2NVTK

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvtK00
1HQMA 2BE5A 4C2MK 5M5YK 4A3GC 4YFXA 4NOIA 5C44K 4Y7NK 4A3EK 4BBSK 3GTMK 3HOYC 1I3QC 3M4OC 1Y1VK 2NVTC 2A69A 5IP9K 4AYBL 3RZOC 4KN4A 3EQLA 2WB1D 3GTGC 3S1NK 2R92K 4A3FC 4JK1A 2VUMC 1TWGC 4A3DC 5FJ8K 4A3MK 3HOUK 2YU9C 4BY1K 1ZYRA 4G7HA 3S17K 5IYCK 3S1RK 4GZYA 2B63K 2Y0SD 3FKIK 4QIWD 1YNNA 1TWHK 2A68A 2E2IK 5FLMK 4MEYA 3HOXK 3S1MC 4XLNA 2A6EA 3K7AK 5IYBC 2JA6C 2NVXK 3H3VD 3I4NK 3I4MC 3M3YK 3S2HK 2R7ZK 4BXXK 5C4XC 2JA7C 3HOWK 4A3BC 2R93K 3RZDC 4YFNA 3S16K 4A3KK 3WODA 2CW0A 2PA8L 3HOVC 2NVYK 4BBRC 5C3EC 2JA5C 3I4MK 3HOZC 5M3FK 4BY7C 1XPPA 3HKZD 3S15C 4A3GK 1K83C 1SFOC 3S2DC 4XSZA 3HOYK 1I3QK 2JA5K 3M4OK 2NVTK 2NVQC 1WCMC 2E2HC 3PO3C 3H0GC 4KN7A 2PMZL 3GTGK 3RZOK 4A3LC 4X6AC 4A3IC 2WAQL 4A3CC 3GTLC 4OIOA 4A3FK 4G7ZA 3S1QC 2VUMK 1TWGK 4A3DK 1TWAK 3GTKC 1TWCC 3CQZC 2YU9K 4Y52C 5IYDC 4A93C 1Y1WC 1R9TC 4LK1A 2JA8C 5IP7C 4Q5SA 4LLGA 3DXJA 4A3JC 1TWFC 1SMYA 5TMCA 2WB1L 3S1MK 4A3BK 5IYBK 2JA6K 3GTQC 5C4XK 5TMFA 2JA7K 2PPBA 1YNJA 4QJVB 3RZDK 4AYBD 3GTOC 2O5IA 5C4JC 4BY7K 3GTPC 1I50C 4LJZA 4BBRK 5C3EK 3HOVK 4MQ9A 4C3HK 2Y0SL 3GTJC 3HOZK 4QIWL 4YFKA 4KMUA 3S14C 3S15K 3PO3K 1I6HC 1TWAC 1K83K 1SFOK 3S2DK 4G7OA 4YG2A 2O5JA 4XSXA 1BDFA 2NVQK 1WCMK 4ZH4A 1IW7A 4Y7NC 3H0GK 4C3JK 5C44C 4A3EC 2E2HK 3GTMC 3H3VL 4LK0A 4A3LK 4A3IK 1Y1VC 4A3CK 3GTLK 4X6AK 5IP9C 4OIRA 5D4DA 3S1QK 3PO2C 3S1NC 3GTKK 1TWCK 3CQZK 2R92C 4BBSC 4Y52K 3HKZL 4Q4ZA 4A93K 5IYDK 4A3MC 1Y1WK 3HOUC 4BY1C 3PO2K 1R9TK 2JA8K 2PA8D 5IP7K 5M3MK 5IYCC 3S1RC 4OINA 3S17C 2B63C 4MEXA 3FKIC 5M5XK 1TWFK 4A3JK 2E2JC 1TWHC 2E2IC 5FLMC 3GTQK 1I6VA 3HOXC 5M5WK 4OIQA 2E2JK 3GTOK 3K7AC 3M3YC 2NVXC 3S2HC 2PMZD 2A6HA 3I4NC 2R7ZC 4BXXC 4QJVA 5C4JK 2WAQD 3GTPK 1I50K 3HOWC 4XLPA 2R93C 3GTJK 4C3IK 3S16C 4A3KC 1I6HK 3S14K 4OIPA 2NVYC
chains in the Genus database with same CATH superfamily
1JQWA 1XXBA 4KDDA 3HXAA 4YFXA 1C0AA 3GTMK 4WILA 1I3QC 3HOYC 2NVTC 3GTGC 4LQYA 2R92K 5IOSA 2Y3PA 4KB2A 1GE9A 3S1RK 4GZYA 4GTBA 2E2IA 3FKIK 1YNNA 1TWHK 4FZBA 1O25A 1UV7A 5FLMK 2GAHC 3HOXK 1X31C 2ZUEA 4XLNA 3M3YK 3S2HK 2P5MA 1WSRA 1ZBSA 1O24A 2NVYA 3N3YA 4KATA 2PA8L 3OEPA 3I4MK 4WJ4A 4A3GK 3AD8C 1K83C 3ADAC 4KN7A 4A3LC 5JVOA 1IBAA 4RMFA 3S1QC 2VUMK 1TWGK 4P9SA 3GTKC 2YU9K 1B4AA 2V6UA 2JA8C 2JA6A 1PJ5A 3S1MK 3T00A 2JA7K 4QJVB 3RZDK 3BUEA 2CFAA 4ILDA 4MQ9A 2Y0SL 1SFOA 5L46A 1I6HC 3S14C 1TWAC 4YG2A 1IQ0A 1WQGA 2NVQK 4ZH4A 2E2HK 4BBSC 4LK0A 4A3IK 4P5BA 3GTLK 4OIRA 3A8JA 1VLOA 1USOA 3CQZK 1Y1WA 2FQOA 4Q4ZA 3AQOA 4A3MC 3HOUC 5IYDK 2ZFZA 1O29A 2GSOA 5M3MK 2RH6A 1J98A 2E2JC 1TWFK 3TFIA 5CHPA 3GTQK 1WOPA 2EBBA 3TFHA 4G0UA 1B4BA 2GSNA 5M5WK 1BS2A 4OIQA 2NVXC 2R7ZC 3GTPK 3GTJK 4C3IK 3S16C 4A3KC 4KM9A 4GTCA 2RGRA 4C2MK 3N0BA 5M5YK 1EH1A 1Y1VA 3LAJA 5CJ9A 5IOTA 3M4OC 2A69A 5IP9K 2XCQA 3LAPA 3S1NK 3JSTA 4BLAA 3SZZA 4A3DC 3G4AA 4G0VA 2B63A 1IE0A 1ZYRA 4G7HA 3S17K 4LOWA 4QIWD 2E2IK 3BP3A 5IOQA 1WIHA 3K7AK 5EGHA 5IYBC 4A3BC 2R93A 4KM8A 1EK8A 5EGEA 2CW0A 1RU0A 2NVYK 4BBRC 3HOVC 5M3FK 4BKWA 1O26A 3A8IA 1I3QA 3S2DC 4XSZA 1DCPA 3GTGA 1O27A 1PJ6A 1WCMC 3RZOK 3H0GC 2GAGC 2JH3A 4A3FK 4M1XA 1TWCC 3N0CA 5IORA 1R9TC 4Q5SA 4LLGA 4A3JC 1SMYA 4P5AA 2JA6K 5C4XK 1F7VA 5TMFA 1YNJA 3GTOC 3LPXA 4AYBD 4O2DA 4BY7K 1I50C 1IS1A 4LJZA 5C3EK 4C3HK 3HOZK 1K83A 4YFKA 3S15K 1XXAA 1SFOK 1J6WA 4C45A 2O5JA 4GTAA 4GTEA 1IW7A 3FHZA 4C3JK 3PO3K 3GTMC 4X6AK 4A3CK 3GTKA 5D4DA 3PO2C 3AQPA 2R92C 1ZQ1C 4Y52K 3S0XA 4A93K 1Y1WK 5IP7K 4PABA 3S1RC 3FKIC 5M5XK 1TWHC 4AH6A 5FLMC 3HOXC 1XZQB 2E2JK 3M3YC 3GIRA 3S2HC 2PMZD 2A6HA 5C4JK 2WAQD 4XLPA 1TWAA 1HQMA 2BE5A 2KWAA 4A3GC 3AD9C 4NOIA 5C44K 4Y7NK 4A3EK 1WSVA 1Y1VK 3OREA 3QX3A 4KN4A 2WB1D 3CAGA 1XZPB 1G51A 2VUMC 1ZVUA 1TWGC 2P8TA 5FJ8K 2YU9C 4BY1K 2GSUA 5IYCK 1WORA 2B63K 4GTLA 2A68A 3GEHA 3L4KA 1F93A 4G0WA 2NVXA 3S1MC 2R7ZA 2A6EA 5JFEA 3H3VD 3I4NK 1DCHA 4BXXK 4KMAA 2JA7C 3HOWK 2CFAB 1USMA 2R93K 3RZDC 3WODA 1EFWA 2XCOA 2JA5C 1BGWA 1IL2A 1XPPA 3HKZD 2JA5A 3HOYK 1I3QK 2V6TA 2NVTK 3FOFA 2NVQC 2E2HC 3GTGK 5TJ3A 4A3IC 3GTLC 3AD7C 4G7ZA 1HI9A 2ZUFA 3CQZC 3FOEA 4XCHA 4KC6A 5IYDC 3T01A 3DXJA 4GTFA 1TWFC 3AH5A 3GTQC 4KMDA 3G4CA 2O5IA 1YCLA 3GTPC 3GTJC 4C3IC 4QIWL 1K83K 4C2MC 1VH2A 4G7OA 1WCMA 4XSXA 3H0GA 4A3LK 5IP9C 1TWCA 3S1QK 1ISEA 1WQHA 3S1NC 3GTKK 3L4JA 3SZYA 2FQTA 1O2FB 1R9TA 3PO2K 1XXCA 5HL8A 2W7VA 2JA8K 2PA8D 3S17C 4OINA 4MEXA 2E2IC 3GTOA 3K7AC 1I50A 1L0WA 1VRQC 4QJVA 1YX2A 3VA7A 3ERED 1I6HK 3S14K 1INNA 2NVYC 3IPJA 1DD5A 5E68A 1XZQA 1TWAK 1F7UA 3GTMA 1VGXA 1EI6A 4BBSK 4KB4A 4PAAA 4AYBL 3RZOC 3EQLA 2R92A 3A8KA 4A3FC 4JK1A 4LR2A 4A3MK 3TTGA 3HOUK 3FKIA 1TWHA 2Y0SD 1XZPA 4MEYA 4KMHA 1F9NA 1WQFA 3GSIA 4GT9A 2JA6C 2NVXK 5C4XC 3I4MC 2R7ZK 1VJEA 4BLBA 4YFNA 3S16K 2PHCB 4A3KK 3GEEA 4BY7C 5C3EC 3OPFA 4C3HC 3HOZC 3S15C 1SFOC 1JOEA 2D6FC 3NUHA 2JA5K 3M4OK 4KASA 3PO3C 4C3JC 2PMZL 4X6AC 2WAQL 4A3CC 2VUMA 4OIOA 1TWGA 2YU9A 4A3DK 4KARA 1O2BA 2V6SA 4Y52C 4GFQA 1KQ4A 4A93C 1WOSA 1Y1WC 1V5VA 4LK1A 5IP7C 2XCRB 3GDZA 5TMCA 2WB1L 4A3BK 5IYBK 2JA7A 3MMLB 2PPBA 4GTDA 1DCOA 5C4JC 3HOVK 4BBRK 1ZXOA 3T02A 4KMUA 3S2DK 1O2AA 4KAWX 3V4GA 2E2HA 1BDFA 1WCMK 3GEIA 5C44C 1J6XA 3H0GK 4Y7NC 4A3EC 3H3VL 3GTLA 4WJ3M 1Y1VC 1JVIA 3Q3QA 3CQZA 3TFJA 1PJ7A 1TWCK 4J3NA 3HKZL 4BY1C 1R9TK 1BJTA 5IYCC 1TWFA 2B63C 4A3JK 3BP8C 3GTQA 1O28A 1I6VA 1J6VA 1EQRA 3GTOK 3I4NC 4DDQA 3GTPA 4BXXC 3GTJA 3HOWC 4FM9A 1I50K 2R93C 1WOOA 4OIPA 1AB4A
chains in the Genus database with same CATH topology
1HQMA 2BE5A 4C2MK 5M5YK 4A3GC 4YFXA 4NOIA 5C44K 4Y7NK 4A3EK 4BBSK 3GTMK 3HOYC 1I3QC 3M4OC 1Y1VK 2NVTC 2A69A 5IP9K 4AYBL 3RZOC 4KN4A 3EQLA 2WB1D 3GTGC 3S1NK 2R92K 4A3FC 4JK1A 2VUMC 1TWGC 4A3DC 5FJ8K 4A3MK 3HOUK 2YU9C 4BY1K 1ZYRA 4G7HA 3S17K 5IYCK 3S1RK 4GZYA 2B63K 2Y0SD 3FKIK 4QIWD 1YNNA 1TWHK 2A68A 2E2IK 5FLMK 4MEYA 3HOXK 3S1MC 4XLNA 2A6EA 3K7AK 5IYBC 2JA6C 2NVXK 3H3VD 3I4NK 3I4MC 3M3YK 3S2HK 2R7ZK 4BXXK 5C4XC 2JA7C 3HOWK 4A3BC 2R93K 3RZDC 4YFNA 3S16K 4A3KK 3WODA 2CW0A 2PA8L 3HOVC 2NVYK 4BBRC 5C3EC 2JA5C 3I4MK 3HOZC 5M3FK 4BY7C 1XPPA 3HKZD 3S15C 4A3GK 1K83C 1SFOC 3S2DC 4XSZA 3HOYK 1I3QK 2JA5K 3M4OK 2NVTK 2NVQC 1WCMC 2E2HC 3PO3C 3H0GC 4KN7A 2PMZL 3GTGK 3RZOK 4A3LC 4X6AC 4A3IC 2WAQL 4A3CC 3GTLC 4OIOA 4A3FK 4G7ZA 3S1QC 2VUMK 1TWGK 4A3DK 1TWAK 3GTKC 1TWCC 3CQZC 2YU9K 4Y52C 5IYDC 4A93C 1Y1WC 1R9TC 4LK1A 2JA8C 5IP7C 4Q5SA 4LLGA 3DXJA 4A3JC 1TWFC 1SMYA 5TMCA 2WB1L 3S1MK 4A3BK 5IYBK 2JA6K 3GTQC 5C4XK 5TMFA 2JA7K 2PPBA 1YNJA 4QJVB 3RZDK 4AYBD 3GTOC 2O5IA 5C4JC 4BY7K 3GTPC 1I50C 4LJZA 4BBRK 5C3EK 3HOVK 4MQ9A 4C3HK 2Y0SL 3GTJC 3HOZK 4QIWL 4YFKA 4KMUA 3S14C 3S15K 3PO3K 1I6HC 1TWAC 1K83K 1SFOK 3S2DK 4G7OA 4YG2A 2O5JA 4XSXA 1BDFA 2NVQK 1WCMK 4ZH4A 1IW7A 4Y7NC 3H0GK 4C3JK 5C44C 4A3EC 2E2HK 3GTMC 3H3VL 4LK0A 4A3LK 4A3IK 1Y1VC 4A3CK 3GTLK 4X6AK 5IP9C 4OIRA 5D4DA 3S1QK 3PO2C 3S1NC 3GTKK 1TWCK 3CQZK 2R92C 4BBSC 4Y52K 3HKZL 4Q4ZA 4A93K 5IYDK 4A3MC 1Y1WK 3HOUC 4BY1C 3PO2K 1R9TK 2JA8K 2PA8D 5IP7K 5M3MK 5IYCC 3S1RC 4OINA 3S17C 2B63C 4MEXA 3FKIC 5M5XK 1TWFK 4A3JK 2E2JC 1TWHC 2E2IC 5FLMC 3GTQK 1I6VA 3HOXC 5M5WK 4OIQA 2E2JK 3GTOK 3K7AC 3M3YC 2NVXC 3S2HC 2PMZD 2A6HA 3I4NC 2R7ZC 4BXXC 4QJVA 5C4JK 2WAQD 3GTPK 1I50K 3HOWC 4XLPA 2R93C 3GTJK 4C3IK 3S16C 4A3KC 1I6HK 3S14K 4OIPA 2NVYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM A;  2BE5 A;  4C2M K;  5M5Y K;  4A3G C;  4YFX A;  4NOI A;  5C44 K;  4Y7N K;  4A3E K;  4BBS K;  3GTM K;  3HOY C;  1I3Q C;  3M4O C;  1Y1V K;  2NVT C;  2A69 A;  5IP9 K;  4AYB L;  3RZO C;  4KN4 A;  3EQL A;  2WB1 D;  3GTG C;  3S1N K;  2R92 K;  4A3F C;  4JK1 A;  2VUM C;  1TWG C;  4A3D C;  5FJ8 K;  4A3M K;  3HOU K;  2YU9 C;  4BY1 K;  1ZYR A;  4G7H A;  3S17 K;  5IYC K;  3S1R K;  4GZY A;  2B63 K;  2Y0S D;  3FKI K;  4QIW D;  1YNN A;  1TWH K;  2A68 A;  2E2I K;  5FLM K;  4MEY A;  3HOX K;  3S1M C;  4XLN A;  2A6E A;  3K7A K;  5IYB C;  2JA6 C;  2NVX K;  3H3V D;  3I4N K;  3I4M C;  3M3Y K;  3S2H K;  2R7Z K;  4BXX K;  5C4X C;  2JA7 C;  3HOW K;  4A3B C;  2R93 K;  3RZD C;  4YFN A;  3S16 K;  4A3K K;  3WOD A;  2CW0 A;  2PA8 L;  3HOV C;  2NVY K;  4BBR C;  5C3E C;  2JA5 C;  3I4M K;  3HOZ C;  5M3F K;  4BY7 C;  1XPP A;  3HKZ D;  3S15 C;  4A3G K;  1K83 C;  1SFO C;  3S2D C;  4XSZ A;  3HOY K;  1I3Q K;  2JA5 K;  3M4O K;  2NVT K;  2NVQ C;  1WCM C;  2E2H C;  3PO3 C;  3H0G C;  4KN7 A;  2PMZ L;  3GTG K;  3RZO K;  4A3L C;  4X6A C;  4A3I C;  2WAQ L;  4A3C C;  3GTL C;  4OIO A;  4A3F K;  4G7Z A;  3S1Q C;  2VUM K;  1TWG K;  4A3D K;  1TWA K;  3GTK C;  1TWC C;  3CQZ C;  2YU9 K;  4Y52 C;  5IYD C;  4A93 C;  1Y1W C;  1R9T C;  4LK1 A;  2JA8 C;  5IP7 C;  4Q5S A;  4LLG A;  3DXJ A;  4A3J C;  1TWF C;  1SMY A;  5TMC A;  2WB1 L;  3S1M K;  4A3B K;  5IYB K;  2JA6 K;  3GTQ C;  5C4X K;  5TMF A;  2JA7 K;  2PPB A;  1YNJ A;  4QJV B;  3RZD K;  4AYB D;  3GTO C;  2O5I A;  5C4J C;  4BY7 K;  3GTP C;  1I50 C;  4LJZ A;  4BBR K;  5C3E K;  3HOV K;  4MQ9 A;  4C3H K;  2Y0S L;  3GTJ C;  3HOZ K;  4QIW L;  4YFK A;  4KMU A;  3S14 C;  3S15 K;  3PO3 K;  1I6H C;  1TWA C;  1K83 K;  1SFO K;  3S2D K;  4G7O A;  4YG2 A;  2O5J A;  4XSX A;  1BDF A;  2NVQ K;  1WCM K;  4ZH4 A;  1IW7 A;  4Y7N C;  3H0G K;  4C3J K;  5C44 C;  4A3E C;  2E2H K;  3GTM C;  3H3V L;  4LK0 A;  4A3L K;  4A3I K;  1Y1V C;  4A3C K;  3GTL K;  4X6A K;  5IP9 C;  4OIR A;  5D4D A;  3S1Q K;  3PO2 C;  3S1N C;  3GTK K;  1TWC K;  3CQZ K;  2R92 C;  4BBS C;  4Y52 K;  3HKZ L;  4Q4Z A;  4A93 K;  5IYD K;  4A3M C;  1Y1W K;  3HOU C;  4BY1 C;  3PO2 K;  1R9T K;  2JA8 K;  2PA8 D;  5IP7 K;  5M3M K;  5IYC C;  3S1R C;  4OIN A;  3S17 C;  2B63 C;  4MEX A;  3FKI C;  5M5X K;  1TWF K;  4A3J K;  2E2J C;  1TWH C;  2E2I C;  5FLM C;  3GTQ K;  1I6V A;  3HOX C;  5M5W K;  4OIQ A;  2E2J K;  3GTO K;  3K7A C;  3M3Y C;  2NVX C;  3S2H C;  2PMZ D;  2A6H A;  3I4N C;  2R7Z C;  4BXX C;  4QJV A;  5C4J K;  2WAQ D;  3GTP K;  1I50 K;  3HOW C;  4XLP A;  2R93 C;  3GTJ K;  4C3I K;  3S16 C;  4A3K C;  1I6H K;  3S14 K;  4OIP A;  2NVY C; 
#chains in the Genus database with same CATH topology
 1JQW A;  1XXB A;  4KDD A;  3HXA A;  4YFX A;  1C0A A;  3GTM K;  4WIL A;  1I3Q C;  3HOY C;  2NVT C;  3GTG C;  4LQY A;  2R92 K;  5IOS A;  2Y3P A;  4KB2 A;  1GE9 A;  3S1R K;  4GZY A;  4GTB A;  2E2I A;  3FKI K;  1YNN A;  1TWH K;  4FZB A;  1O25 A;  1UV7 A;  5FLM K;  2GAH C;  3HOX K;  1X31 C;  2ZUE A;  4XLN A;  3M3Y K;  3S2H K;  2P5M A;  1WSR A;  1ZBS A;  1O24 A;  2NVY A;  3N3Y A;  4KAT A;  2PA8 L;  3OEP A;  3I4M K;  4WJ4 A;  4A3G K;  3AD8 C;  1K83 C;  3ADA C;  4KN7 A;  4A3L C;  5JVO A;  1IBA A;  4RMF A;  3S1Q C;  2VUM K;  1TWG K;  4P9S A;  3GTK C;  2YU9 K;  1B4A A;  2V6U A;  2JA8 C;  2JA6 A;  1PJ5 A;  3S1M K;  3T00 A;  2JA7 K;  4QJV B;  3RZD K;  3BUE A;  2CFA A;  4ILD A;  4MQ9 A;  2Y0S L;  1SFO A;  5L46 A;  1I6H C;  3S14 C;  1TWA C;  4YG2 A;  1IQ0 A;  1WQG A;  2NVQ K;  4ZH4 A;  2E2H K;  4BBS C;  4LK0 A;  4A3I K;  4P5B A;  3GTL K;  4OIR A;  3A8J A;  1VLO A;  1USO A;  3CQZ K;  1Y1W A;  2FQO A;  4Q4Z A;  3AQO A;  4A3M C;  3HOU C;  5IYD K;  2ZFZ A;  1O29 A;  2GSO A;  5M3M K;  2RH6 A;  1J98 A;  2E2J C;  1TWF K;  3TFI A;  5CHP A;  3GTQ K;  1WOP A;  2EBB A;  3TFH A;  4G0U A;  1B4B A;  2GSN A;  5M5W K;  1BS2 A;  4OIQ A;  2NVX C;  2R7Z C;  3GTP K;  3GTJ K;  4C3I K;  3S16 C;  4A3K C;  4KM9 A;  4GTC A;  2RGR A;  4C2M K;  3N0B A;  5M5Y K;  1EH1 A;  1Y1V A;  3LAJ A;  5CJ9 A;  5IOT A;  3M4O C;  2A69 A;  5IP9 K;  2XCQ A;  3LAP A;  3S1N K;  3JST A;  4BLA A;  3SZZ A;  4A3D C;  3G4A A;  4G0V A;  2B63 A;  1IE0 A;  1ZYR A;  4G7H A;  3S17 K;  4LOW A;  4QIW D;  2E2I K;  3BP3 A;  5IOQ A;  1WIH A;  3K7A K;  5EGH A;  5IYB C;  4A3B C;  2R93 A;  4KM8 A;  1EK8 A;  5EGE A;  2CW0 A;  1RU0 A;  2NVY K;  4BBR C;  3HOV C;  5M3F K;  4BKW A;  1O26 A;  3A8I A;  1I3Q A;  3S2D C;  4XSZ A;  1DCP A;  3GTG A;  1O27 A;  1PJ6 A;  1WCM C;  3RZO K;  3H0G C;  2GAG C;  2JH3 A;  4A3F K;  4M1X A;  1TWC C;  3N0C A;  5IOR A;  1R9T C;  4Q5S A;  4LLG A;  4A3J C;  1SMY A;  4P5A A;  2JA6 K;  5C4X K;  1F7V A;  5TMF A;  1YNJ A;  3GTO C;  3LPX A;  4AYB D;  4O2D A;  4BY7 K;  1I50 C;  1IS1 A;  4LJZ A;  5C3E K;  4C3H K;  3HOZ K;  1K83 A;  4YFK A;  3S15 K;  1XXA A;  1SFO K;  1J6W A;  4C45 A;  2O5J A;  4GTA A;  4GTE A;  1IW7 A;  3FHZ A;  4C3J K;  3PO3 K;  3GTM C;  4X6A K;  4A3C K;  3GTK A;  5D4D A;  3PO2 C;  3AQP A;  2R92 C;  1ZQ1 C;  4Y52 K;  3S0X A;  4A93 K;  1Y1W K;  5IP7 K;  4PAB A;  3S1R C;  3FKI C;  5M5X K;  1TWH C;  4AH6 A;  5FLM C;  3HOX C;  1XZQ B;  2E2J K;  3M3Y C;  3GIR A;  3S2H C;  2PMZ D;  2A6H A;  5C4J K;  2WAQ D;  4XLP A;  1TWA A;  1HQM A;  2BE5 A;  2KWA A;  4A3G C;  3AD9 C;  4NOI A;  5C44 K;  4Y7N K;  4A3E K;  1WSV A;  1Y1V K;  3ORE A;  3QX3 A;  4KN4 A;  2WB1 D;  3CAG A;  1XZP B;  1G51 A;  2VUM C;  1ZVU A;  1TWG C;  2P8T A;  5FJ8 K;  2YU9 C;  4BY1 K;  2GSU A;  5IYC K;  1WOR A;  2B63 K;  4GTL A;  2A68 A;  3GEH A;  3L4K A;  1F93 A;  4G0W A;  2NVX A;  3S1M C;  2R7Z A;  2A6E A;  5JFE A;  3H3V D;  3I4N K;  1DCH A;  4BXX K;  4KMA A;  2JA7 C;  3HOW K;  2CFA B;  1USM A;  2R93 K;  3RZD C;  3WOD A;  1EFW A;  2XCO A;  2JA5 C;  1BGW A;  1IL2 A;  1XPP A;  3HKZ D;  2JA5 A;  3HOY K;  1I3Q K;  2V6T A;  2NVT K;  3FOF A;  2NVQ C;  2E2H C;  3GTG K;  5TJ3 A;  4A3I C;  3GTL C;  3AD7 C;  4G7Z A;  1HI9 A;  2ZUF A;  3CQZ C;  3FOE A;  4XCH A;  4KC6 A;  5IYD C;  3T01 A;  3DXJ A;  4GTF A;  1TWF C;  3AH5 A;  3GTQ C;  4KMD A;  3G4C A;  2O5I A;  1YCL A;  3GTP C;  3GTJ C;  4C3I C;  4QIW L;  1K83 K;  4C2M C;  1VH2 A;  4G7O A;  1WCM A;  4XSX A;  3H0G A;  4A3L K;  5IP9 C;  1TWC A;  3S1Q K;  1ISE A;  1WQH A;  3S1N C;  3GTK K;  3L4J A;  3SZY A;  2FQT A;  1O2F B;  1R9T A;  3PO2 K;  1XXC A;  5HL8 A;  2W7V A;  2JA8 K;  2PA8 D;  3S17 C;  4OIN A;  4MEX A;  2E2I C;  3GTO A;  3K7A C;  1I50 A;  1L0W A;  1VRQ C;  4QJV A;  1YX2 A;  3VA7 A;  3ERE D;  1I6H K;  3S14 K;  1INN A;  2NVY C;  3IPJ A;  1DD5 A;  5E68 A;  1XZQ A;  1TWA K;  1F7U A;  3GTM A;  1VGX A;  1EI6 A;  4BBS K;  4KB4 A;  4PAA A;  4AYB L;  3RZO C;  3EQL A;  2R92 A;  3A8K A;  4A3F C;  4JK1 A;  4LR2 A;  4A3M K;  3TTG A;  3HOU K;  3FKI A;  1TWH A;  2Y0S D;  1XZP A;  4MEY A;  4KMH A;  1F9N A;  1WQF A;  3GSI A;  4GT9 A;  2JA6 C;  2NVX K;  5C4X C;  3I4M C;  2R7Z K;  1VJE A;  4BLB A;  4YFN A;  3S16 K;  2PHC B;  4A3K K;  3GEE A;  4BY7 C;  5C3E C;  3OPF A;  4C3H C;  3HOZ C;  3S15 C;  1SFO C;  1JOE A;  2D6F C;  3NUH A;  2JA5 K;  3M4O K;  4KAS A;  3PO3 C;  4C3J C;  2PMZ L;  4X6A C;  2WAQ L;  4A3C C;  2VUM A;  4OIO A;  1TWG A;  2YU9 A;  4A3D K;  4KAR A;  1O2B A;  2V6S A;  4Y52 C;  4GFQ A;  1KQ4 A;  4A93 C;  1WOS A;  1Y1W C;  1V5V A;  4LK1 A;  5IP7 C;  2XCR B;  3GDZ A;  5TMC A;  2WB1 L;  4A3B K;  5IYB K;  2JA7 A;  3MML B;  2PPB A;  4GTD A;  1DCO A;  5C4J C;  3HOV K;  4BBR K;  1ZXO A;  3T02 A;  4KMU A;  3S2D K;  1O2A A;  4KAW X;  3V4G A;  2E2H A;  1BDF A;  1WCM K;  3GEI A;  5C44 C;  1J6X A;  3H0G K;  4Y7N C;  4A3E C;  3H3V L;  3GTL A;  4WJ3 M;  1Y1V C;  1JVI A;  3Q3Q A;  3CQZ A;  3TFJ A;  1PJ7 A;  1TWC K;  4J3N A;  3HKZ L;  4BY1 C;  1R9T K;  1BJT A;  5IYC C;  1TWF A;  2B63 C;  4A3J K;  3BP8 C;  3GTQ A;  1O28 A;  1I6V A;  1J6V A;  1EQR A;  3GTO K;  3I4N C;  4DDQ A;  3GTP A;  4BXX C;  3GTJ A;  3HOW C;  4FM9 A;  1I50 K;  2R93 C;  1WOO A;  4OIP A;  1AB4 A; 
#chains in the Genus database with same CATH homology
 1HQM A;  2BE5 A;  4C2M K;  5M5Y K;  4A3G C;  4YFX A;  4NOI A;  5C44 K;  4Y7N K;  4A3E K;  4BBS K;  3GTM K;  3HOY C;  1I3Q C;  3M4O C;  1Y1V K;  2NVT C;  2A69 A;  5IP9 K;  4AYB L;  3RZO C;  4KN4 A;  3EQL A;  2WB1 D;  3GTG C;  3S1N K;  2R92 K;  4A3F C;  4JK1 A;  2VUM C;  1TWG C;  4A3D C;  5FJ8 K;  4A3M K;  3HOU K;  2YU9 C;  4BY1 K;  1ZYR A;  4G7H A;  3S17 K;  5IYC K;  3S1R K;  4GZY A;  2B63 K;  2Y0S D;  3FKI K;  4QIW D;  1YNN A;  1TWH K;  2A68 A;  2E2I K;  5FLM K;  4MEY A;  3HOX K;  3S1M C;  4XLN A;  2A6E A;  3K7A K;  5IYB C;  2JA6 C;  2NVX K;  3H3V D;  3I4N K;  3I4M C;  3M3Y K;  3S2H K;  2R7Z K;  4BXX K;  5C4X C;  2JA7 C;  3HOW K;  4A3B C;  2R93 K;  3RZD C;  4YFN A;  3S16 K;  4A3K K;  3WOD A;  2CW0 A;  2PA8 L;  3HOV C;  2NVY K;  4BBR C;  5C3E C;  2JA5 C;  3I4M K;  3HOZ C;  5M3F K;  4BY7 C;  1XPP A;  3HKZ D;  3S15 C;  4A3G K;  1K83 C;  1SFO C;  3S2D C;  4XSZ A;  3HOY K;  1I3Q K;  2JA5 K;  3M4O K;  2NVT K;  2NVQ C;  1WCM C;  2E2H C;  3PO3 C;  3H0G C;  4KN7 A;  2PMZ L;  3GTG K;  3RZO K;  4A3L C;  4X6A C;  4A3I C;  2WAQ L;  4A3C C;  3GTL C;  4OIO A;  4A3F K;  4G7Z A;  3S1Q C;  2VUM K;  1TWG K;  4A3D K;  1TWA K;  3GTK C;  1TWC C;  3CQZ C;  2YU9 K;  4Y52 C;  5IYD C;  4A93 C;  1Y1W C;  1R9T C;  4LK1 A;  2JA8 C;  5IP7 C;  4Q5S A;  4LLG A;  3DXJ A;  4A3J C;  1TWF C;  1SMY A;  5TMC A;  2WB1 L;  3S1M K;  4A3B K;  5IYB K;  2JA6 K;  3GTQ C;  5C4X K;  5TMF A;  2JA7 K;  2PPB A;  1YNJ A;  4QJV B;  3RZD K;  4AYB D;  3GTO C;  2O5I A;  5C4J C;  4BY7 K;  3GTP C;  1I50 C;  4LJZ A;  4BBR K;  5C3E K;  3HOV K;  4MQ9 A;  4C3H K;  2Y0S L;  3GTJ C;  3HOZ K;  4QIW L;  4YFK A;  4KMU A;  3S14 C;  3S15 K;  3PO3 K;  1I6H C;  1TWA C;  1K83 K;  1SFO K;  3S2D K;  4G7O A;  4YG2 A;  2O5J A;  4XSX A;  1BDF A;  2NVQ K;  1WCM K;  4ZH4 A;  1IW7 A;  4Y7N C;  3H0G K;  4C3J K;  5C44 C;  4A3E C;  2E2H K;  3GTM C;  3H3V L;  4LK0 A;  4A3L K;  4A3I K;  1Y1V C;  4A3C K;  3GTL K;  4X6A K;  5IP9 C;  4OIR A;  5D4D A;  3S1Q K;  3PO2 C;  3S1N C;  3GTK K;  1TWC K;  3CQZ K;  2R92 C;  4BBS C;  4Y52 K;  3HKZ L;  4Q4Z A;  4A93 K;  5IYD K;  4A3M C;  1Y1W K;  3HOU C;  4BY1 C;  3PO2 K;  1R9T K;  2JA8 K;  2PA8 D;  5IP7 K;  5M3M K;  5IYC C;  3S1R C;  4OIN A;  3S17 C;  2B63 C;  4MEX A;  3FKI C;  5M5X K;  1TWF K;  4A3J K;  2E2J C;  1TWH C;  2E2I C;  5FLM C;  3GTQ K;  1I6V A;  3HOX C;  5M5W K;  4OIQ A;  2E2J K;  3GTO K;  3K7A C;  3M3Y C;  2NVX C;  3S2H C;  2PMZ D;  2A6H A;  3I4N C;  2R7Z C;  4BXX C;  4QJV A;  5C4J K;  2WAQ D;  3GTP K;  1I50 K;  3HOW C;  4XLP A;  2R93 C;  3GTJ K;  4C3I K;  3S16 C;  4A3K C;  1I6H K;  3S14 K;  4OIP A;  2NVY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...