2NVQK

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvqK00
5IYCC 2JA8K 4QIWL 2A6EA 5C3EC 3RZDC 3S17K 4BY7K 3HKZD 1I6HK 3GTQK 4AYBD 2PPBA 3H0GC 3K7AK 3HOWK 3S1QK 3PO3C 5C4XK 5IP9C 4A3MC 3H3VD 3GTLK 1XPPA 3S14C 1R9TC 1K83K 4A3BC 1WCMK 4C3JK 3HOVC 1I50K 3GTGC 1IW7A 4QJVB 2Y0SD 4A3IK 2E2JC 5M3MK 2JA6K 3HOWC 4A3JK 2O5IA 4A3MK 2O5JA 2NVYK 5TMCA 3GTOC 4A3DC 3CQZK 3EQLA 1TWHC 5C4JC 4A3GK 4YG2A 2JA5C 5C3EK 3GTKK 5IYCK 4XSXA 4A3CK 3HOUC 3S1NK 5IYDC 4OIQA 4Y52K 2B63K 4ZH4A 3S15C 1SMYA 2JA5K 3GTKC 4A3KK 3M4OK 2WAQL 4YFKA 4Y7NK 3M3YK 3S16C 3GTMC 2E2IK 3HOZC 2WAQD 1BDFA 4LJZA 2NVXK 5M3FK 2JA6C 1TWFK 3I4NC 4A3IC 2NVTC 4BBSK 4G7ZA 4A3BK 4QIWD 4BBSC 1R9TK 5IP7C 1I50C 4KN4A 3GTLC 1K83C 4LK1A 5FLMK 3S1MC 5D4DA 4BY1K 5C44K 3GTMK 1TWFC 4Y7NC 3GTQC 3PO3K 1I6HC 1I3QC 2A68A 2A69A 4G7HA 2YU9C 3H0GK 1TWCK 3K7AC 1Y1WK 3HOXK 3HOYC 4XLNA 3PO2K 3RZOC 3S2HK 2B63C 1SFOK 3S2DC 1YNJA 2VUMC 4A3DK 3GTJC 4OIRA 4XSZA 2A6HA 3WODA 4A93K 4A3FK 4A93C 4C3IK 2PA8L 4A3FC 2R93K 2PMZD 3S1RC 2WB1L 1Y1WC 3RZOK 4OIOA 2WB1D 3S2DK 3DXJA 4KMUA 1TWHK 5C4JK 2JA7C 1YNNA 4BBRC 2R92K 3HKZL 3FKIK 4C3HK 4BY1C 2PA8D 5FLMC 3S1MK 5C44C 5FJ8K 3GTPC 4BXXK 2E2JK 1Y1VK 2NVTK 5IP7K 4QJVA 4Q4ZA 4AYBL 5IP9K 3FKIC 4X6AC 4MQ9A 4JK1A 3S16K 2NVXC 4A3KC 3M4OC 4C2MK 2E2IC 3RZDK 1TWAK 3HOZK 3S1QC 2JA8C 4A3GC 3I4MK 1HQMA 4OINA 2R7ZK 2R93C 3HOUK 4LLGA 1TWGK 2E2HK 4A3LK 2E2HC 3H3VL 2VUMK 2BE5A 5IYBK 4MEXA 3PO2C 3S2HC 1TWAC 3HOYK 4MEYA 1I3QK 2NVYC 2YU9K 3HOXC 3GTOK 4XLPA 1TWCC 3CQZC 4A3EC 4A3JC 3I4NK 3I4MC 4Q5SA 4NOIA 4X6AK 3HOVK 1WCMC 4OIPA 1I6VA 2Y0SL 3GTGK 1Y1VC 5C4XC 3GTPK 3S14K 4KN7A 5TMFA 4BXXC 4LK0A 4A3EK 2JA7K 4BY7C 4BBRK 5M5WK 2PMZL 2R92C 3M3YC 4A3LC 2NVQK 3S17C 5IYBC 3S1RK 5IYDK 4YFNA 5M5YK 5M5XK 3S15K 4G7OA 4A3CC 4Y52C 4YFXA 3S1NC 2CW0A 3GTJK 1TWGC 2R7ZC 4GZYA 1ZYRA 1SFOC 2NVQC
chains in the Genus database with same CATH superfamily
2JA8K 4GTBA 5EGHA 3HKZD 3BP8C 3S1QK 3V4GA 4KMAA 3PO3C 3H3VD 3GTLK 1R9TC 4A3BC 1R9TA 1WOPA 1IL2A 4A3JK 5JFEA 1AB4A 4KB2A 1UV7A 1TWHA 3GTLA 1TWGA 4XSXA 4KC6A 3HOUC 3OREA 5IYDC 4OIQA 4Y52K 4KASA 1O26A 1WORA 2WAQL 3HOZC 4LJZA 2JA6C 1L0WA 4P5BA 3A8KA 3A8IA 1DD5A 1J98A 4GTAA 3QX3A 3TFJA 4G7ZA 1R9TK 5IP7C 2GSNA 3GTLC 1KQ4A 4BY1K 5C44K 1F93A 3GTQC 3IPJA 1I3QC 1WQHA 2A68A 3K7AC 1TWCK 3I4NC 4XLNA 3S2DC 3GSIA 1SFOK 1YNJA 3GTJC 1Y1VA 3WODA 4A93C 3GTJA 4BLAA 3MMLB 2R92A 2WB1L 4OIOA 3T01A 5C4JK 4KAWX 1EK8A 3HKZL 4C2MC 5C44C 2R7ZA 3GTPC 2E2JK 1Y1VK 1X31C 4PABA 3GIRA 3L4KA 2XCOA 2E2IA 1O24A 4MQ9A 1JOEA 4A3KC 2O5JA 4A3GC 1ZBSA 3ADAC 2GAHC 1J6XA 4OINA 2R93C 1WQFA 1TWGK 3LAPA 2GSOA 2BE5A 5IYBK 3HOYK 1I3QK 3I4MC 1PJ5A 1INNA 2V6UA 1TWFA 1EQRA 1IQ0A 4X6AK 1BGWA 3HOVK 4WILA 4P9SA 4BXXC 4KMHA 1C0AA 4A3EK 2JA7K 4BBRK 4J3NA 4DDQA 5M5XK 1K83A 3S15K 5IOQA 4G7OA 3S1NC 4KATA 2XCRB 3GTJK 1TWGC 1WSVA 2CFAB 1SFOC 3GTQK 3H0GC 2JH3A 1IS1A 4A3MC 1XZPB 1K83K 4C3JK 3HOVC 1I50K 1YCLA 3GTGC 2Y0SD 2E2JC 2JA6K 4BLBA 5TMCA 4P5AA 5IORA 5C4JC 1ISEA 5C3EK 4C3IC 4G0UA 3GTGA 4YFKA 3M3YK 3GTMC 2E2IK 5CJ9A 3CAGA 4FM9A 1TWFK 4ILDA 4BBSK 4A3BK 1PJ7A 3GEHA 1XZQA 5FLMK 4XCHA 2ZFZA 1I6HC 2YU9C 3HOYC 3H0GK 3FOEA 3HOXK 2B63C 1BS2A 2FQTA 2VUMC 1B4AA 4A93K 4A3FK 1VJEA 2R93K 3S1RC 4WJ4A 2E2HA 1XXAA 1PJ6A 1Y1WA 2R92K 4WJ3M 4BY1C 1O27A 5FLMC 2JA7A 2YU9A 2ZUEA 4QJVA 5IP9K 2RGRA 1EI6A 3FKIC 1WSRA 4JK1A 2NVXC 3S1QC 1WCMA 1HI9A 3HOUK 1IE0A 3H3VL 1B4BA 3PO2C 1TWAC 4KM9A 3CQZC 3FOFA 4A3JC 4Q5SA 3HXAA 3G4CA 3TFHA 4GTCA 4C3JC 4OIPA 1I6VA 4GTDA 1ZVUA 2EBBA 1Y1VC 3OPFA 3S14K 3LPXA 4KN7A 5TMFA 3AD9C 5M5WK 2R92C 4A3LC 4KM8A 4GTFA 2NVQK 3S17C 1GE9A 5IYDK 3OEPA 1JVIA 3GTOA 5IYCC 2P5MA 5C3EC 2A6EA 3RZDC 2PPBA 1ZQ1C 3K7AK 3HOWK 1XPPA 1USOA 5L46A 3SZYA 4RMFA 1EH1A 1IW7A 1IBAA 5M3MK 2O5IA 2NVYK 3GTOC 3CQZK 1TWHC 4YG2A 5IYCK 2B63A 4FZBA 3GDZA 4G0VA 4A3KK 2RH6A 3S16C 4Y7NK 4A3LK 1BDFA 5M3FK 4A3IC 2Y3PA 4BBSC 1I50C 2KWAA 4KN4A 1WQGA 1K83C 4LK1A 3GTMK 3Q3QA 4Y7NC 2D6FC 3PO3K 4G7HA 3S0XA 3S2HK 1Y1WK 3RZOC 4OIRA 3GEIA 3FHZA 1WIHA 4A3FC 2PMZD 1I50A 2WB1D 4KMUA 4BBRC 3TTGA 3SZZA 4C3HK 2PA8D 5EGEA 3N0CA 4KDDA 1I3QA 1J6VA 1VLOA 5FJ8K 4BXXK 1XXBA 4Q4ZA 1TWCA 2CFAA 4X6AC 5CHPA 1O25A 4C2MK 2E2IC 3RZDK 3T02A 3I4MK 3G4AA 4KB4A 1O2FB 3AQOA 2E2HC 3VA7A 3GTPA 4MEXA 3S2HC 4O2DA 1F7UA 4A3DK 3HOXC 4A3EC 1TWCC 3I4NK 1VH2A 4NOIA 1VGXA 2Y0SL 2W7VA 3L4JA 1O2AA 3GTPK 5C4XC 4LK0A 1EFWA 4BY7C 3M3YC 1WOOA 1DCHA 5IYBC 3S1RK 5M5YK 3GEEA 4A3CC 4Y52C 1YX2A 4GZYA 1ZYRA 3AD7C 4QIWL 4BY7K 2PHCB 4GTLA 1SFOA 3S17K 1I6HK 4AYBD 1O29A 3AD8C 4AH6A 5C4XK 5IP9C 2FQOA 1XXCA 3S14C 2V6SA 1WCMK 1RU0A 4QJVB 5E68A 4A3IK 4BKWA 3ERED 3HOWC 4A3MK 4A3DC 3T00A 3EQLA 2JA5C 3GTKK 2NVYA 3H0GA 5TJ3A 3N3YA 4A3CK 3NUHA 3S1NK 1O28A 2B63K 4ZH4A 3S15C 1SMYA 2JA5K 3GTKC 3GTMA 3AQPA 3M4OK 2R93A 3A8JA 3BP3A 4A3GK 2WAQD 2NVXK 1DCOA 2NVTC 4QIWD 1O2BA 3S1MC 1V5VA 4C3HC 5D4DA 5IOSA 1TWFC 4M1XA 2A69A 1USMA 3PO2K 2P8TA 5JVOA 3GTKA 1XZPA 4XSZA 2A6HA 4C3IK 2PA8L 4GFQA 4LR2A 1XZQB 4LOWA 2ZUFA 1Y1WC 3RZOK 3S2DK 3DXJA 1TWHK 2JA7C 1YNNA 3FKIK 4GT9A 3S1MK 3BUEA 4LQYA 4GTEA 2GAGC 2NVTK 5IP7K 2VUMA 4AYBL 5HL8A 3GTQA 4PAAA 4KMDA 3S16K 3M4OC 3HOZK 1TWAK 2JA8C 3N0BA 1HQMA 4G0WA 1WOSA 2R7ZK 4LLGA 2JA6A 2E2HK 2GSUA 3LAJA 2VUMK 1F7VA 4MEYA 2JA5A 2YU9K 2NVYC 1DCPA 3GTOK 4KARA 4XLPA 5IOTA 3FKIA 1G51A 1VRQC 1TWAA 2NVXA 1J6WA 2XCQA 1BJTA 4C45A 1WCMC 3GTGK 3JSTA 1F9NA 3AH5A 1JQWA 3TFIA 2PMZL 4YFNA 3CQZA 2V6TA 4YFXA 2CW0A 1ZXOA 2R7ZC 2NVQC
chains in the Genus database with same CATH topology
5IYCC 2JA8K 4QIWL 2A6EA 5C3EC 3RZDC 3S17K 4BY7K 3HKZD 1I6HK 3GTQK 4AYBD 2PPBA 3H0GC 3K7AK 3HOWK 3S1QK 3PO3C 5C4XK 5IP9C 4A3MC 3H3VD 3GTLK 1XPPA 3S14C 1R9TC 1K83K 4A3BC 1WCMK 4C3JK 3HOVC 1I50K 3GTGC 1IW7A 4QJVB 2Y0SD 4A3IK 2E2JC 5M3MK 2JA6K 3HOWC 4A3JK 2O5IA 4A3MK 2O5JA 2NVYK 5TMCA 3GTOC 4A3DC 3CQZK 3EQLA 1TWHC 5C4JC 4A3GK 4YG2A 2JA5C 5C3EK 3GTKK 5IYCK 4XSXA 4A3CK 3HOUC 3S1NK 5IYDC 4OIQA 4Y52K 2B63K 4ZH4A 3S15C 1SMYA 2JA5K 3GTKC 4A3KK 3M4OK 2WAQL 4YFKA 4Y7NK 3M3YK 3S16C 3GTMC 2E2IK 3HOZC 2WAQD 1BDFA 4LJZA 2NVXK 5M3FK 2JA6C 1TWFK 3I4NC 4A3IC 2NVTC 4BBSK 4G7ZA 4A3BK 4QIWD 4BBSC 1R9TK 5IP7C 1I50C 4KN4A 3GTLC 1K83C 4LK1A 5FLMK 3S1MC 5D4DA 4BY1K 5C44K 3GTMK 1TWFC 4Y7NC 3GTQC 3PO3K 1I6HC 1I3QC 2A68A 2A69A 4G7HA 2YU9C 3H0GK 1TWCK 3K7AC 1Y1WK 3HOXK 3HOYC 4XLNA 3PO2K 3RZOC 3S2HK 2B63C 1SFOK 3S2DC 1YNJA 2VUMC 4A3DK 3GTJC 4OIRA 4XSZA 2A6HA 3WODA 4A93K 4A3FK 4A93C 4C3IK 2PA8L 4A3FC 2R93K 2PMZD 3S1RC 2WB1L 1Y1WC 3RZOK 4OIOA 2WB1D 3S2DK 3DXJA 4KMUA 1TWHK 5C4JK 2JA7C 1YNNA 4BBRC 2R92K 3HKZL 3FKIK 4C3HK 4BY1C 2PA8D 5FLMC 3S1MK 5C44C 5FJ8K 3GTPC 4BXXK 2E2JK 1Y1VK 2NVTK 5IP7K 4QJVA 4Q4ZA 4AYBL 5IP9K 3FKIC 4X6AC 4MQ9A 4JK1A 3S16K 2NVXC 4A3KC 3M4OC 4C2MK 2E2IC 3RZDK 1TWAK 3HOZK 3S1QC 2JA8C 4A3GC 3I4MK 1HQMA 4OINA 2R7ZK 2R93C 3HOUK 4LLGA 1TWGK 2E2HK 4A3LK 2E2HC 3H3VL 2VUMK 2BE5A 5IYBK 4MEXA 3PO2C 3S2HC 1TWAC 3HOYK 4MEYA 1I3QK 2NVYC 2YU9K 3HOXC 3GTOK 4XLPA 1TWCC 3CQZC 4A3EC 4A3JC 3I4NK 3I4MC 4Q5SA 4NOIA 4X6AK 3HOVK 1WCMC 4OIPA 1I6VA 2Y0SL 3GTGK 1Y1VC 5C4XC 3GTPK 3S14K 4KN7A 5TMFA 4BXXC 4LK0A 4A3EK 2JA7K 4BY7C 4BBRK 5M5WK 2PMZL 2R92C 3M3YC 4A3LC 2NVQK 3S17C 5IYBC 3S1RK 5IYDK 4YFNA 5M5YK 5M5XK 3S15K 4G7OA 4A3CC 4Y52C 4YFXA 3S1NC 2CW0A 3GTJK 1TWGC 2R7ZC 4GZYA 1ZYRA 1SFOC 2NVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC C;  2JA8 K;  4QIW L;  2A6E A;  5C3E C;  3RZD C;  3S17 K;  4BY7 K;  3HKZ D;  1I6H K;  3GTQ K;  4AYB D;  2PPB A;  3H0G C;  3K7A K;  3HOW K;  3S1Q K;  3PO3 C;  5C4X K;  5IP9 C;  4A3M C;  3H3V D;  3GTL K;  1XPP A;  3S14 C;  1R9T C;  1K83 K;  4A3B C;  1WCM K;  4C3J K;  3HOV C;  1I50 K;  3GTG C;  1IW7 A;  4QJV B;  2Y0S D;  4A3I K;  2E2J C;  5M3M K;  2JA6 K;  3HOW C;  4A3J K;  2O5I A;  4A3M K;  2O5J A;  2NVY K;  5TMC A;  3GTO C;  4A3D C;  3CQZ K;  3EQL A;  1TWH C;  5C4J C;  4A3G K;  4YG2 A;  2JA5 C;  5C3E K;  3GTK K;  5IYC K;  4XSX A;  4A3C K;  3HOU C;  3S1N K;  5IYD C;  4OIQ A;  4Y52 K;  2B63 K;  4ZH4 A;  3S15 C;  1SMY A;  2JA5 K;  3GTK C;  4A3K K;  3M4O K;  2WAQ L;  4YFK A;  4Y7N K;  3M3Y K;  3S16 C;  3GTM C;  2E2I K;  3HOZ C;  2WAQ D;  1BDF A;  4LJZ A;  2NVX K;  5M3F K;  2JA6 C;  1TWF K;  3I4N C;  4A3I C;  2NVT C;  4BBS K;  4G7Z A;  4A3B K;  4QIW D;  4BBS C;  1R9T K;  5IP7 C;  1I50 C;  4KN4 A;  3GTL C;  1K83 C;  4LK1 A;  5FLM K;  3S1M C;  5D4D A;  4BY1 K;  5C44 K;  3GTM K;  1TWF C;  4Y7N C;  3GTQ C;  3PO3 K;  1I6H C;  1I3Q C;  2A68 A;  2A69 A;  4G7H A;  2YU9 C;  3H0G K;  1TWC K;  3K7A C;  1Y1W K;  3HOX K;  3HOY C;  4XLN A;  3PO2 K;  3RZO C;  3S2H K;  2B63 C;  1SFO K;  3S2D C;  1YNJ A;  2VUM C;  4A3D K;  3GTJ C;  4OIR A;  4XSZ A;  2A6H A;  3WOD A;  4A93 K;  4A3F K;  4A93 C;  4C3I K;  2PA8 L;  4A3F C;  2R93 K;  2PMZ D;  3S1R C;  2WB1 L;  1Y1W C;  3RZO K;  4OIO A;  2WB1 D;  3S2D K;  3DXJ A;  4KMU A;  1TWH K;  5C4J K;  2JA7 C;  1YNN A;  4BBR C;  2R92 K;  3HKZ L;  3FKI K;  4C3H K;  4BY1 C;  2PA8 D;  5FLM C;  3S1M K;  5C44 C;  5FJ8 K;  3GTP C;  4BXX K;  2E2J K;  1Y1V K;  2NVT K;  5IP7 K;  4QJV A;  4Q4Z A;  4AYB L;  5IP9 K;  3FKI C;  4X6A C;  4MQ9 A;  4JK1 A;  3S16 K;  2NVX C;  4A3K C;  3M4O C;  4C2M K;  2E2I C;  3RZD K;  1TWA K;  3HOZ K;  3S1Q C;  2JA8 C;  4A3G C;  3I4M K;  1HQM A;  4OIN A;  2R7Z K;  2R93 C;  3HOU K;  4LLG A;  1TWG K;  2E2H K;  4A3L K;  2E2H C;  3H3V L;  2VUM K;  2BE5 A;  5IYB K;  4MEX A;  3PO2 C;  3S2H C;  1TWA C;  3HOY K;  4MEY A;  1I3Q K;  2NVY C;  2YU9 K;  3HOX C;  3GTO K;  4XLP A;  1TWC C;  3CQZ C;  4A3E C;  4A3J C;  3I4N K;  3I4M C;  4Q5S A;  4NOI A;  4X6A K;  3HOV K;  1WCM C;  4OIP A;  1I6V A;  2Y0S L;  3GTG K;  1Y1V C;  5C4X C;  3GTP K;  3S14 K;  4KN7 A;  5TMF A;  4BXX C;  4LK0 A;  4A3E K;  2JA7 K;  4BY7 C;  4BBR K;  5M5W K;  2PMZ L;  2R92 C;  3M3Y C;  4A3L C;  2NVQ K;  3S17 C;  5IYB C;  3S1R K;  5IYD K;  4YFN A;  5M5Y K;  5M5X K;  3S15 K;  4G7O A;  4A3C C;  4Y52 C;  4YFX A;  3S1N C;  2CW0 A;  3GTJ K;  1TWG C;  2R7Z C;  4GZY A;  1ZYR A;  1SFO C;  2NVQ C; 
#chains in the Genus database with same CATH topology
 2JA8 K;  4GTB A;  5EGH A;  3HKZ D;  3BP8 C;  3S1Q K;  3V4G A;  4KMA A;  3PO3 C;  3H3V D;  3GTL K;  1R9T C;  4A3B C;  1R9T A;  1WOP A;  1IL2 A;  4A3J K;  5JFE A;  1AB4 A;  4KB2 A;  1UV7 A;  1TWH A;  3GTL A;  1TWG A;  4XSX A;  4KC6 A;  3HOU C;  3ORE A;  5IYD C;  4OIQ A;  4Y52 K;  4KAS A;  1O26 A;  1WOR A;  2WAQ L;  3HOZ C;  4LJZ A;  2JA6 C;  1L0W A;  4P5B A;  3A8K A;  3A8I A;  1DD5 A;  1J98 A;  4GTA A;  3QX3 A;  3TFJ A;  4G7Z A;  1R9T K;  5IP7 C;  2GSN A;  3GTL C;  1KQ4 A;  4BY1 K;  5C44 K;  1F93 A;  3GTQ C;  3IPJ A;  1I3Q C;  1WQH A;  2A68 A;  3K7A C;  1TWC K;  3I4N C;  4XLN A;  3S2D C;  3GSI A;  1SFO K;  1YNJ A;  3GTJ C;  1Y1V A;  3WOD A;  4A93 C;  3GTJ A;  4BLA A;  3MML B;  2R92 A;  2WB1 L;  4OIO A;  3T01 A;  5C4J K;  4KAW X;  1EK8 A;  3HKZ L;  4C2M C;  5C44 C;  2R7Z A;  3GTP C;  2E2J K;  1Y1V K;  1X31 C;  4PAB A;  3GIR A;  3L4K A;  2XCO A;  2E2I A;  1O24 A;  4MQ9 A;  1JOE A;  4A3K C;  2O5J A;  4A3G C;  1ZBS A;  3ADA C;  2GAH C;  1J6X A;  4OIN A;  2R93 C;  1WQF A;  1TWG K;  3LAP A;  2GSO A;  2BE5 A;  5IYB K;  3HOY K;  1I3Q K;  3I4M C;  1PJ5 A;  1INN A;  2V6U A;  1TWF A;  1EQR A;  1IQ0 A;  4X6A K;  1BGW A;  3HOV K;  4WIL A;  4P9S A;  4BXX C;  4KMH A;  1C0A A;  4A3E K;  2JA7 K;  4BBR K;  4J3N A;  4DDQ A;  5M5X K;  1K83 A;  3S15 K;  5IOQ A;  4G7O A;  3S1N C;  4KAT A;  2XCR B;  3GTJ K;  1TWG C;  1WSV A;  2CFA B;  1SFO C;  3GTQ K;  3H0G C;  2JH3 A;  1IS1 A;  4A3M C;  1XZP B;  1K83 K;  4C3J K;  3HOV C;  1I50 K;  1YCL A;  3GTG C;  2Y0S D;  2E2J C;  2JA6 K;  4BLB A;  5TMC A;  4P5A A;  5IOR A;  5C4J C;  1ISE A;  5C3E K;  4C3I C;  4G0U A;  3GTG A;  4YFK A;  3M3Y K;  3GTM C;  2E2I K;  5CJ9 A;  3CAG A;  4FM9 A;  1TWF K;  4ILD A;  4BBS K;  4A3B K;  1PJ7 A;  3GEH A;  1XZQ A;  5FLM K;  4XCH A;  2ZFZ A;  1I6H C;  2YU9 C;  3HOY C;  3H0G K;  3FOE A;  3HOX K;  2B63 C;  1BS2 A;  2FQT A;  2VUM C;  1B4A A;  4A93 K;  4A3F K;  1VJE A;  2R93 K;  3S1R C;  4WJ4 A;  2E2H A;  1XXA A;  1PJ6 A;  1Y1W A;  2R92 K;  4WJ3 M;  4BY1 C;  1O27 A;  5FLM C;  2JA7 A;  2YU9 A;  2ZUE A;  4QJV A;  5IP9 K;  2RGR A;  1EI6 A;  3FKI C;  1WSR A;  4JK1 A;  2NVX C;  3S1Q C;  1WCM A;  1HI9 A;  3HOU K;  1IE0 A;  3H3V L;  1B4B A;  3PO2 C;  1TWA C;  4KM9 A;  3CQZ C;  3FOF A;  4A3J C;  4Q5S A;  3HXA A;  3G4C A;  3TFH A;  4GTC A;  4C3J C;  4OIP A;  1I6V A;  4GTD A;  1ZVU A;  2EBB A;  1Y1V C;  3OPF A;  3S14 K;  3LPX A;  4KN7 A;  5TMF A;  3AD9 C;  5M5W K;  2R92 C;  4A3L C;  4KM8 A;  4GTF A;  2NVQ K;  3S17 C;  1GE9 A;  5IYD K;  3OEP A;  1JVI A;  3GTO A;  5IYC C;  2P5M A;  5C3E C;  2A6E A;  3RZD C;  2PPB A;  1ZQ1 C;  3K7A K;  3HOW K;  1XPP A;  1USO A;  5L46 A;  3SZY A;  4RMF A;  1EH1 A;  1IW7 A;  1IBA A;  5M3M K;  2O5I A;  2NVY K;  3GTO C;  3CQZ K;  1TWH C;  4YG2 A;  5IYC K;  2B63 A;  4FZB A;  3GDZ A;  4G0V A;  4A3K K;  2RH6 A;  3S16 C;  4Y7N K;  4A3L K;  1BDF A;  5M3F K;  4A3I C;  2Y3P A;  4BBS C;  1I50 C;  2KWA A;  4KN4 A;  1WQG A;  1K83 C;  4LK1 A;  3GTM K;  3Q3Q A;  4Y7N C;  2D6F C;  3PO3 K;  4G7H A;  3S0X A;  3S2H K;  1Y1W K;  3RZO C;  4OIR A;  3GEI A;  3FHZ A;  1WIH A;  4A3F C;  2PMZ D;  1I50 A;  2WB1 D;  4KMU A;  4BBR C;  3TTG A;  3SZZ A;  4C3H K;  2PA8 D;  5EGE A;  3N0C A;  4KDD A;  1I3Q A;  1J6V A;  1VLO A;  5FJ8 K;  4BXX K;  1XXB A;  4Q4Z A;  1TWC A;  2CFA A;  4X6A C;  5CHP A;  1O25 A;  4C2M K;  2E2I C;  3RZD K;  3T02 A;  3I4M K;  3G4A A;  4KB4 A;  1O2F B;  3AQO A;  2E2H C;  3VA7 A;  3GTP A;  4MEX A;  3S2H C;  4O2D A;  1F7U A;  4A3D K;  3HOX C;  4A3E C;  1TWC C;  3I4N K;  1VH2 A;  4NOI A;  1VGX A;  2Y0S L;  2W7V A;  3L4J A;  1O2A A;  3GTP K;  5C4X C;  4LK0 A;  1EFW A;  4BY7 C;  3M3Y C;  1WOO A;  1DCH A;  5IYB C;  3S1R K;  5M5Y K;  3GEE A;  4A3C C;  4Y52 C;  1YX2 A;  4GZY A;  1ZYR A;  3AD7 C;  4QIW L;  4BY7 K;  2PHC B;  4GTL A;  1SFO A;  3S17 K;  1I6H K;  4AYB D;  1O29 A;  3AD8 C;  4AH6 A;  5C4X K;  5IP9 C;  2FQO A;  1XXC A;  3S14 C;  2V6S A;  1WCM K;  1RU0 A;  4QJV B;  5E68 A;  4A3I K;  4BKW A;  3ERE D;  3HOW C;  4A3M K;  4A3D C;  3T00 A;  3EQL A;  2JA5 C;  3GTK K;  2NVY A;  3H0G A;  5TJ3 A;  3N3Y A;  4A3C K;  3NUH A;  3S1N K;  1O28 A;  2B63 K;  4ZH4 A;  3S15 C;  1SMY A;  2JA5 K;  3GTK C;  3GTM A;  3AQP A;  3M4O K;  2R93 A;  3A8J A;  3BP3 A;  4A3G K;  2WAQ D;  2NVX K;  1DCO A;  2NVT C;  4QIW D;  1O2B A;  3S1M C;  1V5V A;  4C3H C;  5D4D A;  5IOS A;  1TWF C;  4M1X A;  2A69 A;  1USM A;  3PO2 K;  2P8T A;  5JVO A;  3GTK A;  1XZP A;  4XSZ A;  2A6H A;  4C3I K;  2PA8 L;  4GFQ A;  4LR2 A;  1XZQ B;  4LOW A;  2ZUF A;  1Y1W C;  3RZO K;  3S2D K;  3DXJ A;  1TWH K;  2JA7 C;  1YNN A;  3FKI K;  4GT9 A;  3S1M K;  3BUE A;  4LQY A;  4GTE A;  2GAG C;  2NVT K;  5IP7 K;  2VUM A;  4AYB L;  5HL8 A;  3GTQ A;  4PAA A;  4KMD A;  3S16 K;  3M4O C;  3HOZ K;  1TWA K;  2JA8 C;  3N0B A;  1HQM A;  4G0W A;  1WOS A;  2R7Z K;  4LLG A;  2JA6 A;  2E2H K;  2GSU A;  3LAJ A;  2VUM K;  1F7V A;  4MEY A;  2JA5 A;  2YU9 K;  2NVY C;  1DCP A;  3GTO K;  4KAR A;  4XLP A;  5IOT A;  3FKI A;  1G51 A;  1VRQ C;  1TWA A;  2NVX A;  1J6W A;  2XCQ A;  1BJT A;  4C45 A;  1WCM C;  3GTG K;  3JST A;  1F9N A;  3AH5 A;  1JQW A;  3TFI A;  2PMZ L;  4YFN A;  3CQZ A;  2V6T A;  4YFX A;  2CW0 A;  1ZXO A;  2R7Z C;  2NVQ C; 
#chains in the Genus database with same CATH homology
 5IYC C;  2JA8 K;  4QIW L;  2A6E A;  5C3E C;  3RZD C;  3S17 K;  4BY7 K;  3HKZ D;  1I6H K;  3GTQ K;  4AYB D;  2PPB A;  3H0G C;  3K7A K;  3HOW K;  3S1Q K;  3PO3 C;  5C4X K;  5IP9 C;  4A3M C;  3H3V D;  3GTL K;  1XPP A;  3S14 C;  1R9T C;  1K83 K;  4A3B C;  1WCM K;  4C3J K;  3HOV C;  1I50 K;  3GTG C;  1IW7 A;  4QJV B;  2Y0S D;  4A3I K;  2E2J C;  5M3M K;  2JA6 K;  3HOW C;  4A3J K;  2O5I A;  4A3M K;  2O5J A;  2NVY K;  5TMC A;  3GTO C;  4A3D C;  3CQZ K;  3EQL A;  1TWH C;  5C4J C;  4A3G K;  4YG2 A;  2JA5 C;  5C3E K;  3GTK K;  5IYC K;  4XSX A;  4A3C K;  3HOU C;  3S1N K;  5IYD C;  4OIQ A;  4Y52 K;  2B63 K;  4ZH4 A;  3S15 C;  1SMY A;  2JA5 K;  3GTK C;  4A3K K;  3M4O K;  2WAQ L;  4YFK A;  4Y7N K;  3M3Y K;  3S16 C;  3GTM C;  2E2I K;  3HOZ C;  2WAQ D;  1BDF A;  4LJZ A;  2NVX K;  5M3F K;  2JA6 C;  1TWF K;  3I4N C;  4A3I C;  2NVT C;  4BBS K;  4G7Z A;  4A3B K;  4QIW D;  4BBS C;  1R9T K;  5IP7 C;  1I50 C;  4KN4 A;  3GTL C;  1K83 C;  4LK1 A;  5FLM K;  3S1M C;  5D4D A;  4BY1 K;  5C44 K;  3GTM K;  1TWF C;  4Y7N C;  3GTQ C;  3PO3 K;  1I6H C;  1I3Q C;  2A68 A;  2A69 A;  4G7H A;  2YU9 C;  3H0G K;  1TWC K;  3K7A C;  1Y1W K;  3HOX K;  3HOY C;  4XLN A;  3PO2 K;  3RZO C;  3S2H K;  2B63 C;  1SFO K;  3S2D C;  1YNJ A;  2VUM C;  4A3D K;  3GTJ C;  4OIR A;  4XSZ A;  2A6H A;  3WOD A;  4A93 K;  4A3F K;  4A93 C;  4C3I K;  2PA8 L;  4A3F C;  2R93 K;  2PMZ D;  3S1R C;  2WB1 L;  1Y1W C;  3RZO K;  4OIO A;  2WB1 D;  3S2D K;  3DXJ A;  4KMU A;  1TWH K;  5C4J K;  2JA7 C;  1YNN A;  4BBR C;  2R92 K;  3HKZ L;  3FKI K;  4C3H K;  4BY1 C;  2PA8 D;  5FLM C;  3S1M K;  5C44 C;  5FJ8 K;  3GTP C;  4BXX K;  2E2J K;  1Y1V K;  2NVT K;  5IP7 K;  4QJV A;  4Q4Z A;  4AYB L;  5IP9 K;  3FKI C;  4X6A C;  4MQ9 A;  4JK1 A;  3S16 K;  2NVX C;  4A3K C;  3M4O C;  4C2M K;  2E2I C;  3RZD K;  1TWA K;  3HOZ K;  3S1Q C;  2JA8 C;  4A3G C;  3I4M K;  1HQM A;  4OIN A;  2R7Z K;  2R93 C;  3HOU K;  4LLG A;  1TWG K;  2E2H K;  4A3L K;  2E2H C;  3H3V L;  2VUM K;  2BE5 A;  5IYB K;  4MEX A;  3PO2 C;  3S2H C;  1TWA C;  3HOY K;  4MEY A;  1I3Q K;  2NVY C;  2YU9 K;  3HOX C;  3GTO K;  4XLP A;  1TWC C;  3CQZ C;  4A3E C;  4A3J C;  3I4N K;  3I4M C;  4Q5S A;  4NOI A;  4X6A K;  3HOV K;  1WCM C;  4OIP A;  1I6V A;  2Y0S L;  3GTG K;  1Y1V C;  5C4X C;  3GTP K;  3S14 K;  4KN7 A;  5TMF A;  4BXX C;  4LK0 A;  4A3E K;  2JA7 K;  4BY7 C;  4BBR K;  5M5W K;  2PMZ L;  2R92 C;  3M3Y C;  4A3L C;  2NVQ K;  3S17 C;  5IYB C;  3S1R K;  5IYD K;  4YFN A;  5M5Y K;  5M5X K;  3S15 K;  4G7O A;  4A3C C;  4Y52 C;  4YFX A;  3S1N C;  2CW0 A;  3GTJ K;  1TWG C;  2R7Z C;  4GZY A;  1ZYR A;  1SFO C;  2NVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...