;  3S1N K;  3HOU C;  5IYB C;  3RZO K;  2JA5 C;  1TWG K;  2WAQ D;  4OIP A;  4OIQ A;  3EQL A;  5IP9 C;  2VUM K;  2PA8 D;  2JA8 K;  3M3Y K;  4AYB L;  2Y0S D;  4A3B K;  3S15 C;  2NVY K;  4MEY A;  3GTJ C;  3GTP C;  3WOD A;  5C4X K;  2JA7 K;  1Y1V K;  3S16 K;  4BBS K;  3HOW K;  2NVQ C;  3S1Q C;  3GTQ C;  5IYD C;  2YU9 K;  5IYB K;  2WB1 D;  2JA5 K;  2PMZ D;  2E2J C;  1TWF C;  4YFK A;  4JK1 A;  2E2I C;  4QIW L;  5IP9 K;  2E2H C;  2PPB A;  1BDF A;  4OIO A;  4A3K C;  2B63 C;  2CW0 A;  3S15 K;  3GTP K;  1I3Q C;  2R92 C;  4BY7 C;  4YG2 A;  3HOY C;  1I50 C;  4AYB D;  4A3M C;  3HKZ L;  3DXJ A;  2NVQ K;  3GTQ K;  3H3V L;  3S1Q K;  4LJZ A;  5IYD K;  1IW7 A;  2E2J K;  1TWF K;  4BBS C;  4QJV B;  1YNJ A;  2A6H A;  2E2I K;  5C3E C;  4G7O A;  2E2H K;  3S1M K;  4KN4 A;  3S2H K;  4A3K K;  4A3G K;  3CQZ K;  2B63 K;  5M3M K;  4QIW D;  4GZY A;  5C44 C;  4BY7 K;  1I3Q K;  5M3F K;  4MEX A;  2R92 K;  3HOY K;  2A69 A;  1I50 K;  4A3M K;  4LK1 A;  4G7Z A;  4A3F C;  5C3E K;  3HKZ D;  3H3V D;  1I6V A;  2O5I A;  2YU9 C;  4KN7 A;  3GTM C;  3M4O C;  3HOV K;  3K7A K;  3S1M C;  3S2H C;  4OIR A;  4A3G C;  2BE5 A;  5C44 K;  3CQZ C;  2NVX C;  3H0G C;  1TWH C;  3S2D C;  1I6H K;  4Y52 C;  4Y7N C;  2JA6 C;  3S17 C;  4A3F K;  4A93 C;  1TWC C;  4Q4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...