2NVQK

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvqK00
2E2HC 3HOVC 3S15K 3HKZD 1WCMC 4AYBD 3H0GK 3WODA 1R9TC 1I6VA 3S2HK 5C4XC 3S1RC 2NVTC 4KN7A 5C4XK 1WCMK 2A6EA 1TWGC 3S16K 3GTQK 3S1RK 2BE5A 3CQZC 3HOWK 2JA5C 3S1MC 5FLMC 3S14C 2R93C 4X6AC 1Y1VC 2A69A 3S1QC 1TWCK 1Y1WC 2JA5K 4BY7C 4G7OA 5D4DA 2NVQK 1Y1WK 1TWHC 4BY7K 4OIQA 4A3DK 4Y7NC 2NVYC 4A3JC 4C3JK 2E2JK 1TWHK 2Y0SD 3I4MC 3RZOC 4Y7NK 2NVYK 4A3JK 2O5IA 4A3LK 1ZYRA 2NVXK 2O5JA 3I4MK 4C3HK 5IYDC 3EQLA 4QJVA 3HOZK 3M4OC 4LJZA 3K7AK 4MEYA 4BBRC 5IYCC 4A3BC 4Y52K 2PMZL 3M4OK 2PA8D 5IP7C 4A3CK 2R92C 5C44K 2Y0SL 4LK1A 4BY1C 3M3YK 3PO3K 1I6HK 4OIPA 2E2HK 3FKIC 4A3IC 1R9TK 3HOVK 4LK0A 4NOIA 2NVTK 4G7ZA 4A3IK 3DXJA 1TWGK 2WB1D 3S1MK 3CQZK 4X6AK 2R93K 5FLMK 3S14K 4Q5SA 4XLPA 2PA8L 1Y1VK 2WAQD 4MQ9A 3S1QK 3HKZL 4AYBL 3S2HC 3GTOC 5C4JC 4Q4ZA 4G7HA 3GTPC 5TMCA 3I4NC 3GTPK 4C2MK 3RZOK 4OIRA 2VUMC 2YU9C 3I4NK 4LLGA 1SMYA 5IYDK 3S1NC 5FJ8K 2VUMK 2WAQL 4KMUA 1HQMA 4XLNA 3HOYC 1I3QC 4A3FC 3GTJC 2A6HA 4A3MC 5M3FK 5IYCK 4BBRK 2B63C 3GTMC 3S1NK 4A3BK 3GTKC 1I50C 3HOYK 5IP7K 2B63K 3GTMK 4QJVB 1TWFC 2R92K 3GTKK 5M5XK 4A3KC 4BY1K 4QIWD 2JA6C 3FKIK 4ZH4A 4BXXC 1XPPA 3GTLC 4A3KK 2JA6K 3HOXC 5M3MK 1IW7A 1K83C 4OIOA 4A3EC 3RZDC 2R7ZC 1K83K 1YNNA 5IYBC 1SFOC 4A3EK 2E2IC 3GTOK 5C4JK 4KN4A 3HOUC 1YNJA 4QIWL 2R7ZK 3S17C 3S2DC 5IYBK 4A93C 3H0GC 4A93K 3S17K 2WB1L 2PPBA 3S2DK 3S16C 4C3IK 2YU9K 3GTQC 3HOWC 2A68A 4YFKA 4YFXA 3H3VD 1TWCC 2JA8C 2JA7C 5IP9C 1I3QK 5M5YK 5C3EC 3GTJK 4YFNA 4A3FK 4A3MK 1BDFA 2NVQC 2JA8K 2JA7K 5IP9K 3PO3C 4A3GC 1I50K 4A3DC 5C3EK 2CW0A 1TWFK 2PMZD 2E2JC 4JK1A 1TWAC 3PO2C 4A3GK 4A3LC 4XSZA 2NVXC 4BXXK 4BBSC 3PO2K 1TWAK 5TMFA 4MEXA 3GTLK 5M5WK 3H3VL 3GTGC 3HOZC 4BBSK 3HOXK 3K7AC 4Y52C 4YG2A 3GTGK 4OINA 3RZDK 4A3CC 3S15C 4GZYA 4XSXA 5C44C 1SFOK 2E2IK 3HOUK 1I6HC 3M3YC
chains in the Genus database with same CATH superfamily
1EK8A 4GTAA 1WCMC 2NVTC 2ZUEA 5C4XK 3Q3QA 3HOWK 2BE5A 3CQZC 3S1MC 3S1QC 1TWCK 2JA5K 2GSNA 1Y1WK 1DCPA 4BY7K 1TWHK 2Y0SD 3RZOC 3ADAC 4Y7NK 2NVYK 4A3JK 4KB4A 4C3HK 5IYDC 3EQLA 3CAGA 3HOZK 3M4OC 1XZQB 1O2AA 4MEYA 4A3BC 4Y52K 2KWAA 2R92C 2E2HK 3HOVK 1XXBA 3FKIC 4A3IC 1R9TK 1TWFA 2GAGC 3N3YA 5FLMK 3S14K 2PA8L 1Y1VK 4MQ9A 1YX2A 1USMA 3HKZL 5C4JC 4Q4ZA 4G7HA 3G4AA 2XCOA 3I4NC 4GTLA 3GTPK 3FHZA 4LLGA 4J3NA 3N0CA 3BP3A 2VUMK 4XLNA 3S1NK 2B63C 5IOSA 4KB2A 3GEEA 3SZZA 4GTDA 3GTMK 3GTKK 5L46A 4QIWD 2Y3PA 3GTLC 2GSOA 3GTLA 1K83C 1V5VA 3TFJA 2NVXA 1YNNA 3GTGA 4A3EK 1G51A 1YNJA 2R7ZK 5IYBK 1O24A 2WB1L 2PPBA 3OPFA 3HOWC 4GTBA 1B4BA 4YFKA 4BLBA 1TWCC 2JA8C 2JA7C 1EQRA 4A3MK 1TWGA 4P5BA 5IP9K 2JA5A 2R93A 1JVIA 1TWFK 1Y1WA 3GDZA 4JK1A 1TWAC 2V6UA 4DDQA 3BUEA 1JQWA 1TWHA 3GSIA 5TMFA 3PO2K 5M5WK 2NVYA 3T02A 3HOZC 3HXAA 1EH1A 2XCQA 2GAHC 2FQTA 4Y52C 3AQPA 3AQOA 3RZDK 3IPJA 3S15C 4XSXA 3AH5A 3HOUK 2E2HC 3HOVC 4AYBD 1R9TC 3S2HK 5TJ3A 3WODA 3LAJA 3S1RC 3SZYA 2FQOA 2A6EA 3S16K 1WQHA 3T00A 2P5MA 5FLMC 3S14C 2CFAA 1Y1VC 1O29A 3S0XA 4KC6A 2NVQK 3GEHA 2EBBA 4A3DK 4AH6A 1ZXOA 4C3JK 5HL8A 2E2JK 3I4MC 3FOEA 2P8TA 3A8IA 2O5JA 2NVXK 3GTPA 4KM8A 3ERED 3K7AK 3LPXA 2VUMA 2YU9A 2PMZL 1BS2A 1JOEA 5CJ9A 1YCLA 2Y0SL 1I3QA 1ZBSA 3M3YK 4OIPA 4KARA 3GTMA 3GTKA 4NOIA 1WOSA 1O2BA 1TWGK 2R93K 4XLPA 4P9SA 1GE9A 3N0BA 4KMAA 5TMCA 5IOTA 2R7ZA 1PJ6A 4FZBA 4C2MK 2E2IA 1F7VA 3H0GA 3HOYC 4A3MC 4BBRK 5IP7K 4QJVB 1TWFC 3L4KA 1WSVA 4BY1K 4ZH4A 3FOFA 1VH2A 4A3KK 1DCOA 2JA6K 1XZPA 1IW7A 1RU0A 3RZDC 4LR2A 3HOUC 2CFAB 4KN4A 3S17C 4QIWL 4PAAA 4KATA 3S2DK 3OREA 3S16C 4C3IK 2YU9K 1J6XA 2A68A 4YFXA 3H3VD 5EGEA 1I3QK 4A3FK 2NVQC 1BDFA 3L4JA 4A3GC 4A3DC 1ZQ1C 5C3EK 4C3JC 1J6VA 4ILDA 2E2JC 3TFIA 2NVXC 1IQ0A 4BXXK 3GTGC 4BBSK 3K7AC 4OINA 5D4DA 2E2IK 3M3YC 4A93K 3HKZD 5C4XC 1VJEA 3H0GK 4XCHA 1WCMK 1BGWA 1TWGC 3AD8C 3GTQK 4WJ3M 2JA5C 2R93C 4PABA 3V4GA 2V6TA 1Y1WC 4BY7C 1O27A 4LQYA 4G7OA 1TWHC 4OIQA 4Y7NC 2NVYC 4A3JC 4C3HC 3GTOA 1ZYRA 1WSRA 4QJVA 3GEIA 4KDDA 4LJZA 4BBRC 1XZPB 1PJ7A 1WOOA 3M4OK 5IOQA 5IP7C 1WOPA 2D6FC 5C44K 4LK1A 4BY1C 3PO3K 1I6HK 3G4CA 1O2FB 1I50A 1EFWA 4BLAA 4A3IK 3DXJA 2WB1D 4X6AK 2JA6A 2WAQD 3GTPC 3OEPA 2VUMC 1SFOA 4C3IC 2ZUFA 2YU9C 3I4NK 3QX3A 5JVOA 3S1NC 1WQGA 1DCHA 1I3QC 4A3FC 5M3FK 5IYCK 4KMDA 4G0UA 3GTMC 3LAPA 3GTKC 2B63K 1AB4A 1O28A 4BXXC 1XPPA 4GTFA 3NUHA 1X31C 1WIHA 4OIOA 1O25A 1EI6A 4A3EC 2R7ZC 1K83K 5IYBC 3BP8C 3AD9C 2E2IC 3GTOK 4G0WA 4GTCA 4A93C 3TTGA 2RGRA 3H0GC 1HI9A 3A8JA 3GTQC 1WCMA 4G0VA 3GTQA 5IP9C 3GTJK 2JA8K 1KQ4A 2GSUA 5CHPA 3CQZA 2JA7K 1I50K 2PMZD 1XXAA 3PO2C 1TWAK 3MMLB 4MEXA 4BKWA 4KMHA 3H3VL 3T01A 3HOXK 5E68A 3A8KA 4GZYA 5C44C 3S2HC 1SFOK 1I6HC 3PO3C 3S15K 1INNA 1I6VA 1C0AA 4KN7A 3VA7A 2R92A 3GIRA 3S1RK 4X6AC 3FKIA 1BJTA 2A69A 2V6SA 1VRQC 4O2DA 1B4AA 4A3LK 2O5IA 3I4MK 1UV7A 5IYCC 4P5AA 1F7UA 5EGHA 2PA8D 4A3CK 2B63A 1IL2A 1O26A 4LK0A 2NVTK 4G7ZA 3S1MK 3CQZK 4Q5SA 3S1QK 1VLOA 1J6WA 4KM9A 1DD5A 4AYBL 3GTOC 2ZFZA 1K83A 2JH3A 4C2MC 1IS1A 1ISEA 3RZOK 4OIRA 1SMYA 5IYDK 4WILA 4FM9A 5FJ8K 5IORA 2WAQL 4KMUA 1HQMA 3GTJC 2A6HA 4A3BK 1XXCA 1I50C 3HOYK 4RMFA 3GTJA 1USOA 1TWCA 2R92K 2JA7A 5M5XK 4A3KC 1PJ5A 1WORA 2JA6C 3FKIK 3TFHA 1XZQA 3HOXC 5M3MK 1TWAA 3JSTA 4M1XA 1J98A 1L0WA 1SFOC 5C4JK 4KASA 3S2DC 2RH6A 3S17K 4GTEA 1ZVUA 2E2HA 3AD7C 1VGXA 1R9TA 1IE0A 4GFQA 5M5YK 5C3EC 4YFNA 1IBAA 4C45A 2XCRB 2CW0A 1Y1VA 2PHCB 4A3GK 1WQFA 4A3LC 4XSZA 4LOWA 4BBSC 4KAWX 3GTLK 4WJ4A 5JFEA 1F9NA 4GT9A 4YG2A 3GTGK 4A3CC 2W7VA 1F93A
chains in the Genus database with same CATH topology
2E2HC 3HOVC 3S15K 3HKZD 1WCMC 4AYBD 3H0GK 3WODA 1R9TC 1I6VA 3S2HK 5C4XC 3S1RC 2NVTC 4KN7A 5C4XK 1WCMK 2A6EA 1TWGC 3S16K 3GTQK 3S1RK 2BE5A 3CQZC 3HOWK 2JA5C 3S1MC 5FLMC 3S14C 2R93C 4X6AC 1Y1VC 2A69A 3S1QC 1TWCK 1Y1WC 2JA5K 4BY7C 4G7OA 5D4DA 2NVQK 1Y1WK 1TWHC 4BY7K 4OIQA 4A3DK 4Y7NC 2NVYC 4A3JC 4C3JK 2E2JK 1TWHK 2Y0SD 3I4MC 3RZOC 4Y7NK 2NVYK 4A3JK 2O5IA 4A3LK 1ZYRA 2NVXK 2O5JA 3I4MK 4C3HK 5IYDC 3EQLA 4QJVA 3HOZK 3M4OC 4LJZA 3K7AK 4MEYA 4BBRC 5IYCC 4A3BC 4Y52K 2PMZL 3M4OK 2PA8D 5IP7C 4A3CK 2R92C 5C44K 2Y0SL 4LK1A 4BY1C 3M3YK 3PO3K 1I6HK 4OIPA 2E2HK 3FKIC 4A3IC 1R9TK 3HOVK 4LK0A 4NOIA 2NVTK 4G7ZA 4A3IK 3DXJA 1TWGK 2WB1D 3S1MK 3CQZK 4X6AK 2R93K 5FLMK 3S14K 4Q5SA 4XLPA 2PA8L 1Y1VK 2WAQD 4MQ9A 3S1QK 3HKZL 4AYBL 3S2HC 3GTOC 5C4JC 4Q4ZA 4G7HA 3GTPC 5TMCA 3I4NC 3GTPK 4C2MK 3RZOK 4OIRA 2VUMC 2YU9C 3I4NK 4LLGA 1SMYA 5IYDK 3S1NC 5FJ8K 2VUMK 2WAQL 4KMUA 1HQMA 4XLNA 3HOYC 1I3QC 4A3FC 3GTJC 2A6HA 4A3MC 5M3FK 5IYCK 4BBRK 2B63C 3GTMC 3S1NK 4A3BK 3GTKC 1I50C 3HOYK 5IP7K 2B63K 3GTMK 4QJVB 1TWFC 2R92K 3GTKK 5M5XK 4A3KC 4BY1K 4QIWD 2JA6C 3FKIK 4ZH4A 4BXXC 1XPPA 3GTLC 4A3KK 2JA6K 3HOXC 5M3MK 1IW7A 1K83C 4OIOA 4A3EC 3RZDC 2R7ZC 1K83K 1YNNA 5IYBC 1SFOC 4A3EK 2E2IC 3GTOK 5C4JK 4KN4A 3HOUC 1YNJA 4QIWL 2R7ZK 3S17C 3S2DC 5IYBK 4A93C 3H0GC 4A93K 3S17K 2WB1L 2PPBA 3S2DK 3S16C 4C3IK 2YU9K 3GTQC 3HOWC 2A68A 4YFKA 4YFXA 3H3VD 1TWCC 2JA8C 2JA7C 5IP9C 1I3QK 5M5YK 5C3EC 3GTJK 4YFNA 4A3FK 4A3MK 1BDFA 2NVQC 2JA8K 2JA7K 5IP9K 3PO3C 4A3GC 1I50K 4A3DC 5C3EK 2CW0A 1TWFK 2PMZD 2E2JC 4JK1A 1TWAC 3PO2C 4A3GK 4A3LC 4XSZA 2NVXC 4BXXK 4BBSC 3PO2K 1TWAK 5TMFA 4MEXA 3GTLK 5M5WK 3H3VL 3GTGC 3HOZC 4BBSK 3HOXK 3K7AC 4Y52C 4YG2A 3GTGK 4OINA 3RZDK 4A3CC 3S15C 4GZYA 4XSXA 5C44C 1SFOK 2E2IK 3HOUK 1I6HC 3M3YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H C;  3HOV C;  3S15 K;  3HKZ D;  1WCM C;  4AYB D;  3H0G K;  3WOD A;  1R9T C;  1I6V A;  3S2H K;  5C4X C;  3S1R C;  2NVT C;  4KN7 A;  5C4X K;  1WCM K;  2A6E A;  1TWG C;  3S16 K;  3GTQ K;  3S1R K;  2BE5 A;  3CQZ C;  3HOW K;  2JA5 C;  3S1M C;  5FLM C;  3S14 C;  2R93 C;  4X6A C;  1Y1V C;  2A69 A;  3S1Q C;  1TWC K;  1Y1W C;  2JA5 K;  4BY7 C;  4G7O A;  5D4D A;  2NVQ K;  1Y1W K;  1TWH C;  4BY7 K;  4OIQ A;  4A3D K;  4Y7N C;  2NVY C;  4A3J C;  4C3J K;  2E2J K;  1TWH K;  2Y0S D;  3I4M C;  3RZO C;  4Y7N K;  2NVY K;  4A3J K;  2O5I A;  4A3L K;  1ZYR A;  2NVX K;  2O5J A;  3I4M K;  4C3H K;  5IYD C;  3EQL A;  4QJV A;  3HOZ K;  3M4O C;  4LJZ A;  3K7A K;  4MEY A;  4BBR C;  5IYC C;  4A3B C;  4Y52 K;  2PMZ L;  3M4O K;  2PA8 D;  5IP7 C;  4A3C K;  2R92 C;  5C44 K;  2Y0S L;  4LK1 A;  4BY1 C;  3M3Y K;  3PO3 K;  1I6H K;  4OIP A;  2E2H K;  3FKI C;  4A3I C;  1R9T K;  3HOV K;  4LK0 A;  4NOI A;  2NVT K;  4G7Z A;  4A3I K;  3DXJ A;  1TWG K;  2WB1 D;  3S1M K;  3CQZ K;  4X6A K;  2R93 K;  5FLM K;  3S14 K;  4Q5S A;  4XLP A;  2PA8 L;  1Y1V K;  2WAQ D;  4MQ9 A;  3S1Q K;  3HKZ L;  4AYB L;  3S2H C;  3GTO C;  5C4J C;  4Q4Z A;  4G7H A;  3GTP C;  5TMC A;  3I4N C;  3GTP K;  4C2M K;  3RZO K;  4OIR A;  2VUM C;  2YU9 C;  3I4N K;  4LLG A;  1SMY A;  5IYD K;  3S1N C;  5FJ8 K;  2VUM K;  2WAQ L;  4KMU A;  1HQM A;  4XLN A;  3HOY C;  1I3Q C;  4A3F C;  3GTJ C;  2A6H A;  4A3M C;  5M3F K;  5IYC K;  4BBR K;  2B63 C;  3GTM C;  3S1N K;  4A3B K;  3GTK C;  1I50 C;  3HOY K;  5IP7 K;  2B63 K;  3GTM K;  4QJV B;  1TWF C;  2R92 K;  3GTK K;  5M5X K;  4A3K C;  4BY1 K;  4QIW D;  2JA6 C;  3FKI K;  4ZH4 A;  4BXX C;  1XPP A;  3GTL C;  4A3K K;  2JA6 K;  3HOX C;  5M3M K;  1IW7 A;  1K83 C;  4OIO A;  4A3E C;  3RZD C;  2R7Z C;  1K83 K;  1YNN A;  5IYB C;  1SFO C;  4A3E K;  2E2I C;  3GTO K;  5C4J K;  4KN4 A;  3HOU C;  1YNJ A;  4QIW L;  2R7Z K;  3S17 C;  3S2D C;  5IYB K;  4A93 C;  3H0G C;  4A93 K;  3S17 K;  2WB1 L;  2PPB A;  3S2D K;  3S16 C;  4C3I K;  2YU9 K;  3GTQ C;  3HOW C;  2A68 A;  4YFK A;  4YFX A;  3H3V D;  1TWC C;  2JA8 C;  2JA7 C;  5IP9 C;  1I3Q K;  5M5Y K;  5C3E C;  3GTJ K;  4YFN A;  4A3F K;  4A3M K;  1BDF A;  2NVQ C;  2JA8 K;  2JA7 K;  5IP9 K;  3PO3 C;  4A3G C;  1I50 K;  4A3D C;  5C3E K;  2CW0 A;  1TWF K;  2PMZ D;  2E2J C;  4JK1 A;  1TWA C;  3PO2 C;  4A3G K;  4A3L C;  4XSZ A;  2NVX C;  4BXX K;  4BBS C;  3PO2 K;  1TWA K;  5TMF A;  4MEX A;  3GTL K;  5M5W K;  3H3V L;  3GTG C;  3HOZ C;  4BBS K;  3HOX K;  3K7A C;  4Y52 C;  4YG2 A;  3GTG K;  4OIN A;  3RZD K;  4A3C C;  3S15 C;  4GZY A;  4XSX A;  5C44 C;  1SFO K;  2E2I K;  3HOU K;  1I6H C;  3M3Y C; 
#chains in the Genus database with same CATH topology
 1EK8 A;  4GTA A;  1WCM C;  2NVT C;  2ZUE A;  5C4X K;  3Q3Q A;  3HOW K;  2BE5 A;  3CQZ C;  3S1M C;  3S1Q C;  1TWC K;  2JA5 K;  2GSN A;  1Y1W K;  1DCP A;  4BY7 K;  1TWH K;  2Y0S D;  3RZO C;  3ADA C;  4Y7N K;  2NVY K;  4A3J K;  4KB4 A;  4C3H K;  5IYD C;  3EQL A;  3CAG A;  3HOZ K;  3M4O C;  1XZQ B;  1O2A A;  4MEY A;  4A3B C;  4Y52 K;  2KWA A;  2R92 C;  2E2H K;  3HOV K;  1XXB A;  3FKI C;  4A3I C;  1R9T K;  1TWF A;  2GAG C;  3N3Y A;  5FLM K;  3S14 K;  2PA8 L;  1Y1V K;  4MQ9 A;  1YX2 A;  1USM A;  3HKZ L;  5C4J C;  4Q4Z A;  4G7H A;  3G4A A;  2XCO A;  3I4N C;  4GTL A;  3GTP K;  3FHZ A;  4LLG A;  4J3N A;  3N0C A;  3BP3 A;  2VUM K;  4XLN A;  3S1N K;  2B63 C;  5IOS A;  4KB2 A;  3GEE A;  3SZZ A;  4GTD A;  3GTM K;  3GTK K;  5L46 A;  4QIW D;  2Y3P A;  3GTL C;  2GSO A;  3GTL A;  1K83 C;  1V5V A;  3TFJ A;  2NVX A;  1YNN A;  3GTG A;  4A3E K;  1G51 A;  1YNJ A;  2R7Z K;  5IYB K;  1O24 A;  2WB1 L;  2PPB A;  3OPF A;  3HOW C;  4GTB A;  1B4B A;  4YFK A;  4BLB A;  1TWC C;  2JA8 C;  2JA7 C;  1EQR A;  4A3M K;  1TWG A;  4P5B A;  5IP9 K;  2JA5 A;  2R93 A;  1JVI A;  1TWF K;  1Y1W A;  3GDZ A;  4JK1 A;  1TWA C;  2V6U A;  4DDQ A;  3BUE A;  1JQW A;  1TWH A;  3GSI A;  5TMF A;  3PO2 K;  5M5W K;  2NVY A;  3T02 A;  3HOZ C;  3HXA A;  1EH1 A;  2XCQ A;  2GAH C;  2FQT A;  4Y52 C;  3AQP A;  3AQO A;  3RZD K;  3IPJ A;  3S15 C;  4XSX A;  3AH5 A;  3HOU K;  2E2H C;  3HOV C;  4AYB D;  1R9T C;  3S2H K;  5TJ3 A;  3WOD A;  3LAJ A;  3S1R C;  3SZY A;  2FQO A;  2A6E A;  3S16 K;  1WQH A;  3T00 A;  2P5M A;  5FLM C;  3S14 C;  2CFA A;  1Y1V C;  1O29 A;  3S0X A;  4KC6 A;  2NVQ K;  3GEH A;  2EBB A;  4A3D K;  4AH6 A;  1ZXO A;  4C3J K;  5HL8 A;  2E2J K;  3I4M C;  3FOE A;  2P8T A;  3A8I A;  2O5J A;  2NVX K;  3GTP A;  4KM8 A;  3ERE D;  3K7A K;  3LPX A;  2VUM A;  2YU9 A;  2PMZ L;  1BS2 A;  1JOE A;  5CJ9 A;  1YCL A;  2Y0S L;  1I3Q A;  1ZBS A;  3M3Y K;  4OIP A;  4KAR A;  3GTM A;  3GTK A;  4NOI A;  1WOS A;  1O2B A;  1TWG K;  2R93 K;  4XLP A;  4P9S A;  1GE9 A;  3N0B A;  4KMA A;  5TMC A;  5IOT A;  2R7Z A;  1PJ6 A;  4FZB A;  4C2M K;  2E2I A;  1F7V A;  3H0G A;  3HOY C;  4A3M C;  4BBR K;  5IP7 K;  4QJV B;  1TWF C;  3L4K A;  1WSV A;  4BY1 K;  4ZH4 A;  3FOF A;  1VH2 A;  4A3K K;  1DCO A;  2JA6 K;  1XZP A;  1IW7 A;  1RU0 A;  3RZD C;  4LR2 A;  3HOU C;  2CFA B;  4KN4 A;  3S17 C;  4QIW L;  4PAA A;  4KAT A;  3S2D K;  3ORE A;  3S16 C;  4C3I K;  2YU9 K;  1J6X A;  2A68 A;  4YFX A;  3H3V D;  5EGE A;  1I3Q K;  4A3F K;  2NVQ C;  1BDF A;  3L4J A;  4A3G C;  4A3D C;  1ZQ1 C;  5C3E K;  4C3J C;  1J6V A;  4ILD A;  2E2J C;  3TFI A;  2NVX C;  1IQ0 A;  4BXX K;  3GTG C;  4BBS K;  3K7A C;  4OIN A;  5D4D A;  2E2I K;  3M3Y C;  4A93 K;  3HKZ D;  5C4X C;  1VJE A;  3H0G K;  4XCH A;  1WCM K;  1BGW A;  1TWG C;  3AD8 C;  3GTQ K;  4WJ3 M;  2JA5 C;  2R93 C;  4PAB A;  3V4G A;  2V6T A;  1Y1W C;  4BY7 C;  1O27 A;  4LQY A;  4G7O A;  1TWH C;  4OIQ A;  4Y7N C;  2NVY C;  4A3J C;  4C3H C;  3GTO A;  1ZYR A;  1WSR A;  4QJV A;  3GEI A;  4KDD A;  4LJZ A;  4BBR C;  1XZP B;  1PJ7 A;  1WOO A;  3M4O K;  5IOQ A;  5IP7 C;  1WOP A;  2D6F C;  5C44 K;  4LK1 A;  4BY1 C;  3PO3 K;  1I6H K;  3G4C A;  1O2F B;  1I50 A;  1EFW A;  4BLA A;  4A3I K;  3DXJ A;  2WB1 D;  4X6A K;  2JA6 A;  2WAQ D;  3GTP C;  3OEP A;  2VUM C;  1SFO A;  4C3I C;  2ZUF A;  2YU9 C;  3I4N K;  3QX3 A;  5JVO A;  3S1N C;  1WQG A;  1DCH A;  1I3Q C;  4A3F C;  5M3F K;  5IYC K;  4KMD A;  4G0U A;  3GTM C;  3LAP A;  3GTK C;  2B63 K;  1AB4 A;  1O28 A;  4BXX C;  1XPP A;  4GTF A;  3NUH A;  1X31 C;  1WIH A;  4OIO A;  1O25 A;  1EI6 A;  4A3E C;  2R7Z C;  1K83 K;  5IYB C;  3BP8 C;  3AD9 C;  2E2I C;  3GTO K;  4G0W A;  4GTC A;  4A93 C;  3TTG A;  2RGR A;  3H0G C;  1HI9 A;  3A8J A;  3GTQ C;  1WCM A;  4G0V A;  3GTQ A;  5IP9 C;  3GTJ K;  2JA8 K;  1KQ4 A;  2GSU A;  5CHP A;  3CQZ A;  2JA7 K;  1I50 K;  2PMZ D;  1XXA A;  3PO2 C;  1TWA K;  3MML B;  4MEX A;  4BKW A;  4KMH A;  3H3V L;  3T01 A;  3HOX K;  5E68 A;  3A8K A;  4GZY A;  5C44 C;  3S2H C;  1SFO K;  1I6H C;  3PO3 C;  3S15 K;  1INN A;  1I6V A;  1C0A A;  4KN7 A;  3VA7 A;  2R92 A;  3GIR A;  3S1R K;  4X6A C;  3FKI A;  1BJT A;  2A69 A;  2V6S A;  1VRQ C;  4O2D A;  1B4A A;  4A3L K;  2O5I A;  3I4M K;  1UV7 A;  5IYC C;  4P5A A;  1F7U A;  5EGH A;  2PA8 D;  4A3C K;  2B63 A;  1IL2 A;  1O26 A;  4LK0 A;  2NVT K;  4G7Z A;  3S1M K;  3CQZ K;  4Q5S A;  3S1Q K;  1VLO A;  1J6W A;  4KM9 A;  1DD5 A;  4AYB L;  3GTO C;  2ZFZ A;  1K83 A;  2JH3 A;  4C2M C;  1IS1 A;  1ISE A;  3RZO K;  4OIR A;  1SMY A;  5IYD K;  4WIL A;  4FM9 A;  5FJ8 K;  5IOR A;  2WAQ L;  4KMU A;  1HQM A;  3GTJ C;  2A6H A;  4A3B K;  1XXC A;  1I50 C;  3HOY K;  4RMF A;  3GTJ A;  1USO A;  1TWC A;  2R92 K;  2JA7 A;  5M5X K;  4A3K C;  1PJ5 A;  1WOR A;  2JA6 C;  3FKI K;  3TFH A;  1XZQ A;  3HOX C;  5M3M K;  1TWA A;  3JST A;  4M1X A;  1J98 A;  1L0W A;  1SFO C;  5C4J K;  4KAS A;  3S2D C;  2RH6 A;  3S17 K;  4GTE A;  1ZVU A;  2E2H A;  3AD7 C;  1VGX A;  1R9T A;  1IE0 A;  4GFQ A;  5M5Y K;  5C3E C;  4YFN A;  1IBA A;  4C45 A;  2XCR B;  2CW0 A;  1Y1V A;  2PHC B;  4A3G K;  1WQF A;  4A3L C;  4XSZ A;  4LOW A;  4BBS C;  4KAW X;  3GTL K;  4WJ4 A;  5JFE A;  1F9N A;  4GT9 A;  4YG2 A;  3GTG K;  4A3C C;  2W7V A;  1F93 A; 
#chains in the Genus database with same CATH homology
 2E2H C;  3HOV C;  3S15 K;  3HKZ D;  1WCM C;  4AYB D;  3H0G K;  3WOD A;  1R9T C;  1I6V A;  3S2H K;  5C4X C;  3S1R C;  2NVT C;  4KN7 A;  5C4X K;  1WCM K;  2A6E A;  1TWG C;  3S16 K;  3GTQ K;  3S1R K;  2BE5 A;  3CQZ C;  3HOW K;  2JA5 C;  3S1M C;  5FLM C;  3S14 C;  2R93 C;  4X6A C;  1Y1V C;  2A69 A;  3S1Q C;  1TWC K;  1Y1W C;  2JA5 K;  4BY7 C;  4G7O A;  5D4D A;  2NVQ K;  1Y1W K;  1TWH C;  4BY7 K;  4OIQ A;  4A3D K;  4Y7N C;  2NVY C;  4A3J C;  4C3J K;  2E2J K;  1TWH K;  2Y0S D;  3I4M C;  3RZO C;  4Y7N K;  2NVY K;  4A3J K;  2O5I A;  4A3L K;  1ZYR A;  2NVX K;  2O5J A;  3I4M K;  4C3H K;  5IYD C;  3EQL A;  4QJV A;  3HOZ K;  3M4O C;  4LJZ A;  3K7A K;  4MEY A;  4BBR C;  5IYC C;  4A3B C;  4Y52 K;  2PMZ L;  3M4O K;  2PA8 D;  5IP7 C;  4A3C K;  2R92 C;  5C44 K;  2Y0S L;  4LK1 A;  4BY1 C;  3M3Y K;  3PO3 K;  1I6H K;  4OIP A;  2E2H K;  3FKI C;  4A3I C;  1R9T K;  3HOV K;  4LK0 A;  4NOI A;  2NVT K;  4G7Z A;  4A3I K;  3DXJ A;  1TWG K;  2WB1 D;  3S1M K;  3CQZ K;  4X6A K;  2R93 K;  5FLM K;  3S14 K;  4Q5S A;  4XLP A;  2PA8 L;  1Y1V K;  2WAQ D;  4MQ9 A;  3S1Q K;  3HKZ L;  4AYB L;  3S2H C;  3GTO C;  5C4J C;  4Q4Z A;  4G7H A;  3GTP C;  5TMC A;  3I4N C;  3GTP K;  4C2M K;  3RZO K;  4OIR A;  2VUM C;  2YU9 C;  3I4N K;  4LLG A;  1SMY A;  5IYD K;  3S1N C;  5FJ8 K;  2VUM K;  2WAQ L;  4KMU A;  1HQM A;  4XLN A;  3HOY C;  1I3Q C;  4A3F C;  3GTJ C;  2A6H A;  4A3M C;  5M3F K;  5IYC K;  4BBR K;  2B63 C;  3GTM C;  3S1N K;  4A3B K;  3GTK C;  1I50 C;  3HOY K;  5IP7 K;  2B63 K;  3GTM K;  4QJV B;  1TWF C;  2R92 K;  3GTK K;  5M5X K;  4A3K C;  4BY1 K;  4QIW D;  2JA6 C;  3FKI K;  4ZH4 A;  4BXX C;  1XPP A;  3GTL C;  4A3K K;  2JA6 K;  3HOX C;  5M3M K;  1IW7 A;  1K83 C;  4OIO A;  4A3E C;  3RZD C;  2R7Z C;  1K83 K;  1YNN A;  5IYB C;  1SFO C;  4A3E K;  2E2I C;  3GTO K;  5C4J K;  4KN4 A;  3HOU C;  1YNJ A;  4QIW L;  2R7Z K;  3S17 C;  3S2D C;  5IYB K;  4A93 C;  3H0G C;  4A93 K;  3S17 K;  2WB1 L;  2PPB A;  3S2D K;  3S16 C;  4C3I K;  2YU9 K;  3GTQ C;  3HOW C;  2A68 A;  4YFK A;  4YFX A;  3H3V D;  1TWC C;  2JA8 C;  2JA7 C;  5IP9 C;  1I3Q K;  5M5Y K;  5C3E C;  3GTJ K;  4YFN A;  4A3F K;  4A3M K;  1BDF A;  2NVQ C;  2JA8 K;  2JA7 K;  5IP9 K;  3PO3 C;  4A3G C;  1I50 K;  4A3D C;  5C3E K;  2CW0 A;  1TWF K;  2PMZ D;  2E2J C;  4JK1 A;  1TWA C;  3PO2 C;  4A3G K;  4A3L C;  4XSZ A;  2NVX C;  4BXX K;  4BBS C;  3PO2 K;  1TWA K;  5TMF A;  4MEX A;  3GTL K;  5M5W K;  3H3V L;  3GTG C;  3HOZ C;  4BBS K;  3HOX K;  3K7A C;  4Y52 C;  4YG2 A;  3GTG K;  4OIN A;  3RZD K;  4A3C C;  3S15 C;  4GZY A;  4XSX A;  5C44 C;  1SFO K;  2E2I K;  3HOU K;  1I6H C;  3M3Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...