2NVQK

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvqK00
4QIWL 3GTLK 5C4JC 2PMZD 2A6HA 3RZDK 2JA7C 3GTGK 1I6HC 2Y0SD 3K7AK 4XSZA 2YU9K 5C44C 2WB1L 4C3HK 1Y1VC 1TWAK 2CW0A 3HOWC 3S14K 3S1NK 4A3LC 3GTKC 5M3MK 4LK1A 2PA8L 1YNNA 4A3BK 3GTJK 5IYCC 1I3QK 2NVYC 4A3JC 1IW7A 4A3MK 2PPBA 3HOUC 3HOVK 3WODA 5IYBC 5FLMK 3HKZD 5C4XK 1TWFK 4OINA 3PO2C 4G7OA 3GTOC 1I50K 4A3CK 3CQZC 4KN4A 4Y52C 4Y7NK 4AYBL 1HQMA 4QJVB 4YG2A 5IP7C 4A3EK 4OIRA 3GTPK 2R7ZK 3H3VL 3M3YK 4QJVA 2R93K 3I4NC 3H0GC 4Q5SA 5D4DA 4A3FC 5TMCA 2E2HC 3HOZK 1SFOK 3GTQK 4BBSC 2E2JC 4A3IC 3S2DC 3PO3C 4KN7A 2VUMK 5C3EC 2NVXC 4BY1C 3HOYC 5C4JK 2NVTC 2JA7K 3S17C 4XLNA 3HOXC 2B63C 1R9TC 1I6HK 2BE5A 2NVTK 5C44K 4BXXC 1Y1VK 4BBRC 3HOWK 4A3LK 5M5YK 3GTKK 3I4MC 4A93C 4NOIA 5IYCK 2NVYK 4YFKA 4A3JK 4OIPA 1Y1WC 3GTMC 1SMYA 3HOUK 4X6AC 5IYBK 4Q4ZA 1XPPA 2WAQD 4GZYA 5M5XK 3PO2K 1TWHC 3GTOK 4X6AK 2A6EA 3RZOC 1K83C 4BY7C 3CQZK 3S16C 2R92C 3S15C 5IP7K 2PMZL 5M3FK 4Y52K 4XSXA 2NVQC 4A3DC 1TWCC 4YFNA 4A3KC 3I4NK 3H0GK 2Y0SL 5IYDC 4A3FK 2E2HK 3S1MC 4OIOA 1YNJA 4OIQA 4BBSK 4QIWD 2E2JK 4A3IK 3S2DK 3PO3K 3S1QC 4KMUA 3FKIC 3S2HC 4MEYA 5C3EK 2NVXK 4BY1K 2WB1D 3HKZL 3HOYK 2E2IC 2JA6C 3M4OC 3S17K 4A3GC 1BDFA 2PA8D 3HOXK 2B63K 1R9TK 1TWGC 4YFXA 5IP9C 4BXXK 3S1RC 1I6VA 4BBRK 4JK1A 2JA5C 4MEXA 2JA8C 2O5IA 3I4MK 4A93K 5M5WK 4C2MK 2O5JA 3GTMK 1Y1WK 3GTLC 4AYBD 3RZDC 3GTGC 4MQ9A 1WCMC 1ZYRA 3H3VD 4LLGA 1TWHK 3K7AC 2YU9C 3RZOK 4BY7K 1K83K 3S14C 1TWAC 1WCMK 2R92K 3S15K 3S16K 3S1NC 2NVQK 4A3DK 1TWCK 4A3KK 4A3BC 2A68A 3GTJC 4A3MC 1I3QC 4G7HA 5IYDK 4C3IK 5TMFA 3S1MK 3HOVC 4C3JK 4XLPA 5FLMC 3DXJA 1TWFC 5C4XC 3S1QK 1I50C 4LJZA 4A3CC 3FKIK 3S2HK 4Y7NC 3GTPC 5FJ8K 4A3EC 4LK0A 3M3YC 2R7ZC 2WAQL 2E2IK 2R93C 2JA6K 3M4OK 4A3GK 3HOZC 1SFOC 3GTQC 1TWGK 3EQLA 4ZH4A 5IP9K 3S1RK 2A69A 4G7ZA 2VUMC 2JA5K 2JA8K
chains in the Genus database with same CATH superfamily
5CHPA 2JA7A 2Y0SD 1BS2A 2YU9K 5C44C 4C3HK 1Y1VC 3GTKC 5CJ9A 4LK1A 4DDQA 2NVYC 1IW7A 2W7VA 2PPBA 2ZFZA 5FLMK 3HKZD 3GTOC 4KMAA 4KN4A 4A3EK 4YG2A 1JOEA 4BLBA 2Y3PA 3H3VL 4J3NA 4A3FC 3HOZK 3H0GA 1VH2A 4PABA 4LOWA 2GAGC 2V6UA 1XZPB 2NVTC 3G4CA 4G0UA 3S17C 4XLNA 5JVOA 2B63C 5HL8A 4C45A 1BGWA 2BE5A 5C44K 1X31C 1Y1VK 1PJ5A 3GTKK 4P5AA 2NVYK 3GEEA 1Y1WC 1L0WA 3AQOA 3GTMA 2WAQD 1B4BA 3GEIA 3ERED 3GTOK 1WIHA 4KAWX 4X6AK 1K83C 4KATA 2XCOA 3S15C 5M3FK 1WCMA 4YFNA 5IYDC 4A3FK 4M1XA 4OIOA 4QIWD 1DCPA 3SZZA 4KMUA 1VJEA 3TFJA 3FKIA 3AH5A 1USMA 2JA6C 3S17K 3M4OC 2RH6A 1O25A 2B63K 5TJ3A 1IQ0A 5IP9C 4JK1A 3SZYA 1F7VA 4KMDA 2CFAB 1O28A 2JA8C 5M5WK 4WJ4A 1Y1WK 3GEHA 1ZYRA 2FQOA 1K83K 3S14C 3S15K 1TWAA 4A3BC 1I3QC 5IYDK 2ZUEA 3GTKA 1ZBSA 1TWFC 3TTGA 3IPJA 1XZQA 3M3YC 2R93C 2JA6K 3M4OK 1C0AA 3LAJA 2R7ZA 1EH1A 3GTQC 1G51A 5IP9K 1O29A 2JA8K 1F9NA 2VUMA 3QX3A 2A6HA 4GTLA 1AB4A 3L4JA 4XSZA 3GSIA 2EBBA 3S14K 2CW0A 3HOWC 4A3LC 3G4AA 3OPFA 4A3BK 1YNNA 4PAAA 5IYCC 1I3QK 1WQHA 1ZQ1C 4A3JC 4WJ3M 3FOFA 5IYBC 3GIRA 1JQWA 1TWFK 3ADAC 1O2FB 1WQGA 3CQZC 4Y52C 2GSNA 4OIRA 3M3YK 2R93K 1O2BA 5D4DA 3GTQK 4BBSC 2E2HA 2E2JC 3S2DC 3PO3C 3N0BA 3LPXA 4GTCA 4BY1C 2NVXC 3HOXC 1R9TC 4BXXC 3NUHA 1XXAA 4BBRC 3HOWK 4A3LK 5IYCK 3AQPA 4A3JK 4OIPA 1WORA 4LR2A 3V4GA 4X6AC 5IYBK 1HI9A 4GZYA 1VRQC 1TWHC 3Q3QA 1IL2A 3CQZK 1IS1A 4Y52K 2PMZL 3TFHA 2NVQC 1TWCC 2R92A 4OIQA 4BBSK 2E2JK 3S2DK 3PO3K 3S1QC 1YCLA 1BJTA 3AD9C 3S2HC 4BY1K 2NVXK 4KM9A 4P5BA 2V6SA 4A3GC 3HOXK 1R9TK 4BXXK 1TWGA 4BBRK 3GTQA 2JA5A 2O5JA 3GTLC 3GTGC 5IOSA 3H3VD 4LLGA 1JVIA 1TWHK 3K7AC 4WILA 2YU9A 2NVQK 3BUEA 1TWCK 4KMHA 3GTJC 4A3MC 1PJ7A 2P5MA 4G0WA 3HOVC 4P9SA 4G0VA 3DXJA 5L46A 3S1QK 1XZQB 3OEPA 4A3CC 3S2HK 3GTPC 3FHZA 3GDZA 4A3GK 1O27A 1SFOC 2ZUFA 3GTLK 5C4JC 1J6VA 2JA7C 3GTGK 4BLAA 3K7AK 2WB1L 4GFQA 5JFEA 1Y1VA 5M3MK 2PA8L 3GTJK 4A3MK 3HOUC 1YX2A 2NVYA 5EGEA 3HOVK 3WODA 1J6XA 1ZVUA 4OINA 3PO2C 4G7OA 4A3CK 3GTOA 3GTPK 4AYBL 1HQMA 5IP7C 4QJVA 2XCRB 3H0GC 3I4NC 3T00A 1SFOK 1J98A 1VLOA 4A3IC 4GTAA 4KN7A 4FZBA 1VGXA 1V5VA 1RU0A 3S0XA 3A8JA 3T01A 5C4JK 1O24A 4AH6A 2JA7K 5E68A 4BKWA 2B63A 5M5YK 4KM8A 3I4MC 4A93C 4NOIA 4XCHA 4GT9A 4C2MC 4GTDA 3FOEA 1GE9A 3GTMC 3HOUK 1SMYA 4Q4ZA 1XPPA 1Y1WA 5M5XK 3PO2K 2A6EA 3RZOC 4BY7C 3S16C 1WOPA 5IP7K 3VA7A 1K83A 4XSXA 4A3DC 4A3KC 2XCQA 3H0GK 1KQ4A 2Y0SL 1F7UA 4C3IC 3I4NK 3S1MC 4A3IK 1EFWA 3AD8C 3FKIC 3CAGA 4MEYA 1J6WA 3HKZL 2E2IC 3L4KA 2JA6A 1INNA 1ISEA 1DD5A 3S1RC 3A8KA 2GSUA 4MEXA 2O5IA 3I4MK 4A93K 4C2MK 3GTMK 3TFIA 3RZDC 4MQ9A 3HXAA 3RZOK 4BY7K 1TWAC 1WCMK 1DCHA 3S16K 3S1NC 4A3DK 4A3KK 4C3IK 3S1MK 1I3QA 3N0CA 4GTBA 5C4XC 1EI6A 1I50C 4LJZA 1TWFA 5IORA 3FKIK 4Y7NC 4LK0A 1WSVA 3N3YA 2WAQL 1F93A 2E2IK 2R7ZC 2R93A 3EQLA 4ZH4A 3S1RK 2A69A 2RGRA 4G7ZA 2VUMC 1WSRA 4QIWL 2PMZD 3RZDK 1IE0A 1I6HC 1USOA 1TWAK 3S1NK 5EGHA 4KDDA 5C4XK 3A8IA 1I50K 1EQRA 4KC6A 4Y7NK 4QJVB 3CQZA 2FQTA 4KB4A 2R7ZK 4Q5SA 4O2DA 5TMCA 2E2HC 2VUMK 4RMFA 2KWAA 1B4AA 1IBAA 4KB2A 5C3EC 4LQYA 4GTEA 3HOYC 2NVXA 1XZPA 5IOTA 1DCOA 1I6HK 1WOSA 2NVTK 1R9TA 2E2IA 2PHCB 4YFKA 3AD7C 1UV7A 1TWHA 2JH3A 2R92C 2V6TA 4ILDA 1TWCA 2E2HK 1O2AA 2D6FC 4C3JC 1YNJA 3JSTA 3MMLB 3LAPA 1ZXOA 5C3EK 2WB1D 3HOYK 3OREA 1I50A 1BDFA 2PA8D 1TWGC 4YFXA 1PJ6A 1I6VA 4KASA 2JA5C 2GSOA 4GTFA 2CFAA 1EK8A 4AYBD 3GTLA 1WCMC 3GTGA 2YU9C 4C3HC 1XXCA 2R92K 4FM9A 2A68A 4G7HA 2P8TA 5TMFA 3GTJA 1WQFA 4C3JK 4XLPA 5FLMC 1XXBA 1WOOA 5FJ8K 2GAHC 4A3EC 3T02A 3GTPA 3HOZC 5IOQA 3BP8C 1TWGK 4KARA 3BP3A 1SFOA 2JA5K 1O26A
chains in the Genus database with same CATH topology
4QIWL 3GTLK 5C4JC 2PMZD 2A6HA 3RZDK 2JA7C 3GTGK 1I6HC 2Y0SD 3K7AK 4XSZA 2YU9K 5C44C 2WB1L 4C3HK 1Y1VC 1TWAK 2CW0A 3HOWC 3S14K 3S1NK 4A3LC 3GTKC 5M3MK 4LK1A 2PA8L 1YNNA 4A3BK 3GTJK 5IYCC 1I3QK 2NVYC 4A3JC 1IW7A 4A3MK 2PPBA 3HOUC 3HOVK 3WODA 5IYBC 5FLMK 3HKZD 5C4XK 1TWFK 4OINA 3PO2C 4G7OA 3GTOC 1I50K 4A3CK 3CQZC 4KN4A 4Y52C 4Y7NK 4AYBL 1HQMA 4QJVB 4YG2A 5IP7C 4A3EK 4OIRA 3GTPK 2R7ZK 3H3VL 3M3YK 4QJVA 2R93K 3I4NC 3H0GC 4Q5SA 5D4DA 4A3FC 5TMCA 2E2HC 3HOZK 1SFOK 3GTQK 4BBSC 2E2JC 4A3IC 3S2DC 3PO3C 4KN7A 2VUMK 5C3EC 2NVXC 4BY1C 3HOYC 5C4JK 2NVTC 2JA7K 3S17C 4XLNA 3HOXC 2B63C 1R9TC 1I6HK 2BE5A 2NVTK 5C44K 4BXXC 1Y1VK 4BBRC 3HOWK 4A3LK 5M5YK 3GTKK 3I4MC 4A93C 4NOIA 5IYCK 2NVYK 4YFKA 4A3JK 4OIPA 1Y1WC 3GTMC 1SMYA 3HOUK 4X6AC 5IYBK 4Q4ZA 1XPPA 2WAQD 4GZYA 5M5XK 3PO2K 1TWHC 3GTOK 4X6AK 2A6EA 3RZOC 1K83C 4BY7C 3CQZK 3S16C 2R92C 3S15C 5IP7K 2PMZL 5M3FK 4Y52K 4XSXA 2NVQC 4A3DC 1TWCC 4YFNA 4A3KC 3I4NK 3H0GK 2Y0SL 5IYDC 4A3FK 2E2HK 3S1MC 4OIOA 1YNJA 4OIQA 4BBSK 4QIWD 2E2JK 4A3IK 3S2DK 3PO3K 3S1QC 4KMUA 3FKIC 3S2HC 4MEYA 5C3EK 2NVXK 4BY1K 2WB1D 3HKZL 3HOYK 2E2IC 2JA6C 3M4OC 3S17K 4A3GC 1BDFA 2PA8D 3HOXK 2B63K 1R9TK 1TWGC 4YFXA 5IP9C 4BXXK 3S1RC 1I6VA 4BBRK 4JK1A 2JA5C 4MEXA 2JA8C 2O5IA 3I4MK 4A93K 5M5WK 4C2MK 2O5JA 3GTMK 1Y1WK 3GTLC 4AYBD 3RZDC 3GTGC 4MQ9A 1WCMC 1ZYRA 3H3VD 4LLGA 1TWHK 3K7AC 2YU9C 3RZOK 4BY7K 1K83K 3S14C 1TWAC 1WCMK 2R92K 3S15K 3S16K 3S1NC 2NVQK 4A3DK 1TWCK 4A3KK 4A3BC 2A68A 3GTJC 4A3MC 1I3QC 4G7HA 5IYDK 4C3IK 5TMFA 3S1MK 3HOVC 4C3JK 4XLPA 5FLMC 3DXJA 1TWFC 5C4XC 3S1QK 1I50C 4LJZA 4A3CC 3FKIK 3S2HK 4Y7NC 3GTPC 5FJ8K 4A3EC 4LK0A 3M3YC 2R7ZC 2WAQL 2E2IK 2R93C 2JA6K 3M4OK 4A3GK 3HOZC 1SFOC 3GTQC 1TWGK 3EQLA 4ZH4A 5IP9K 3S1RK 2A69A 4G7ZA 2VUMC 2JA5K 2JA8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW L;  3GTL K;  5C4J C;  2PMZ D;  2A6H A;  3RZD K;  2JA7 C;  3GTG K;  1I6H C;  2Y0S D;  3K7A K;  4XSZ A;  2YU9 K;  5C44 C;  2WB1 L;  4C3H K;  1Y1V C;  1TWA K;  2CW0 A;  3HOW C;  3S14 K;  3S1N K;  4A3L C;  3GTK C;  5M3M K;  4LK1 A;  2PA8 L;  1YNN A;  4A3B K;  3GTJ K;  5IYC C;  1I3Q K;  2NVY C;  4A3J C;  1IW7 A;  4A3M K;  2PPB A;  3HOU C;  3HOV K;  3WOD A;  5IYB C;  5FLM K;  3HKZ D;  5C4X K;  1TWF K;  4OIN A;  3PO2 C;  4G7O A;  3GTO C;  1I50 K;  4A3C K;  3CQZ C;  4KN4 A;  4Y52 C;  4Y7N K;  4AYB L;  1HQM A;  4QJV B;  4YG2 A;  5IP7 C;  4A3E K;  4OIR A;  3GTP K;  2R7Z K;  3H3V L;  3M3Y K;  4QJV A;  2R93 K;  3I4N C;  3H0G C;  4Q5S A;  5D4D A;  4A3F C;  5TMC A;  2E2H C;  3HOZ K;  1SFO K;  3GTQ K;  4BBS C;  2E2J C;  4A3I C;  3S2D C;  3PO3 C;  4KN7 A;  2VUM K;  5C3E C;  2NVX C;  4BY1 C;  3HOY C;  5C4J K;  2NVT C;  2JA7 K;  3S17 C;  4XLN A;  3HOX C;  2B63 C;  1R9T C;  1I6H K;  2BE5 A;  2NVT K;  5C44 K;  4BXX C;  1Y1V K;  4BBR C;  3HOW K;  4A3L K;  5M5Y K;  3GTK K;  3I4M C;  4A93 C;  4NOI A;  5IYC K;  2NVY K;  4YFK A;  4A3J K;  4OIP A;  1Y1W C;  3GTM C;  1SMY A;  3HOU K;  4X6A C;  5IYB K;  4Q4Z A;  1XPP A;  2WAQ D;  4GZY A;  5M5X K;  3PO2 K;  1TWH C;  3GTO K;  4X6A K;  2A6E A;  3RZO C;  1K83 C;  4BY7 C;  3CQZ K;  3S16 C;  2R92 C;  3S15 C;  5IP7 K;  2PMZ L;  5M3F K;  4Y52 K;  4XSX A;  2NVQ C;  4A3D C;  1TWC C;  4YFN A;  4A3K C;  3I4N K;  3H0G K;  2Y0S L;  5IYD C;  4A3F K;  2E2H K;  3S1M C;  4OIO A;  1YNJ A;  4OIQ A;  4BBS K;  4QIW D;  2E2J K;  4A3I K;  3S2D K;  3PO3 K;  3S1Q C;  4KMU A;  3FKI C;  3S2H C;  4MEY A;  5C3E K;  2NVX K;  4BY1 K;  2WB1 D;  3HKZ L;  3HOY K;  2E2I C;  2JA6 C;  3M4O C;  3S17 K;  4A3G C;  1BDF A;  2PA8 D;  3HOX K;  2B63 K;  1R9T K;  1TWG C;  4YFX A;  5IP9 C;  4BXX K;  3S1R C;  1I6V A;  4BBR K;  4JK1 A;  2JA5 C;  4MEX A;  2JA8 C;  2O5I A;  3I4M K;  4A93 K;  5M5W K;  4C2M K;  2O5J A;  3GTM K;  1Y1W K;  3GTL C;  4AYB D;  3RZD C;  3GTG C;  4MQ9 A;  1WCM C;  1ZYR A;  3H3V D;  4LLG A;  1TWH K;  3K7A C;  2YU9 C;  3RZO K;  4BY7 K;  1K83 K;  3S14 C;  1TWA C;  1WCM K;  2R92 K;  3S15 K;  3S16 K;  3S1N C;  2NVQ K;  4A3D K;  1TWC K;  4A3K K;  4A3B C;  2A68 A;  3GTJ C;  4A3M C;  1I3Q C;  4G7H A;  5IYD K;  4C3I K;  5TMF A;  3S1M K;  3HOV C;  4C3J K;  4XLP A;  5FLM C;  3DXJ A;  1TWF C;  5C4X C;  3S1Q K;  1I50 C;  4LJZ A;  4A3C C;  3FKI K;  3S2H K;  4Y7N C;  3GTP C;  5FJ8 K;  4A3E C;  4LK0 A;  3M3Y C;  2R7Z C;  2WAQ L;  2E2I K;  2R93 C;  2JA6 K;  3M4O K;  4A3G K;  3HOZ C;  1SFO C;  3GTQ C;  1TWG K;  3EQL A;  4ZH4 A;  5IP9 K;  3S1R K;  2A69 A;  4G7Z A;  2VUM C;  2JA5 K;  2JA8 K; 
#chains in the Genus database with same CATH topology
 5CHP A;  2JA7 A;  2Y0S D;  1BS2 A;  2YU9 K;  5C44 C;  4C3H K;  1Y1V C;  3GTK C;  5CJ9 A;  4LK1 A;  4DDQ A;  2NVY C;  1IW7 A;  2W7V A;  2PPB A;  2ZFZ A;  5FLM K;  3HKZ D;  3GTO C;  4KMA A;  4KN4 A;  4A3E K;  4YG2 A;  1JOE A;  4BLB A;  2Y3P A;  3H3V L;  4J3N A;  4A3F C;  3HOZ K;  3H0G A;  1VH2 A;  4PAB A;  4LOW A;  2GAG C;  2V6U A;  1XZP B;  2NVT C;  3G4C A;  4G0U A;  3S17 C;  4XLN A;  5JVO A;  2B63 C;  5HL8 A;  4C45 A;  1BGW A;  2BE5 A;  5C44 K;  1X31 C;  1Y1V K;  1PJ5 A;  3GTK K;  4P5A A;  2NVY K;  3GEE A;  1Y1W C;  1L0W A;  3AQO A;  3GTM A;  2WAQ D;  1B4B A;  3GEI A;  3ERE D;  3GTO K;  1WIH A;  4KAW X;  4X6A K;  1K83 C;  4KAT A;  2XCO A;  3S15 C;  5M3F K;  1WCM A;  4YFN A;  5IYD C;  4A3F K;  4M1X A;  4OIO A;  4QIW D;  1DCP A;  3SZZ A;  4KMU A;  1VJE A;  3TFJ A;  3FKI A;  3AH5 A;  1USM A;  2JA6 C;  3S17 K;  3M4O C;  2RH6 A;  1O25 A;  2B63 K;  5TJ3 A;  1IQ0 A;  5IP9 C;  4JK1 A;  3SZY A;  1F7V A;  4KMD A;  2CFA B;  1O28 A;  2JA8 C;  5M5W K;  4WJ4 A;  1Y1W K;  3GEH A;  1ZYR A;  2FQO A;  1K83 K;  3S14 C;  3S15 K;  1TWA A;  4A3B C;  1I3Q C;  5IYD K;  2ZUE A;  3GTK A;  1ZBS A;  1TWF C;  3TTG A;  3IPJ A;  1XZQ A;  3M3Y C;  2R93 C;  2JA6 K;  3M4O K;  1C0A A;  3LAJ A;  2R7Z A;  1EH1 A;  3GTQ C;  1G51 A;  5IP9 K;  1O29 A;  2JA8 K;  1F9N A;  2VUM A;  3QX3 A;  2A6H A;  4GTL A;  1AB4 A;  3L4J A;  4XSZ A;  3GSI A;  2EBB A;  3S14 K;  2CW0 A;  3HOW C;  4A3L C;  3G4A A;  3OPF A;  4A3B K;  1YNN A;  4PAA A;  5IYC C;  1I3Q K;  1WQH A;  1ZQ1 C;  4A3J C;  4WJ3 M;  3FOF A;  5IYB C;  3GIR A;  1JQW A;  1TWF K;  3ADA C;  1O2F B;  1WQG A;  3CQZ C;  4Y52 C;  2GSN A;  4OIR A;  3M3Y K;  2R93 K;  1O2B A;  5D4D A;  3GTQ K;  4BBS C;  2E2H A;  2E2J C;  3S2D C;  3PO3 C;  3N0B A;  3LPX A;  4GTC A;  4BY1 C;  2NVX C;  3HOX C;  1R9T C;  4BXX C;  3NUH A;  1XXA A;  4BBR C;  3HOW K;  4A3L K;  5IYC K;  3AQP A;  4A3J K;  4OIP A;  1WOR A;  4LR2 A;  3V4G A;  4X6A C;  5IYB K;  1HI9 A;  4GZY A;  1VRQ C;  1TWH C;  3Q3Q A;  1IL2 A;  3CQZ K;  1IS1 A;  4Y52 K;  2PMZ L;  3TFH A;  2NVQ C;  1TWC C;  2R92 A;  4OIQ A;  4BBS K;  2E2J K;  3S2D K;  3PO3 K;  3S1Q C;  1YCL A;  1BJT A;  3AD9 C;  3S2H C;  4BY1 K;  2NVX K;  4KM9 A;  4P5B A;  2V6S A;  4A3G C;  3HOX K;  1R9T K;  4BXX K;  1TWG A;  4BBR K;  3GTQ A;  2JA5 A;  2O5J A;  3GTL C;  3GTG C;  5IOS A;  3H3V D;  4LLG A;  1JVI A;  1TWH K;  3K7A C;  4WIL A;  2YU9 A;  2NVQ K;  3BUE A;  1TWC K;  4KMH A;  3GTJ C;  4A3M C;  1PJ7 A;  2P5M A;  4G0W A;  3HOV C;  4P9S A;  4G0V A;  3DXJ A;  5L46 A;  3S1Q K;  1XZQ B;  3OEP A;  4A3C C;  3S2H K;  3GTP C;  3FHZ A;  3GDZ A;  4A3G K;  1O27 A;  1SFO C;  2ZUF A;  3GTL K;  5C4J C;  1J6V A;  2JA7 C;  3GTG K;  4BLA A;  3K7A K;  2WB1 L;  4GFQ A;  5JFE A;  1Y1V A;  5M3M K;  2PA8 L;  3GTJ K;  4A3M K;  3HOU C;  1YX2 A;  2NVY A;  5EGE A;  3HOV K;  3WOD A;  1J6X A;  1ZVU A;  4OIN A;  3PO2 C;  4G7O A;  4A3C K;  3GTO A;  3GTP K;  4AYB L;  1HQM A;  5IP7 C;  4QJV A;  2XCR B;  3H0G C;  3I4N C;  3T00 A;  1SFO K;  1J98 A;  1VLO A;  4A3I C;  4GTA A;  4KN7 A;  4FZB A;  1VGX A;  1V5V A;  1RU0 A;  3S0X A;  3A8J A;  3T01 A;  5C4J K;  1O24 A;  4AH6 A;  2JA7 K;  5E68 A;  4BKW A;  2B63 A;  5M5Y K;  4KM8 A;  3I4M C;  4A93 C;  4NOI A;  4XCH A;  4GT9 A;  4C2M C;  4GTD A;  3FOE A;  1GE9 A;  3GTM C;  3HOU K;  1SMY A;  4Q4Z A;  1XPP A;  1Y1W A;  5M5X K;  3PO2 K;  2A6E A;  3RZO C;  4BY7 C;  3S16 C;  1WOP A;  5IP7 K;  3VA7 A;  1K83 A;  4XSX A;  4A3D C;  4A3K C;  2XCQ A;  3H0G K;  1KQ4 A;  2Y0S L;  1F7U A;  4C3I C;  3I4N K;  3S1M C;  4A3I K;  1EFW A;  3AD8 C;  3FKI C;  3CAG A;  4MEY A;  1J6W A;  3HKZ L;  2E2I C;  3L4K A;  2JA6 A;  1INN A;  1ISE A;  1DD5 A;  3S1R C;  3A8K A;  2GSU A;  4MEX A;  2O5I A;  3I4M K;  4A93 K;  4C2M K;  3GTM K;  3TFI A;  3RZD C;  4MQ9 A;  3HXA A;  3RZO K;  4BY7 K;  1TWA C;  1WCM K;  1DCH A;  3S16 K;  3S1N C;  4A3D K;  4A3K K;  4C3I K;  3S1M K;  1I3Q A;  3N0C A;  4GTB A;  5C4X C;  1EI6 A;  1I50 C;  4LJZ A;  1TWF A;  5IOR A;  3FKI K;  4Y7N C;  4LK0 A;  1WSV A;  3N3Y A;  2WAQ L;  1F93 A;  2E2I K;  2R7Z C;  2R93 A;  3EQL A;  4ZH4 A;  3S1R K;  2A69 A;  2RGR A;  4G7Z A;  2VUM C;  1WSR A;  4QIW L;  2PMZ D;  3RZD K;  1IE0 A;  1I6H C;  1USO A;  1TWA K;  3S1N K;  5EGH A;  4KDD A;  5C4X K;  3A8I A;  1I50 K;  1EQR A;  4KC6 A;  4Y7N K;  4QJV B;  3CQZ A;  2FQT A;  4KB4 A;  2R7Z K;  4Q5S A;  4O2D A;  5TMC A;  2E2H C;  2VUM K;  4RMF A;  2KWA A;  1B4A A;  1IBA A;  4KB2 A;  5C3E C;  4LQY A;  4GTE A;  3HOY C;  2NVX A;  1XZP A;  5IOT A;  1DCO A;  1I6H K;  1WOS A;  2NVT K;  1R9T A;  2E2I A;  2PHC B;  4YFK A;  3AD7 C;  1UV7 A;  1TWH A;  2JH3 A;  2R92 C;  2V6T A;  4ILD A;  1TWC A;  2E2H K;  1O2A A;  2D6F C;  4C3J C;  1YNJ A;  3JST A;  3MML B;  3LAP A;  1ZXO A;  5C3E K;  2WB1 D;  3HOY K;  3ORE A;  1I50 A;  1BDF A;  2PA8 D;  1TWG C;  4YFX A;  1PJ6 A;  1I6V A;  4KAS A;  2JA5 C;  2GSO A;  4GTF A;  2CFA A;  1EK8 A;  4AYB D;  3GTL A;  1WCM C;  3GTG A;  2YU9 C;  4C3H C;  1XXC A;  2R92 K;  4FM9 A;  2A68 A;  4G7H A;  2P8T A;  5TMF A;  3GTJ A;  1WQF A;  4C3J K;  4XLP A;  5FLM C;  1XXB A;  1WOO A;  5FJ8 K;  2GAH C;  4A3E C;  3T02 A;  3GTP A;  3HOZ C;  5IOQ A;  3BP8 C;  1TWG K;  4KAR A;  3BP3 A;  1SFO A;  2JA5 K;  1O26 A; 
#chains in the Genus database with same CATH homology
 4QIW L;  3GTL K;  5C4J C;  2PMZ D;  2A6H A;  3RZD K;  2JA7 C;  3GTG K;  1I6H C;  2Y0S D;  3K7A K;  4XSZ A;  2YU9 K;  5C44 C;  2WB1 L;  4C3H K;  1Y1V C;  1TWA K;  2CW0 A;  3HOW C;  3S14 K;  3S1N K;  4A3L C;  3GTK C;  5M3M K;  4LK1 A;  2PA8 L;  1YNN A;  4A3B K;  3GTJ K;  5IYC C;  1I3Q K;  2NVY C;  4A3J C;  1IW7 A;  4A3M K;  2PPB A;  3HOU C;  3HOV K;  3WOD A;  5IYB C;  5FLM K;  3HKZ D;  5C4X K;  1TWF K;  4OIN A;  3PO2 C;  4G7O A;  3GTO C;  1I50 K;  4A3C K;  3CQZ C;  4KN4 A;  4Y52 C;  4Y7N K;  4AYB L;  1HQM A;  4QJV B;  4YG2 A;  5IP7 C;  4A3E K;  4OIR A;  3GTP K;  2R7Z K;  3H3V L;  3M3Y K;  4QJV A;  2R93 K;  3I4N C;  3H0G C;  4Q5S A;  5D4D A;  4A3F C;  5TMC A;  2E2H C;  3HOZ K;  1SFO K;  3GTQ K;  4BBS C;  2E2J C;  4A3I C;  3S2D C;  3PO3 C;  4KN7 A;  2VUM K;  5C3E C;  2NVX C;  4BY1 C;  3HOY C;  5C4J K;  2NVT C;  2JA7 K;  3S17 C;  4XLN A;  3HOX C;  2B63 C;  1R9T C;  1I6H K;  2BE5 A;  2NVT K;  5C44 K;  4BXX C;  1Y1V K;  4BBR C;  3HOW K;  4A3L K;  5M5Y K;  3GTK K;  3I4M C;  4A93 C;  4NOI A;  5IYC K;  2NVY K;  4YFK A;  4A3J K;  4OIP A;  1Y1W C;  3GTM C;  1SMY A;  3HOU K;  4X6A C;  5IYB K;  4Q4Z A;  1XPP A;  2WAQ D;  4GZY A;  5M5X K;  3PO2 K;  1TWH C;  3GTO K;  4X6A K;  2A6E A;  3RZO C;  1K83 C;  4BY7 C;  3CQZ K;  3S16 C;  2R92 C;  3S15 C;  5IP7 K;  2PMZ L;  5M3F K;  4Y52 K;  4XSX A;  2NVQ C;  4A3D C;  1TWC C;  4YFN A;  4A3K C;  3I4N K;  3H0G K;  2Y0S L;  5IYD C;  4A3F K;  2E2H K;  3S1M C;  4OIO A;  1YNJ A;  4OIQ A;  4BBS K;  4QIW D;  2E2J K;  4A3I K;  3S2D K;  3PO3 K;  3S1Q C;  4KMU A;  3FKI C;  3S2H C;  4MEY A;  5C3E K;  2NVX K;  4BY1 K;  2WB1 D;  3HKZ L;  3HOY K;  2E2I C;  2JA6 C;  3M4O C;  3S17 K;  4A3G C;  1BDF A;  2PA8 D;  3HOX K;  2B63 K;  1R9T K;  1TWG C;  4YFX A;  5IP9 C;  4BXX K;  3S1R C;  1I6V A;  4BBR K;  4JK1 A;  2JA5 C;  4MEX A;  2JA8 C;  2O5I A;  3I4M K;  4A93 K;  5M5W K;  4C2M K;  2O5J A;  3GTM K;  1Y1W K;  3GTL C;  4AYB D;  3RZD C;  3GTG C;  4MQ9 A;  1WCM C;  1ZYR A;  3H3V D;  4LLG A;  1TWH K;  3K7A C;  2YU9 C;  3RZO K;  4BY7 K;  1K83 K;  3S14 C;  1TWA C;  1WCM K;  2R92 K;  3S15 K;  3S16 K;  3S1N C;  2NVQ K;  4A3D K;  1TWC K;  4A3K K;  4A3B C;  2A68 A;  3GTJ C;  4A3M C;  1I3Q C;  4G7H A;  5IYD K;  4C3I K;  5TMF A;  3S1M K;  3HOV C;  4C3J K;  4XLP A;  5FLM C;  3DXJ A;  1TWF C;  5C4X C;  3S1Q K;  1I50 C;  4LJZ A;  4A3C C;  3FKI K;  3S2H K;  4Y7N C;  3GTP C;  5FJ8 K;  4A3E C;  4LK0 A;  3M3Y C;  2R7Z C;  2WAQ L;  2E2I K;  2R93 C;  2JA6 K;  3M4O K;  4A3G K;  3HOZ C;  1SFO C;  3GTQ C;  1TWG K;  3EQL A;  4ZH4 A;  5IP9 K;  3S1R K;  2A69 A;  4G7Z A;  2VUM C;  2JA5 K;  2JA8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...