2NVQK

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvqK00
4BY7K 3GTLK 3S1NK 3GTLC 3S1NC 5IYBK 5C4JC 2JA5K 3GTGK 1Y1VK 3HKZL 1TWFC 4A3DC 3HOZC 4QIWL 4G7HA 5C44C 5FLMC 3M4OC 2JA6C 1TWHC 5TMCA 5M5YK 1I50K 4MEYA 3HOXC 4Q4ZA 2PA8L 4LJZA 4A3EK 4OIPA 2E2HK 4A93K 3S1QC 4QJVA 2WB1D 4XSZA 3I4MK 1K83C 2JA7K 1I6HK 2JA8C 3H3VD 4A3IK 4X6AK 1K83K 2WAQL 1I6HC 4C3HK 1TWAC 2YU9C 2YU9K 2NVQK 3GTKK 4LK1A 4G7ZA 3S1RC 3GTQK 3S1QK 3M3YC 2NVYC 3GTJC 2E2JC 3FKIK 3PO3C 2R92C 2O5IA 2JA8K 2JA7C 5IP7C 4BY1C 3HOZK 1ZYRA 2A69A 2NVTK 1XPPA 3GTOC 5IP7K 4AYBD 4BY1K 4A3BC 1TWGC 2A68A 5IYDK 3S2DK 5FLMK 2NVYK 3GTJK 1SFOK 4C3JK 3GTPK 2NVQC 3GTKC 4YFXA 1I3QC 4NOIA 3K7AK 5IYCC 3H0GC 2NVXC 2NVXK 2R93K 4A3IC 4X6AC 5D4DA 1Y1WC 1YNNA 4QJVB 5IP9K 1WCMK 4Q5SA 3GTMK 3HOVK 4OINA 3RZOK 4A93C 1I6VA 2Y0SL 4YFKA 2R7ZC 1TWHK 3PO2C 3S2HC 3I4NK 3K7AC 1I3QK 5C3EK 3RZDC 2PMZL 4A3DK 1TWCK 1TWCC 4KMUA 3S14C 3S1RK 1TWGK 3GTQC 3S1MC 1IW7A 4A3MC 4BY7C 1TWAK 2A6HA 3GTOK 5C4XC 4XSXA 3S2HK 3S15C 2E2IK 2B63C 4OIQA 3S17C 2R92K 4A3LK 5M3FK 4A3CC 3HKZD 4C3IK 4QIWD 3WODA 1I50C 1YNJA 2E2HC 4A3MK 3CQZC 2VUMK 4OIRA 2JA6K 1BDFA 3HOWC 3HOUC 4Y52K 4YFNA 5C44K 2PA8D 3S15K 1SFOC 4KN7A 5TMFA 2WB1L 4OIOA 4MEXA 3I4MC 3H3VL 4A3KK 4A3BK 4LK0A 3S14K 4MQ9A 4Y7NK 2WAQD 3GTMC 1HQMA 5M5WK 3HOYC 3RZOC 3M4OK 5IP9C 4BXXK 4GZYA 1SMYA 2A6EA 4Y7NC 3S16C 3M3YK 3PO3K 2O5JA 5C4JK 4A3JK 5IYBC 2JA5C 3GTGC 2PPBA 4G7OA 2CW0A 5FJ8K 3S2DC 1Y1WK 2R7ZK 4A3FC 4AYBL 4C2MK 4XLPA 3HOWK 1R9TC 4YG2A 4BBRC 4A3GK 5IYCK 2NVTC 3CQZK 3S16K 4BXXC 4A3CK 4A3LC 4BBSK 5M5XK 2B63K 2E2JK 2E2IC 3S17K 1TWFK 4A3KC 1Y1VC 4ZH4A 4XLNA 4JK1A 3I4NC 5C4XK 2BE5A 3S1MK 4A3FK 3PO2K 2Y0SD 3DXJA 3FKIC 4Y52C 3HOUK 1WCMC 4BBSC 5C3EC 3EQLA 3RZDK 2VUMC 5M3MK 2PMZD 4LLGA 4A3JC 3H0GK 2R93C 4BBRK 1R9TK 4A3GC 3HOVC 4KN4A 3HOYK 3GTPC 4A3EC 5IYDC 3HOXK
chains in the Genus database with same CATH superfamily
4M1XA 3GTLC 3S1NC 3GTGK 4A3DC 3HOZC 1EFWA 2JA6C 2E2HK 4MEYA 4Q4ZA 4A3EK 4LJZA 4OIPA 3AQOA 1K83C 4KC6A 2JA7K 1I6HK 4X6AK 2VUMA 1TWAC 2YU9C 2NVQK 3GTKK 4LK1A 3GTQK 2R7ZA 1PJ5A 2E2JC 4KATA 3L4JA 5IP7K 2B63A 4GTBA 4LOWA 5IYDK 3S2DK 2NVYK 3GTPK 1O27A 1I3QC 1ZBSA 4NOIA 1Y1WC 1USOA 1RU0A 1J6WA 3BP8C 5EGEA 4A93C 3PO2C 1TWHK 1WOOA 1I3QK 4PAAA 3RZDC 4KARA 1EQRA 1TWCK 5JVOA 3GIRA 3GTQC 3N0BA 1TWAK 2A6HA 4BY7C 3S15C 1J6VA 1L0WA 3G4CA 1YNJA 1JQWA 2E2HC 2VUMK 2JA6K 1O29A 1BDFA 1VGXA 4YFNA 1ISEA 5C44K 1SFOA 3GTPA 4KN7A 4BLAA 1XXBA 4LK0A 1F93A 3S14K 3M4OK 5M5WK 3HOYC 1XXCA 4GZYA 3PO3K 3GTGC 4A3JK 3CQZA 2PPBA 4G7OA 5FJ8K 3H0GA 1R9TC 4A3GK 2NVTC 2Y3PA 1DCOA 2XCRB 1EK8A 4O2DA 1I3QA 5E68A 4JK1A 3FKIC 3FKIA 4Y52C 3RZDK 3GEIA 5M3MK 3ADAC 2ZUFA 2R93C 3HOVC 3A8KA 4C3JC 4KM8A 4KDDA 4Q5SA 3HOXK 5EGHA 2JA5K 3BP3A 4WJ4A 1TWFC 4QIWL 1O24A 4LR2A 3M4OC 1TWHC 5TMCA 1I50K 3HOXC 2CFAA 2GSNA 4QJVA 3V4GA 2JA8C 3H3VD 1O2BA 1XZQB 4DDQA 3AD9C 2YU9K 3T02A 3GTJC 3FKIK 2JA8K 4BY1C 1ZYRA 2E2HA 2D6FC 2A69A 1WIHA 3G4AA 3HXAA 4BY1K 4A3BC 1XXAA 3GTJK 2W7VA 1YCLA 2NVQC 3GTKC 1R9TA 5IYCC 1WQFA 1ZQ1C 3H0GC 3K7AK 2NVXC 3N3YA 3GTQA 4X6AC 1YNNA 5IP9K 1WOSA 2R92A 3HOVK 2NVYA 4C45A 2Y0SL 4KM9A 4YFKA 5C3EK 1O2AA 4GTCA 4KASA 4A3DK 1O2FB 1GE9A 3S14C 3S1RK 5CHPA 3S1MC 3GTOK 1HI9A 4XSXA 3SZZA 3FOFA 2B63C 3S17C 3GTMA 4ILDA 3HKZD 1WSRA 4GTLA 4Y52K 5HL8A 4G0UA 2PA8D 4OIOA 1TWAA 4P9SA 4Y7NK 2WAQD 1HQMA 5TJ3A 3M3YK 1UV7A 1ZXOA 2JA6A 1ZVUA 2R93A 1IS1A 1B4BA 1B4AA 4A3FC 2V6UA 5IYCK 1X31C 4A3LC 4BBSK 4G0VA 1INNA 1TWFK 3T01A 5IOTA 4A3KC 4XLNA 2V6SA 4BLBA 3OPFA 2BE5A 5C4XK 3DXJA 3GEEA 3TTGA 2FQTA 3IPJA 3EQLA 2VUMC 4LLGA 1AB4A 4P5BA 2ZUEA 3H0GK 4BBRK 2E2IA 2NVXA 4KN4A 2JA7A 4J3NA 4A3EC 5IYDC 3LPXA 3TFHA 4BY7K 5IYBK 5C4JC 1F9NA 4G7HA 1IE0A 2V6TA 4A93K 2WB1D 3I4MK 1O25A 2GSOA 4A3IK 1K83K 1I6HC 4C3HK 1XZPB 4LQYA 3M3YC 2NVYC 2R92C 1VH2A 2JA7C 5IP7C 2CFAB 1BS2A 1BGWA 1I50A 1TWFA 4AYBD 2A68A 3OEPA 4G0WA 4C3JK 4GTEA 4YFXA 2NVXK 2R93K 3FOEA 3QX3A 1J6XA 3S0XA 1WCMK 1IQ0A 3GTJA 3GDZA 1I6VA 4KMAA 1EH1A 5IOQA 2KWAA 4GTFA 2PMZL 4BKWA 3BUEA 4KMUA 1TWGK 1IW7A 3CAGA 1TWHA 4GT9A 3VA7A 2GSUA 2E2IK 4OIQA 2YU9A 1O26A 5M3FK 4A3CC 4QIWD 3WODA 1K83A 3CQZC 1JVIA 3HOWC 3HOUC 4KB2A 3S15K 1WQGA 3I4MC 1VJEA 1JOEA 3H3VL 3AH5A 4A3BK 1YX2A 3GTLA 5IP9C 2RH6A 3S16C 2ZFZA 5C4JK 1USMA 3LAPA 4C3IC 2CW0A 3S2DC 1IL2A 1Y1WK 3A8IA 1O28A 4YG2A 1BJTA 4BBRC 3CQZK 4KB4A 3S16K 4RMFA 4KMDA 4BXXC 1PJ6A 4A3CK 1TWGA 5M5XK 2JH3A 2E2JK 1WQHA 3GSIA 3GTGA 3LAJA 4A3FK 3PO2K 2Y0SD 4WJ3M 4A3JC 3TFJA 2RGRA 1Y1WA 1J98A 1V5VA 3GTPC 3GTLK 3AD7C 3S1NK 1Y1VK 3HKZL 4PABA 4GTAA 1WOPA 5C44C 3NUHA 5FLMC 1IBAA 4P5AA 4GFQA 5M5YK 2R7ZK 3S1QC 1WORA 2PA8L 3SZYA 4XSZA 3JSTA 4C2MC 3FHZA 2WAQL 2XCQA 4G7ZA 3S1RC 3S1QK 2GAHC 2P8TA 3PO3C 3GEHA 2O5IA 3HOZK 2NVTK 1XPPA 3GTOC 1TWGC 5FLMK 1SFOK 5IOSA 3T00A 3MMLB 3L4KA 4A3IC 5D4DA 4QJVB 3OREA 1VLOA 2P5MA 4KMHA 3GTMK 4OINA 3RZOK 1EI6A 2R7ZC 3S2HC 3I4NK 3K7AC 3Q3QA 3GTOA 2PHCB 1Y1VA 1TWCC 1DCHA 5C4XC 3N0CA 4A3MC 1VRQC 3S2HK 5JFEA 1XZQA 2R92K 4A3LK 4AH6A 4C3IK 2GAGC 4KAWX 1I50C 4A3MK 4OIRA 4C3HC 3TFIA 1DCPA 2EBBA 1F7UA 3AQPA 1SFOC 5TMFA 2WB1L 4MEXA 4A3KK 5IORA 4MQ9A 3GTMC 3RZOC 1WCMA 4BXXK 3AD8C 1SMYA 2A6EA 4Y7NC 3ERED 2O5JA 2JA5C 5IYBC 1G51A 4AYBL 4C2MK 4XLPA 3HOWK 1WSVA 2B63K 3S17K 1KQ4A 2E2IC 1TWCA 1Y1VC 5CJ9A 5L46A 4ZH4A 1F7VA 3A8JA 3I4NC 3GTKA 2JA5A 1PJ7A 3S1MK 1DD5A 2XCOA 3HOUK 1WCMC 4BBSC 4FZBA 5C3EC 2FQOA 2PMZD 4XCHA 4WILA 1XZPA 4FM9A 1R9TK 4A3GC 3HOYK 4GTDA 1C0AA
chains in the Genus database with same CATH topology
4BY7K 3GTLK 3S1NK 3GTLC 3S1NC 5IYBK 5C4JC 2JA5K 3GTGK 1Y1VK 3HKZL 1TWFC 4A3DC 3HOZC 4QIWL 4G7HA 5C44C 5FLMC 3M4OC 2JA6C 1TWHC 5TMCA 5M5YK 1I50K 4MEYA 3HOXC 4Q4ZA 2PA8L 4LJZA 4A3EK 4OIPA 2E2HK 4A93K 3S1QC 4QJVA 2WB1D 4XSZA 3I4MK 1K83C 2JA7K 1I6HK 2JA8C 3H3VD 4A3IK 4X6AK 1K83K 2WAQL 1I6HC 4C3HK 1TWAC 2YU9C 2YU9K 2NVQK 3GTKK 4LK1A 4G7ZA 3S1RC 3GTQK 3S1QK 3M3YC 2NVYC 3GTJC 2E2JC 3FKIK 3PO3C 2R92C 2O5IA 2JA8K 2JA7C 5IP7C 4BY1C 3HOZK 1ZYRA 2A69A 2NVTK 1XPPA 3GTOC 5IP7K 4AYBD 4BY1K 4A3BC 1TWGC 2A68A 5IYDK 3S2DK 5FLMK 2NVYK 3GTJK 1SFOK 4C3JK 3GTPK 2NVQC 3GTKC 4YFXA 1I3QC 4NOIA 3K7AK 5IYCC 3H0GC 2NVXC 2NVXK 2R93K 4A3IC 4X6AC 5D4DA 1Y1WC 1YNNA 4QJVB 5IP9K 1WCMK 4Q5SA 3GTMK 3HOVK 4OINA 3RZOK 4A93C 1I6VA 2Y0SL 4YFKA 2R7ZC 1TWHK 3PO2C 3S2HC 3I4NK 3K7AC 1I3QK 5C3EK 3RZDC 2PMZL 4A3DK 1TWCK 1TWCC 4KMUA 3S14C 3S1RK 1TWGK 3GTQC 3S1MC 1IW7A 4A3MC 4BY7C 1TWAK 2A6HA 3GTOK 5C4XC 4XSXA 3S2HK 3S15C 2E2IK 2B63C 4OIQA 3S17C 2R92K 4A3LK 5M3FK 4A3CC 3HKZD 4C3IK 4QIWD 3WODA 1I50C 1YNJA 2E2HC 4A3MK 3CQZC 2VUMK 4OIRA 2JA6K 1BDFA 3HOWC 3HOUC 4Y52K 4YFNA 5C44K 2PA8D 3S15K 1SFOC 4KN7A 5TMFA 2WB1L 4OIOA 4MEXA 3I4MC 3H3VL 4A3KK 4A3BK 4LK0A 3S14K 4MQ9A 4Y7NK 2WAQD 3GTMC 1HQMA 5M5WK 3HOYC 3RZOC 3M4OK 5IP9C 4BXXK 4GZYA 1SMYA 2A6EA 4Y7NC 3S16C 3M3YK 3PO3K 2O5JA 5C4JK 4A3JK 5IYBC 2JA5C 3GTGC 2PPBA 4G7OA 2CW0A 5FJ8K 3S2DC 1Y1WK 2R7ZK 4A3FC 4AYBL 4C2MK 4XLPA 3HOWK 1R9TC 4YG2A 4BBRC 4A3GK 5IYCK 2NVTC 3CQZK 3S16K 4BXXC 4A3CK 4A3LC 4BBSK 5M5XK 2B63K 2E2JK 2E2IC 3S17K 1TWFK 4A3KC 1Y1VC 4ZH4A 4XLNA 4JK1A 3I4NC 5C4XK 2BE5A 3S1MK 4A3FK 3PO2K 2Y0SD 3DXJA 3FKIC 4Y52C 3HOUK 1WCMC 4BBSC 5C3EC 3EQLA 3RZDK 2VUMC 5M3MK 2PMZD 4LLGA 4A3JC 3H0GK 2R93C 4BBRK 1R9TK 4A3GC 3HOVC 4KN4A 3HOYK 3GTPC 4A3EC 5IYDC 3HOXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 K;  3GTL K;  3S1N K;  3GTL C;  3S1N C;  5IYB K;  5C4J C;  2JA5 K;  3GTG K;  1Y1V K;  3HKZ L;  1TWF C;  4A3D C;  3HOZ C;  4QIW L;  4G7H A;  5C44 C;  5FLM C;  3M4O C;  2JA6 C;  1TWH C;  5TMC A;  5M5Y K;  1I50 K;  4MEY A;  3HOX C;  4Q4Z A;  2PA8 L;  4LJZ A;  4A3E K;  4OIP A;  2E2H K;  4A93 K;  3S1Q C;  4QJV A;  2WB1 D;  4XSZ A;  3I4M K;  1K83 C;  2JA7 K;  1I6H K;  2JA8 C;  3H3V D;  4A3I K;  4X6A K;  1K83 K;  2WAQ L;  1I6H C;  4C3H K;  1TWA C;  2YU9 C;  2YU9 K;  2NVQ K;  3GTK K;  4LK1 A;  4G7Z A;  3S1R C;  3GTQ K;  3S1Q K;  3M3Y C;  2NVY C;  3GTJ C;  2E2J C;  3FKI K;  3PO3 C;  2R92 C;  2O5I A;  2JA8 K;  2JA7 C;  5IP7 C;  4BY1 C;  3HOZ K;  1ZYR A;  2A69 A;  2NVT K;  1XPP A;  3GTO C;  5IP7 K;  4AYB D;  4BY1 K;  4A3B C;  1TWG C;  2A68 A;  5IYD K;  3S2D K;  5FLM K;  2NVY K;  3GTJ K;  1SFO K;  4C3J K;  3GTP K;  2NVQ C;  3GTK C;  4YFX A;  1I3Q C;  4NOI A;  3K7A K;  5IYC C;  3H0G C;  2NVX C;  2NVX K;  2R93 K;  4A3I C;  4X6A C;  5D4D A;  1Y1W C;  1YNN A;  4QJV B;  5IP9 K;  1WCM K;  4Q5S A;  3GTM K;  3HOV K;  4OIN A;  3RZO K;  4A93 C;  1I6V A;  2Y0S L;  4YFK A;  2R7Z C;  1TWH K;  3PO2 C;  3S2H C;  3I4N K;  3K7A C;  1I3Q K;  5C3E K;  3RZD C;  2PMZ L;  4A3D K;  1TWC K;  1TWC C;  4KMU A;  3S14 C;  3S1R K;  1TWG K;  3GTQ C;  3S1M C;  1IW7 A;  4A3M C;  4BY7 C;  1TWA K;  2A6H A;  3GTO K;  5C4X C;  4XSX A;  3S2H K;  3S15 C;  2E2I K;  2B63 C;  4OIQ A;  3S17 C;  2R92 K;  4A3L K;  5M3F K;  4A3C C;  3HKZ D;  4C3I K;  4QIW D;  3WOD A;  1I50 C;  1YNJ A;  2E2H C;  4A3M K;  3CQZ C;  2VUM K;  4OIR A;  2JA6 K;  1BDF A;  3HOW C;  3HOU C;  4Y52 K;  4YFN A;  5C44 K;  2PA8 D;  3S15 K;  1SFO C;  4KN7 A;  5TMF A;  2WB1 L;  4OIO A;  4MEX A;  3I4M C;  3H3V L;  4A3K K;  4A3B K;  4LK0 A;  3S14 K;  4MQ9 A;  4Y7N K;  2WAQ D;  3GTM C;  1HQM A;  5M5W K;  3HOY C;  3RZO C;  3M4O K;  5IP9 C;  4BXX K;  4GZY A;  1SMY A;  2A6E A;  4Y7N C;  3S16 C;  3M3Y K;  3PO3 K;  2O5J A;  5C4J K;  4A3J K;  5IYB C;  2JA5 C;  3GTG C;  2PPB A;  4G7O A;  2CW0 A;  5FJ8 K;  3S2D C;  1Y1W K;  2R7Z K;  4A3F C;  4AYB L;  4C2M K;  4XLP A;  3HOW K;  1R9T C;  4YG2 A;  4BBR C;  4A3G K;  5IYC K;  2NVT C;  3CQZ K;  3S16 K;  4BXX C;  4A3C K;  4A3L C;  4BBS K;  5M5X K;  2B63 K;  2E2J K;  2E2I C;  3S17 K;  1TWF K;  4A3K C;  1Y1V C;  4ZH4 A;  4XLN A;  4JK1 A;  3I4N C;  5C4X K;  2BE5 A;  3S1M K;  4A3F K;  3PO2 K;  2Y0S D;  3DXJ A;  3FKI C;  4Y52 C;  3HOU K;  1WCM C;  4BBS C;  5C3E C;  3EQL A;  3RZD K;  2VUM C;  5M3M K;  2PMZ D;  4LLG A;  4A3J C;  3H0G K;  2R93 C;  4BBR K;  1R9T K;  4A3G C;  3HOV C;  4KN4 A;  3HOY K;  3GTP C;  4A3E C;  5IYD C;  3HOX K; 
#chains in the Genus database with same CATH topology
 4M1X A;  3GTL C;  3S1N C;  3GTG K;  4A3D C;  3HOZ C;  1EFW A;  2JA6 C;  2E2H K;  4MEY A;  4Q4Z A;  4A3E K;  4LJZ A;  4OIP A;  3AQO A;  1K83 C;  4KC6 A;  2JA7 K;  1I6H K;  4X6A K;  2VUM A;  1TWA C;  2YU9 C;  2NVQ K;  3GTK K;  4LK1 A;  3GTQ K;  2R7Z A;  1PJ5 A;  2E2J C;  4KAT A;  3L4J A;  5IP7 K;  2B63 A;  4GTB A;  4LOW A;  5IYD K;  3S2D K;  2NVY K;  3GTP K;  1O27 A;  1I3Q C;  1ZBS A;  4NOI A;  1Y1W C;  1USO A;  1RU0 A;  1J6W A;  3BP8 C;  5EGE A;  4A93 C;  3PO2 C;  1TWH K;  1WOO A;  1I3Q K;  4PAA A;  3RZD C;  4KAR A;  1EQR A;  1TWC K;  5JVO A;  3GIR A;  3GTQ C;  3N0B A;  1TWA K;  2A6H A;  4BY7 C;  3S15 C;  1J6V A;  1L0W A;  3G4C A;  1YNJ A;  1JQW A;  2E2H C;  2VUM K;  2JA6 K;  1O29 A;  1BDF A;  1VGX A;  4YFN A;  1ISE A;  5C44 K;  1SFO A;  3GTP A;  4KN7 A;  4BLA A;  1XXB A;  4LK0 A;  1F93 A;  3S14 K;  3M4O K;  5M5W K;  3HOY C;  1XXC A;  4GZY A;  3PO3 K;  3GTG C;  4A3J K;  3CQZ A;  2PPB A;  4G7O A;  5FJ8 K;  3H0G A;  1R9T C;  4A3G K;  2NVT C;  2Y3P A;  1DCO A;  2XCR B;  1EK8 A;  4O2D A;  1I3Q A;  5E68 A;  4JK1 A;  3FKI C;  3FKI A;  4Y52 C;  3RZD K;  3GEI A;  5M3M K;  3ADA C;  2ZUF A;  2R93 C;  3HOV C;  3A8K A;  4C3J C;  4KM8 A;  4KDD A;  4Q5S A;  3HOX K;  5EGH A;  2JA5 K;  3BP3 A;  4WJ4 A;  1TWF C;  4QIW L;  1O24 A;  4LR2 A;  3M4O C;  1TWH C;  5TMC A;  1I50 K;  3HOX C;  2CFA A;  2GSN A;  4QJV A;  3V4G A;  2JA8 C;  3H3V D;  1O2B A;  1XZQ B;  4DDQ A;  3AD9 C;  2YU9 K;  3T02 A;  3GTJ C;  3FKI K;  2JA8 K;  4BY1 C;  1ZYR A;  2E2H A;  2D6F C;  2A69 A;  1WIH A;  3G4A A;  3HXA A;  4BY1 K;  4A3B C;  1XXA A;  3GTJ K;  2W7V A;  1YCL A;  2NVQ C;  3GTK C;  1R9T A;  5IYC C;  1WQF A;  1ZQ1 C;  3H0G C;  3K7A K;  2NVX C;  3N3Y A;  3GTQ A;  4X6A C;  1YNN A;  5IP9 K;  1WOS A;  2R92 A;  3HOV K;  2NVY A;  4C45 A;  2Y0S L;  4KM9 A;  4YFK A;  5C3E K;  1O2A A;  4GTC A;  4KAS A;  4A3D K;  1O2F B;  1GE9 A;  3S14 C;  3S1R K;  5CHP A;  3S1M C;  3GTO K;  1HI9 A;  4XSX A;  3SZZ A;  3FOF A;  2B63 C;  3S17 C;  3GTM A;  4ILD A;  3HKZ D;  1WSR A;  4GTL A;  4Y52 K;  5HL8 A;  4G0U A;  2PA8 D;  4OIO A;  1TWA A;  4P9S A;  4Y7N K;  2WAQ D;  1HQM A;  5TJ3 A;  3M3Y K;  1UV7 A;  1ZXO A;  2JA6 A;  1ZVU A;  2R93 A;  1IS1 A;  1B4B A;  1B4A A;  4A3F C;  2V6U A;  5IYC K;  1X31 C;  4A3L C;  4BBS K;  4G0V A;  1INN A;  1TWF K;  3T01 A;  5IOT A;  4A3K C;  4XLN A;  2V6S A;  4BLB A;  3OPF A;  2BE5 A;  5C4X K;  3DXJ A;  3GEE A;  3TTG A;  2FQT A;  3IPJ A;  3EQL A;  2VUM C;  4LLG A;  1AB4 A;  4P5B A;  2ZUE A;  3H0G K;  4BBR K;  2E2I A;  2NVX A;  4KN4 A;  2JA7 A;  4J3N A;  4A3E C;  5IYD C;  3LPX A;  3TFH A;  4BY7 K;  5IYB K;  5C4J C;  1F9N A;  4G7H A;  1IE0 A;  2V6T A;  4A93 K;  2WB1 D;  3I4M K;  1O25 A;  2GSO A;  4A3I K;  1K83 K;  1I6H C;  4C3H K;  1XZP B;  4LQY A;  3M3Y C;  2NVY C;  2R92 C;  1VH2 A;  2JA7 C;  5IP7 C;  2CFA B;  1BS2 A;  1BGW A;  1I50 A;  1TWF A;  4AYB D;  2A68 A;  3OEP A;  4G0W A;  4C3J K;  4GTE A;  4YFX A;  2NVX K;  2R93 K;  3FOE A;  3QX3 A;  1J6X A;  3S0X A;  1WCM K;  1IQ0 A;  3GTJ A;  3GDZ A;  1I6V A;  4KMA A;  1EH1 A;  5IOQ A;  2KWA A;  4GTF A;  2PMZ L;  4BKW A;  3BUE A;  4KMU A;  1TWG K;  1IW7 A;  3CAG A;  1TWH A;  4GT9 A;  3VA7 A;  2GSU A;  2E2I K;  4OIQ A;  2YU9 A;  1O26 A;  5M3F K;  4A3C C;  4QIW D;  3WOD A;  1K83 A;  3CQZ C;  1JVI A;  3HOW C;  3HOU C;  4KB2 A;  3S15 K;  1WQG A;  3I4M C;  1VJE A;  1JOE A;  3H3V L;  3AH5 A;  4A3B K;  1YX2 A;  3GTL A;  5IP9 C;  2RH6 A;  3S16 C;  2ZFZ A;  5C4J K;  1USM A;  3LAP A;  4C3I C;  2CW0 A;  3S2D C;  1IL2 A;  1Y1W K;  3A8I A;  1O28 A;  4YG2 A;  1BJT A;  4BBR C;  3CQZ K;  4KB4 A;  3S16 K;  4RMF A;  4KMD A;  4BXX C;  1PJ6 A;  4A3C K;  1TWG A;  5M5X K;  2JH3 A;  2E2J K;  1WQH A;  3GSI A;  3GTG A;  3LAJ A;  4A3F K;  3PO2 K;  2Y0S D;  4WJ3 M;  4A3J C;  3TFJ A;  2RGR A;  1Y1W A;  1J98 A;  1V5V A;  3GTP C;  3GTL K;  3AD7 C;  3S1N K;  1Y1V K;  3HKZ L;  4PAB A;  4GTA A;  1WOP A;  5C44 C;  3NUH A;  5FLM C;  1IBA A;  4P5A A;  4GFQ A;  5M5Y K;  2R7Z K;  3S1Q C;  1WOR A;  2PA8 L;  3SZY A;  4XSZ A;  3JST A;  4C2M C;  3FHZ A;  2WAQ L;  2XCQ A;  4G7Z A;  3S1R C;  3S1Q K;  2GAH C;  2P8T A;  3PO3 C;  3GEH A;  2O5I A;  3HOZ K;  2NVT K;  1XPP A;  3GTO C;  1TWG C;  5FLM K;  1SFO K;  5IOS A;  3T00 A;  3MML B;  3L4K A;  4A3I C;  5D4D A;  4QJV B;  3ORE A;  1VLO A;  2P5M A;  4KMH A;  3GTM K;  4OIN A;  3RZO K;  1EI6 A;  2R7Z C;  3S2H C;  3I4N K;  3K7A C;  3Q3Q A;  3GTO A;  2PHC B;  1Y1V A;  1TWC C;  1DCH A;  5C4X C;  3N0C A;  4A3M C;  1VRQ C;  3S2H K;  5JFE A;  1XZQ A;  2R92 K;  4A3L K;  4AH6 A;  4C3I K;  2GAG C;  4KAW X;  1I50 C;  4A3M K;  4OIR A;  4C3H C;  3TFI A;  1DCP A;  2EBB A;  1F7U A;  3AQP A;  1SFO C;  5TMF A;  2WB1 L;  4MEX A;  4A3K K;  5IOR A;  4MQ9 A;  3GTM C;  3RZO C;  1WCM A;  4BXX K;  3AD8 C;  1SMY A;  2A6E A;  4Y7N C;  3ERE D;  2O5J A;  2JA5 C;  5IYB C;  1G51 A;  4AYB L;  4C2M K;  4XLP A;  3HOW K;  1WSV A;  2B63 K;  3S17 K;  1KQ4 A;  2E2I C;  1TWC A;  1Y1V C;  5CJ9 A;  5L46 A;  4ZH4 A;  1F7V A;  3A8J A;  3I4N C;  3GTK A;  2JA5 A;  1PJ7 A;  3S1M K;  1DD5 A;  2XCO A;  3HOU K;  1WCM C;  4BBS C;  4FZB A;  5C3E C;  2FQO A;  2PMZ D;  4XCH A;  4WIL A;  1XZP A;  4FM9 A;  1R9T K;  4A3G C;  3HOY K;  4GTD A;  1C0A A; 
#chains in the Genus database with same CATH homology
 4BY7 K;  3GTL K;  3S1N K;  3GTL C;  3S1N C;  5IYB K;  5C4J C;  2JA5 K;  3GTG K;  1Y1V K;  3HKZ L;  1TWF C;  4A3D C;  3HOZ C;  4QIW L;  4G7H A;  5C44 C;  5FLM C;  3M4O C;  2JA6 C;  1TWH C;  5TMC A;  5M5Y K;  1I50 K;  4MEY A;  3HOX C;  4Q4Z A;  2PA8 L;  4LJZ A;  4A3E K;  4OIP A;  2E2H K;  4A93 K;  3S1Q C;  4QJV A;  2WB1 D;  4XSZ A;  3I4M K;  1K83 C;  2JA7 K;  1I6H K;  2JA8 C;  3H3V D;  4A3I K;  4X6A K;  1K83 K;  2WAQ L;  1I6H C;  4C3H K;  1TWA C;  2YU9 C;  2YU9 K;  2NVQ K;  3GTK K;  4LK1 A;  4G7Z A;  3S1R C;  3GTQ K;  3S1Q K;  3M3Y C;  2NVY C;  3GTJ C;  2E2J C;  3FKI K;  3PO3 C;  2R92 C;  2O5I A;  2JA8 K;  2JA7 C;  5IP7 C;  4BY1 C;  3HOZ K;  1ZYR A;  2A69 A;  2NVT K;  1XPP A;  3GTO C;  5IP7 K;  4AYB D;  4BY1 K;  4A3B C;  1TWG C;  2A68 A;  5IYD K;  3S2D K;  5FLM K;  2NVY K;  3GTJ K;  1SFO K;  4C3J K;  3GTP K;  2NVQ C;  3GTK C;  4YFX A;  1I3Q C;  4NOI A;  3K7A K;  5IYC C;  3H0G C;  2NVX C;  2NVX K;  2R93 K;  4A3I C;  4X6A C;  5D4D A;  1Y1W C;  1YNN A;  4QJV B;  5IP9 K;  1WCM K;  4Q5S A;  3GTM K;  3HOV K;  4OIN A;  3RZO K;  4A93 C;  1I6V A;  2Y0S L;  4YFK A;  2R7Z C;  1TWH K;  3PO2 C;  3S2H C;  3I4N K;  3K7A C;  1I3Q K;  5C3E K;  3RZD C;  2PMZ L;  4A3D K;  1TWC K;  1TWC C;  4KMU A;  3S14 C;  3S1R K;  1TWG K;  3GTQ C;  3S1M C;  1IW7 A;  4A3M C;  4BY7 C;  1TWA K;  2A6H A;  3GTO K;  5C4X C;  4XSX A;  3S2H K;  3S15 C;  2E2I K;  2B63 C;  4OIQ A;  3S17 C;  2R92 K;  4A3L K;  5M3F K;  4A3C C;  3HKZ D;  4C3I K;  4QIW D;  3WOD A;  1I50 C;  1YNJ A;  2E2H C;  4A3M K;  3CQZ C;  2VUM K;  4OIR A;  2JA6 K;  1BDF A;  3HOW C;  3HOU C;  4Y52 K;  4YFN A;  5C44 K;  2PA8 D;  3S15 K;  1SFO C;  4KN7 A;  5TMF A;  2WB1 L;  4OIO A;  4MEX A;  3I4M C;  3H3V L;  4A3K K;  4A3B K;  4LK0 A;  3S14 K;  4MQ9 A;  4Y7N K;  2WAQ D;  3GTM C;  1HQM A;  5M5W K;  3HOY C;  3RZO C;  3M4O K;  5IP9 C;  4BXX K;  4GZY A;  1SMY A;  2A6E A;  4Y7N C;  3S16 C;  3M3Y K;  3PO3 K;  2O5J A;  5C4J K;  4A3J K;  5IYB C;  2JA5 C;  3GTG C;  2PPB A;  4G7O A;  2CW0 A;  5FJ8 K;  3S2D C;  1Y1W K;  2R7Z K;  4A3F C;  4AYB L;  4C2M K;  4XLP A;  3HOW K;  1R9T C;  4YG2 A;  4BBR C;  4A3G K;  5IYC K;  2NVT C;  3CQZ K;  3S16 K;  4BXX C;  4A3C K;  4A3L C;  4BBS K;  5M5X K;  2B63 K;  2E2J K;  2E2I C;  3S17 K;  1TWF K;  4A3K C;  1Y1V C;  4ZH4 A;  4XLN A;  4JK1 A;  3I4N C;  5C4X K;  2BE5 A;  3S1M K;  4A3F K;  3PO2 K;  2Y0S D;  3DXJ A;  3FKI C;  4Y52 C;  3HOU K;  1WCM C;  4BBS C;  5C3E C;  3EQL A;  3RZD K;  2VUM C;  5M3M K;  2PMZ D;  4LLG A;  4A3J C;  3H0G K;  2R93 C;  4BBR K;  1R9T K;  4A3G C;  3HOV C;  4KN4 A;  3HOY K;  3GTP C;  4A3E C;  5IYD C;  3HOX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...