2NW0A

Crystal structure of a lysin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
189
Chain Sequence
GYIVDMSKWNGSPDWDTAKGQLDLVIARVQDGSNYVDPVYKDYVAAMKARNIPFGSYAFCRFVSVEDAKVEARDFWNRGDKDSLFWVADVEVTTMSDMRAGTQAFIDELYRLGAKKVGLYVGHHKYEEFGAAQIKCDFTWIPRYGAKPAYPCDLWQYDEYGQVPGIGKCDLNRLNGDKSLDWFTGKGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.6 A Crystal Structure of the Catalytic Domain of PlyB, a Bacteriophage Lysin Active Against Bacillus anthracis.
pubmed doi rcsb
source organism Unidentified phage
molecule tags Hydrolase
molecule keywords PlyB
total genus 71
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2006-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2nw0A00
1E0XA 2DT0A 3E1F1 4M80A 1CGTA 1CECA 2WKGA 3WH6A 3M6DA 1BSIA 4NI3A 3VX1A 4AIUA 3S6TA 3FAXA 1US3A 2D22A 4W87A 1MFVA 1ZJAA 2TAAA 1JXKA 2YBUA 4HTYA 4Q22A 1B2YA 1LLOA 1KGXA 2XFYA 1HP4A 1AVAA 1E4NA 5D9PA 5IDIA 3IJ8A 2DT1A 4U3CA 2JE8A 1XYFA 4CN1A 1KGWA 4NRSA 4J3WA 2DPEA 3GNPA 4P8VA 4CUCA 4OKDA 4UOQA 3AHTA 3A3HA 1U2YA 2J25A 1UZ1A 2X2YA 1UD6A 4GI8A 1UA7A 2J47A 4D6GA 3D3AA 4MAVA 3BAXA 1CXIA 1US2A 3K8LA 1V0LA 2J62A 4PSRA 2VI0A 4GZJA 1E6ZA 1K9DA 2XVLA 4PRWA 5CQ1A 3UERA 4ATWA 4DM2A 4AZIA 4EKJA 4S3KA 2YIHA 1MXDA 1J0IA 4AZHA 5I6SA 1VEMA 2VUYA 1W9DM 2XSAA 3DYMA 1E72M 1BYDA 1VEPA 3AXHA 1GOMA 1UWTA 1G5AA 2J7DA 1NH6A 1KR0A 1JG9A 2OWCA 1GPFA 2PBOA 2HVMA 1ISVA 3MMDA 1TUXA 3UESA 1JZ3A 4BS0A 1E6XM 1E6QM 2XG9A 4GPNA 1CZ1A 3CIVA 3WDJA 4CD4A 2XUCA 1BPLB 3AMLA 3SCNA 3WF3A 4TX6A 3T2PA 1UUQA 4D72A 4PTVA 2G4FA 1PIFA 3ZSTA 2O9OA 4PMUA 1J0KA 5ABEA 3F5KA 4E8DA 4MTVA 3DC0A 1NP0A 3WUGA 3TTQA 1RD6A 5I3DA 1JNEA 3WBAA 4B9YA 4CU7A 1B0IA 1TCMA 3ZOAA 4ACZA 1W32A 5DO8A 3CUIA 4PCTA 1YQ2A 1KXHA 5A8QA 3BCDA 3SCSA 2VT0A 1CXHA 4P7RA 4AEFA 4MB5A 2OWWA 1Q6DA 2G3NA 5D9NA 3SCQA 1UR1A 3W37A 4F8XA 3WNLA 2C0HA 3VUPA 2PI6A 1X6LA 3WNPA 2VNCA 2E8YA 2YBTA 1EO5A 1E4MM 3K46A 1LWHA 1XV8A 3AJ7A 4WKFA 1W9PA 3BC9A 2D20A 4OIFA 4MADA 4PMQA 3M07A 2DH2A 2OYKA 4KWUA 5GNYA 4W8AA 1JDAA 1OCQA 1UA3A 1Q4NX 4XZBA 3O2LA 2BXZA 1JZ2A 3EYPA 1UH3A 3ZJ7A 3AOFA 3U5UA 3F5JA 4M8UA 3G6MA 1O6IA 1V3KA 3L4UA 3PTMA 5D9MA 4UCFA 3MSGA 4JCLA 3W6LA 1C8YA 2WVVA 2W62A 4MNKA 4HP5A 5EFFA 4QFUA 2XHYA 1ISXA 1JXJA 4W89A 2WMFA 3OGSA 3CUGA 2WCGA 4UOZA 3BH4A 3VX0A 4JFVA 2EJ1A 3TONA 1HKMA 5EBAA 2J7HA 4JFTA 4NZCA 4TUFA 2IXUA 5I0DA 3EMQA 2YA0A 1W9VA 1PAMA 1EGZA 3WD3A 2ZUUA 4U33A 1Q6FA 4C7DA 1KCKA 1GOOA 2WHMA 4M1RA 3RIKA 4W8BA 3W53A 2ZX9A 1ITCA 1VF8A 1B90A 4CKQA 2XIIA 3AXXA 1WZMA 2Z1KA 3OIHA 4JL1A 1W1TA 1JL8A 1K9TA 2WM0A 2YLAA 4C7GA 5AY7A 3ZQ9A 1W3LA 3NDYA 4AEEA 1RP9A 5CGTA 1UD4A 1D7FA 3VD7A 3AIEA 5FL1A 3W38A 4U3AA 3WQ8A 3AS2A 1GNXA 4AZ6A 3AQUA 1UHVA 3WH8A 2DH3A 2QHAA 1LG2A 3VIPA 1H3GA 2W66A 3QHOA 4JAWA 2W92A 4ZFMA 4UFKA 4JIEA 3WENA 3VM7A 1KWGA 1ODZA 4BCEA 4UQDA 2UY5A 4D1IA 1BGAA 1E1EA 2FGLA 1DP0A 3TA9A 5IHRA 1JZ5A 3EDKA 1TA3A 3VINA 1GORA 3UG5A 3GXFA 1J0JA 1QBBA 3THDA 4JL2A 2E9MA 3PTKA 2EPLX 4WK9A 2J7GA 1FH7A 5D8WA 2XIBA 1NOUA 4F9DA 4KGLA 3QOKA 3W24A 4PBGA 1D2KA 1J10A 1J01A 4J3XA 5BCAA 1CEOA 1UKTA 4YHGA 1J12A 4M24A 5CJ5A 3W6MA 4IM4A 3VD4A 4CU8A 2GDUA 1HJUA 1BTCA 1E3XA 3AHXA 3ZJ8A 4D6JA 3B9EA 1OINA 4LYRA 5ABFA 1GJWA 4AZBA 2CKRA 5JBDA 1UD5A 1OWQA 2ZX6A 3ECQA 3VOCA 3AMDA 1M7XA 4TXEA 3AIVA 1UR8A 1W9XA 5LA2A 3UG3A 1VJZA 1EDGA 3BAJA 4L4OA 5A6AA 4J3TA 5I5RA 4ZE4A 4TTUA 4LQ1A 1MYRA 3BLKA 4AZCA 3L2MA 1GVYA 1WDQA 1BAGA 2VVSA 2JFEX 4JHOA 1QNSA 4D6DA 4WLCA 5EFDA 1UH4A 1LF1A 2WYSA 4Z2KA 1JZ6A 2WZHA 2XGBA 1J11A 3VPLA 1JIBA 2FHFA 1NM9A 2D23A 4X0VA 2BVTA 3II1A 5A6BA 2A3EA 4UQCA 3MUIA 2DSZA 3PZGA 1CTNA 2BY0A 3UR7A 3BSGA 3WUBA 2VX7A 3WQ6A 3AMGA 1RPKA 1BFNA 3ZJKA 3SUUA 2J8FA 1XH2A 3J7HA 3CZEA 3OLGA 5LA0A 5ECUA 2VQUA 3TTYA 3A4WA 4OBRA 3M46A 3VGFA 1W9BM 2WB5A 1OB0A 1AQ0A 2UWFA 1MWOA 1DWJM 2OSYA 4D71A 1UYQA 2W63A 3AIWA 1NQ6A 4J3UA 3CHCA 4AYSA 4V2XA 3SCPA 1J0HA 3VDAA 2WBKA 3CH9A 2WCSA 2VZTA 4LX4A 1GQLA 1XD1A 5CPSA 3RJXA 3I3EA 2VL4A 3ARVA 1UKQA 1MQPA 5JBFA 2WC7A 4ZEPA 1PBGA 2BV9A 3W81A 2PWDA 1ISZA 2XVKA 3CPUA 4B16A 1KWKA 1WDSA 2Q8XA 4HZ6A 3KWXA 3PZVA 3RMEA 3OLDA 4UFMA 5IFPA 3SIMA 1QW8A 3VILA 5A2AA 1KBKA 4KH2A 1M03A 4DWSD 3AI0A 1BQCA 4BZYA 3ALGA 1JYVA 4Y7EA 4H8HA 4WSKA 2EPNA 1E6RA 4AIOA 1HKIA 1WO2A 1HIZA 2VRQA 4ZENA 2EXOA 3VIGA 1XC6A 4MNLA 1G01A 2E3ZA 2BHZA 1FOBA 2JEPA 3CBWA 1UWQA 4J27A 4W7UA 1QHOA 4J3VA 1KXTA 2ZE0A 1JZ4A 4V28A 3DYPA 3AIUA 1E3ZA 3IANA 4CD7A 3TOPA 1V6UA 3UR8A 3GXDA 1MFUA 3I3DA 3WF1A 3B9DA 4RE2A 2Y8KA 1GJUA 1E73M 4ATDA 1UKSA 4FLQA 3SUWA 3MANA 4OBSA 5BRQA 1QNOA 3IAPA 2E8ZA 4EE9A 3PBGA 4JHZA 1IV8A 2WLZA 1UWIA 1WP6A 1MVYA 1K9EA 1Q6GA 4CCEA 5DF0A 7TAAA 5DEZA 1CGYA 4TTGA 3EMZA 3M7SA 2DQXA 4ATLA 2JIEA 1C8XA 2E9LA 2D24A 3GH5A 1EH9A 4MB3A 3NIYA 3WUEA 4KRTA 2YOCA 1V3LA 3LPFA 3CHDA 3ZJ6A 3VGDA 2VRJA 2YA2A 1CBGA 2WC3A 3IJ7A 3EDFA 1L8NA 3WF2A 1UD2A 3K4AA 3SCOA 3WY1A 1CGWA 1MW0A 2WWCA 4P7OA 5E09A 2J7EA 2CIPA 3PZ9A 2YJQA 1HXJA 2XWDA 4F79A 2Y4SA 1QHZA 3GM8A 3AS0A 1WDRA 3CMJA 3GXMA 4H8VA 3CMGA 3GH4A 4FLOA 4BA0A 5IXEA 4D6FA 2YLLA 3WEOA 4P7NA 1UKPA 4GIAA 4N0RA 2WMGA 3AIRA 1G94A 1WE5A 2E4TA 1DWFM 3SCRA 2NW0A 4U2YA 2X05A 1MW1A 5AC4A 4QCFA 1JYXA 3UCQA 1VEOA 1JZ8A 1JAEA 4FLRA 3AHVA 3RO8A 1FFQA 4BQ3A 1QI4A 2W91A 4JCMA 1CXEA 2BY3A 3PTQA 4AC1X 1B3VA 2O9PA 1ODUA 2GFTA 5BWFA 5M17A 1V0MA 4F66A 2WHJA 3MO4A 1HVQA 4UQAA 1GZJA 4H7VA 3BAKA 5I79A 3HU7A 2VR5A 1XGZA 2O92A 5DT7A 4U31A 3CUJA 4ACYA 2UY4A 3ARRA 4RL3A 2EO7A 4V27A 1E0VA 3AMKA 3CHEA 2PWHA 2A3HA 4BQ5A 4CGTA 4MJ4A 1JNDA 4W86A 8A3HA 3RM8A 1QI2A 1FH9A 2EPKX 6CGTA 2XSBA 5KZ6A 1WPCA 5ABFB 1HL9A 4CN6A 4JFSA 7CGTA 3WF0A 1IZKA 2Z1SA 3RM9A 1H4PA 1TR1A 1VFOA 4TX8A 2QPUA 3DECA 1CDGA 3ZR5A 3WDRA 1CXFA 4BF7A 1V3HA 1EHNA 1JDCA 1NWTA 3U7BA 4NF7A 2W4XA 3AXIA 1JGIA 2WSPA 2WZEA 3VDBA 4DUWA 4MJ2A 1QOXA 1EA9C 2WMKA 2WANA 1HJSA 3DHPA 1XCXA 3FN9A 2GJXA 5CPQA 1CPUA 3ZM8A 1KBBA 1I1XA 5BXTA 1QVBA 4IPNB 3AZRA 1Y7VA 5CLWA 3WBEA 3AYRA 5FL0A 2G8ZA 3CHFA 1NOWA 5BYWA 4HPHA 2G41A 5A3HA 1DWIM 1GUVA 2WWDA 3BAWA 3OA5A 4M81A 3W0KA 4W88A 2GSJA 3F5LA 5DMYA 2NT0A 4FK9A 4JKMA 1NARA 1YHTA 2X0YA 3RDKA 3VMPA 4E4PA 3EMCA 3A6OA 1OM0A 1EQPA 1NOFA 3K8KA 3VO0A 1SMDA 4WF7A 4AD5A 1OIMA 4AD4A 4UFJA 2BHUA 2CETA 1MW3A 1ITXA 3VNYA 1JI1A 4MNJA 4B15A 2X1IA 3B9AA 1M04A 2ZIDA 2VX6A 5A6JA 2AMGA 5LA1A 2CCRA 3CTTA 1JZ7A 2PF0A 2Y5EA 3VIJA 2CEQA 2BHYA 1FHLA 2GK1A 2DIEA 2DSKA 3SEPA 1FHDA 3QHMA 5C70A 5E0CA 4HOWA 1SFSA 5A8OA 5JBEA 2V3GA 4HMEA 2UY3A 3ARTA 2V3FA 1BYAA 3LPOA 3CUFA 2YL6A 4S3JA 4UFIA 3HN3A 1GQIA 1HF6A 3KL3A 4HA4A 4HOZA 2B31A 1VAHA 3L4XA 1BYBA 3VIOA 1LL6A 1V3IA 1OGBA 3POHA 3BAIA 3HMCA 1B30A 2XWEA 4D6IA 3MU7A 2A3CA 1XD0A 1BF2A 2FDMA 3G6LA 3CZGA 3N9KA 3QHNA 3QOMA 2ZUMA 4UFHA 3W4RA 1BVZA 2PWGA 2GJRA 4FMVA 1LQ0A 2QMJA 3BCFA 1ZBVA 1D3CA 5ABHA 2YL8A 2CBJA 3TP4A 1FP9A 4B3KA 3WN6A 1HT6A 4HU8A 1DHKA 4Z2GA 2WNWA 2JIWA 1UWSA 1ISWA 1QNPA 1OT2A 3OB8A 4KRUA 3ARQA 5AC5A 2WXDM 2CESA 1EOMA 1F4HA 1GQKA 1SMAA 3VIHA 3L4VA 2BS9A 5LYRA 1C92A 4PCSA 5A6KA 1QNQA 1ISYA 4AXNA 2EQDA 1JYWA 1HVXA 4WJXA 1JF6A 4YN5A 5I24A 3N18A 3PZOA 2ESCA 3I3BA 1HX0A 5ABGA 3RJYA 3K8MA 4W93A 4Z2HA 3CO4A 4MNMA 4RE4A 1TMQA 3AS3A 3WD2A 2OYLA 1F4AA 5EMYA 5E0FA 3PZQA 2ZWYA 4HZ8A 3PZIA 2VC9A 2CERA 2GVYA 3AFBA 3SCUA 1NWUA 1PEZA 1TVNA 5E6ZA 2BXYA 2WBGA 5GQBA 3FHQA 1SR0A 3RILA 2VOTA 1FH8A 1W1PA 4CU6A 2E40A 2VQTA 2YDQA 4TOQA 2Y8VA 2VRKA 2YDSA 3ZO9A 1GOKA 3VD3A 1V6VA 2E9BA 2W67A 3AZSA 5F7UA 2FHBA 4GXPA 1H2JA 4CVWA 1R8LA 3CZJA 2BNJA 4Z2IA 1TG7A 3ARPA 2C7FA 1OT1A 2E0PA 3WH7A 1QHPA 4P8WA 3WQWA 3CGTA 4OUEA 1A47A 4ACZB 3ARYA 2WK2A 5CG0A 2QV4A 2X8RA 1EQCA 2JEQA 3NSMA 1E5JA 3PZUA 3WNKA 5CLTA 2VZOA 3CZ8A 5HPOA 2CBIA 2CKSA 4UFLA 3VVGA 1CXKA 1BHGA 1K9FA 1L0PA 4K68A 3SCTA 2DGAA 3ARWA 3ZT5A 3VM5A 3QGVA 2D0FA 1VBRA 3SUTA 1HJXA 3N04A 3AZTA 2FHCA 1C90A 1V3MA 4AW7A 1H1NA 1LWJA 3AICA 1W91A 1B3WA 4Z2LA 4J28A 1PJ9A 4JKLA 4UNIA 1W2VA 4W7WA 2ZXAA 4EAMA 1W2PA 2AOSA 2PBGA 3VNZA 1B3YA 1EO7A 2VO5A 4HMCA 3T2OA 1E15A 4X9YA 4JFWA 4CCCA 4HA3A 4YHEA 4GQQA 1R85A 4QLKA 4Z2JA 1QW9A 4B9ZA 3CLWA 2J7CA 3ARUA 3VMNA 1HKJA 1E6SM 2XM2A 2NT1A 2CBVA 5FCZA 2XM1A 1CXLA 4PN2A 5AYIA 4UTFA 1XSIA 2V5DA 3SUSA 4LYQA 5GNZA 3T09A 4QDMA 5CGMA 3KZSA 1OIFA 1TA3B 2XYLA 4D6HA 1JFXA 1N82A 3BMWA 5JIWA 3FAWA 1B3ZA 1U30A 5A8NA 1QPKA 1XYZA 4XX6A 2WAGA 2WCAA 1UH2A 1H11A 1OGSA 3MMWA 3FXYA 1V6YA 1XH0A 3BLPX 3ARXA 4B3LA 3OGVA 1E40A 1ZBKA 4U5IA 4W5ZA 4H04A 2D3LA 1AQMA 4A3YA 3W25A 4BQ4A 1LJYA 5A1AA 4PTMA 1JD7A 5EB8A 2VCCA 2D2OA 2J78A 3BXWA 2BY1A 1B1YA 5HOSA 1UKOA 2GJPA 4DUVA 2YL5A 3VGBA 1PZ2A 3WNOA 3NSXA 3AHYA 1G0CA 3IJ9A 1UR9A 1CNVA 1V0NA 2F61A 1H09A 1B9ZA 1WZAA 4LPCA 3FNDA 3KL0A 4ML4A 1C8QA 3WF4A 5KEZA 3HJEA 1HNYA 1V02A 2DSWA 3VIMA 1HJQA 5GNXA 2NSXA 2CNCA 4MDPA 1CGVA 3ZMRA 2ZOXA 3WKZA 2WZIA 4TVCA 2GUYA 3EDEA 4U5KA 2VJXA 3W28A 2F8QA 3LPGA 3O6AA 2W61A 3UETA 1RP8A 2IUZA 2YA1A 1VBUA 4MB1A 4J7RA 4HU0A 3PZMA 3N17A 2G3JA 2OLHA 5I23A 4M29A 2J77A 4PMRA 2V38A 1UR2A 2ZICA 4W5UA 2WVVB 4ZXLA 1VFFA 1O7AA 1JF5A 1PPIA 3WMCA 5E9AA 1KQZA 4GINA 4NRRA 1CWYA 4TVUA 2WVSA 3N1AA 3FW6A 4GZEA 3WELA 5I2UA 1I75A 4DUXA 3OBAA 4JZ5A 1GVIA 4PMZA 1WAWA 4H2CA 1WKYA 1M01A 1J0YA 1LL4A 2VCBA 3L4TA 1GOWA 4PUDA 3O9NA 5M03A 1E71M 4UR9A 1DTUA 1XH1A 3VIIA 4AZ5A 3VKKA 1LL7A 5A2CA 1HN1A 5BXSA 2WVUA 3APGA 1UOKA 5JIPA 5A6LA 1JI2A 4GO8A 4M82A 2DT2A 1OGGA 4J3SA 4AD0A 4UZSA 1X1NA 3VDCA 2AAAA 3ZT7A 1C93A 2D3NA 3VTRA 1B3XA 1OBAA 3NJ3A 4NSBA 2DEPA 3W82A 4PTWA 4HMDA 5FOOA 1BVNP 1C3FA 4AZ7A 4PTXA 2PC8A 2W5FA 2ZX5A 3GTNA 3SCVA 5D8ZA 4UOJA 4IUGA 1TVPA 5I77A 4AY1A 5HDRA 1GOQA 5HPCA 2J8GA 1QNRA 4E2OA 3FY1A 1W3KA 4WSJA 1JDDA 4TVDA 4XUYA 2V3DA 1MW2A 1V0KA 4ZE5A 1EOKA 2VCAA 3VGEA 1GQJA 4LGXA 2ZUNA 1VJSA 3KL5A 1Q6CA 3WNMA 1H0IA 5E6YA 2ZUWA 3AMCA 2EPOA 5A6SA 5AYBA 4AD3A 2DDXA 1BG9A 3GXIA 1P6WA 4EK7A 2X0HA 9CGTA 3WH9A 3NYDA 3PZTA 2PWEA 2XPKA 3VIFA 2MANA 4W84A 3OLIA 2FH8A 2XGIA 4OOZA 3RM4A 1W1YA 1GW1A 3L4YA 3DYOA 1UR4A 4XB3A 2WC4A 3T0BA 4WIWA 5BXRA 4GZIA 4PMVA 1DWGM 1UWUA 2IXVA 3K1DA 1Z32X 1ZL1A 3WL0A 2QPSA 5DFAA 4JKKA 1BYCA 2V5CA 3NDZA 2DSVA 6TAAA 3BMVA 2QMKA 1NWRA 3EDDA 3MUZ1 4CD8A 2XTKA 3OZOA 2A3AA 2WMHA 3N12A 8CGTA 4F9JA 3W29A 1WCGA 4U2ZA 2VMFA 4MDOA 4N42A 1QBAA 1W1VA 4PEEA 3DHUA 4M56A 3N15A 4W8LA 5A2BA 1E9LA 3MV11 3WFLA 3A4AA 2RGLA 2VR4A 2PB1A 1SYTA 2G3IA 3K4DA 3ZSSA 1MXGA 4WKHA 1AMYA 3WL1A 3B8SA 2ZWZA 2OWXA 3LMYA 4P8XA 3NCOA 1UR0A 2CHOA 4MAZA 3NUKA 4WKAA 5D9OA 1MQRA 3VD9A 1EXPA 4YPJA 2OSXA 3T0AA 3AYSA 2QLYA 1U33A 1JFHA 5JUVA 3L4ZA 2WSKA 1WNOA 2WMJA 4GI6A 2XVNA 2CXGA 1GHRA 5FIPA 3EDJA 1WDPA 1XSJA 5GPRA 3POCA 1VFUA 4W85A 3JUGA 4UQBA 1E0WA 4P8UA 3WEMA 4OJYA 4CVUA 2VX4A 3VU2A 4PMOA 4RE3A 1ZB5A 3WDQA 2CHNA 4X0NA 3WMBA 4OOUA 3ARSA 2BVYA 4PMNA 2CPUA 3KEHA 4PSPA 4AZGA 3WD1A 1TZ7A 2F2HA 3CZKA 1WB0A 4QP0A 3GNOA 2XFRA 1NP2A 1EDTA 2VX5A 4AD1A 5BROA 1ZS2A 1K6AA 5HNNA 2YL9A 1OSEA 4PMDA 1ZU8A 4CCDA 2J74A 5D4YA 3GZAA 2O9RA 1GONA 4DWSA 1A3HA 2VZUA 2ZUSA 3BAYA 2D0GA 4DM1A 5A69A 1BG4A 3LPPA 1J18A 1KB3A 5IHSA 1UQZA 4DWSC 2G3MA 3ZR6A 1WZKA 1J9YA 1EIBA 3VMOA 5C71A 4UZUA 1UD8A 3AS1A 1V02E 2Y24A 1UQYA 1KXVA 5A95A 3F4VA 1HJVA 2VVNA 3AISA 5HXMA 4D6CA 3VGGA 2VZVA 4A4AA 4CN4A 4CD6A 3WUFA 3IAQA 1VFMA 2GK1B 3PN8A 1E5NA 4QLLA 2ZXQA 3FHAA 1E55A 4ZXOA 1E6PA 5E70A 1B31A 5A6BD 1H49A 1OD0A 1PX3A 4FF5A 3THCA 1C7TA 1BGGA 1PZ3A 3QR3A 3PHAA 1IZJA 1HP5A 1PIGA 2EBNA 5BXPA 3D5HA 2JF6A 1J0ZA 1FP8A 1UD3A 3UEQA 1ESWA 4PUEA 2J7BA 1GOIA 3WQ4A 3L4WA 2DIJA 1VRXA 2WHKA 3GDBA 2QF8A 3WQ5A 5CPTA 3MMUA 2WHLA 1H0GA 3U7VA 2J75A 2HISA 3MUY1 1UG6A 1PX8A 3VGHA 2BFGA 2WMIB 1ZBCA 3ARZA 4IPLA 1MQQA 1Q6EA 4AMCA 6A3HA 4GQRA 3AHZA 3IK2A 4AZCB 3RCNA 2ZX8A 2FGZA 1E70M 1FA2A 1KXQA 1I1WA 4A3HA 5C8BB 5M5DA 3GH7A 1VENA 3MKKA 1TFVA 2ZUTA 3U5YA 1E4IA 1XRVA 1ZBWA 3WQVA 4H8UA 2YDRA 2A3BA 1CYGA 1AQHA 2GJXB 4UQEA 1GCYA 4UQ9A 3WD4A 1QI0A 4MB4A 1JYNA 1VB9A 2V3EA 3BSHA 1C7SA 1ECEA 4HZ7A 3S2CA 1CENA 4QCEA 4OZOA 1JAKA 4W7VA 4HPGA 4C7FA 1E56A 1ZJBA 3TTOA 2Y2WA 1EDQA 3OLEA 5I78A 1UZ4A 2UY2A 4IISA 4PMYA 3KE0A 3W27A 1XHGA 5HBFA 3CUHA 4GO9A 3W26A 2XFFA 2YKKA 4Q7NA 1M53A 1DWAM 1R7AA 1KGUA 1S46A 2J79A 1E43A 2VURA 2DSUA 1JD9A 4CD5A 3SCWA 2WKLA 3UG4A 4KMQA 1BLIA 2WLYA 3AIQA 2XVPA 1HJWA 2XVGA 4AISA 2PWFA 2CBUA 5A8MA 3TTSA 5IFTA 2D0HA 5BRPA 2D1ZA 2XJ7A 1R87A 3MV01 3VDHA 1E1FA 4URIA 5CZKA 5CSYA 2WMIA 4GI9A 2VTFA 2O9TA 1V08A 1R86A 3PZNA 1PX4A 1W3HA 4LYPA 4EANA 3GBEA 3WDHA 3WDIA 3OGRA 2EEXA 1R7OA 4BQ2A 5A8PA 3MS8A 2DT3A 1VIWA 2GDVA 1CIUA 3T08A 2JALA 5A6MA 1WZLA 3GYCA 1E4LA 1HL8A 1W3JA 4LXFA 3MUAA 4HOXA 2J7FA 5M3WA 4AIEA 2CITA 3GNRA 4JFUA 3SUVA 3N11A 1V6XA 5DT5A 2WPGA 1E6NA 3ZT6A 4HA1A 2EPMX 1XSKA 3WNNA 2ZX7A 1C91A 1V3JA 4QAWA 3ALFA 3N13A 3ZIZA 4D1JA 3SURA 4PYSA 1DEDA 4QLJA 1XCWA 2ZXBA 2WW5A 4KGJA 2ZUVA 3WH5A 1H5VA 2OSWA 4MPKA 3VD5A 1H41A 1KFWA 3MSDA 1TE1A 1CLXA 2OYMA 2WVTA 5FKYA 1IT0A 2J4GA 2FH6A 4DWSB 4H41A 1OD8A 1EHAA 3BGAA 3WSUA 2BY2A 7A3HA 3T0DA 2BVDA 1GHSA 3WMSA 3AIBA 3GBDA 3AROA 3CZLA 1UWRA 4L4PA 1KQYA 4P7LA 1QI3A 1QI5A 1KCLA 2RGMA 3WEZA 3T2QA 4P7QA 5CSUA 4AD2A 3EBVA 3RPMA 1CLVA 4R5EA 2CYGA 1G1YA 3WIJA 2VZSA 4AWEA 4PMXA 1G9HA 1V6WA 1HKKA 4R27A 5CXPA 4GKLA 3WDPP 3OG2A 3VIKA 2C8NA 3A47A 5FD0A 3L2LA 1CGXA 1KR1A 3A4XA 1V03A 1RH9A 1FFRA 1LG1A 2X09A 1DWHM 1CGUA 2JF7A 4XV0A 1NWSA 4E8CA 4FLSA 4D6EA 5A94A 3WFZA 1X6NA 3NSNA 1W9UA 3OZPA 3WD0A 3U57A 4XZWA 2ZXDA 5TD4A
chains in the Genus database with same CATH superfamily
1EC9A 3B8VA 3E1F1 4PUUA 3AXKA 2P5NA 3H2MA 1DE6A 3M6DA 4DO6A 3UJEA 3WMLA 3RGTA 2QDHA 4GX8A 4HTYA 1C29A 4Q22A 1B2YA 1TQJA 3WLOA 2XFYA 2ZA2A 3RITA 2BBFA 3GWQA 5J8LA 3KFTA 4CN1A 1EB3A 2NX3A 1X96A 4OKDA 3BLOA 5K9CA 2A0NA 3K13A 3TMLA 1W3NA 1R2SA 1U2YA 1DQUA 4UTLA 2X2YA 2Z1XA 1EFZA 1ZP4A 3UZZA 4MLRA 4D6GA 4MAVA 4HMNA 1CXIA 4ROQA 2FB2A 2Z00A 1PZ0A 3MI3A 2J62A 1CLKA 2P53A 3LQLA 4JTUA 1H63A 2ZTKA 3QYQA 4EKJA 2VDIA 2YIHA 4GHRA 2I1OA 5C54A 2BGSA 4I6KA 4WGHA 4AZHA 5I6SA 1W9DM 4G56A 1T41A 3URBA 1XL9A 1LT7A 3AXHA 4EX4A 1TWWA 1NH6A 1KR0A 1XLFA 2OWCA 5FEXA 1GPFA 2PBOA 1KW1A 1TUXA 4GPNA 3CIVA 1Q6QA 2H9AA 3EPNA 1BPLB 3STCA 1W5QA 3T2PA 6REQA 4NG3A 4GJIA 1ECQA 2O9OA 4OUIA 4PMUA 4KPLA 3PTDA 4MUPA 1MI3A 4MTVA 3WUGA 3TTQA 1K7FA 1JDEA 1A5UA 3UR5A 3WBAA 1RVKA 3D3FA 1B0IA 1S1RA 4ACZA 3I10A 2VFFA 1YEYA 3L21A 1N7KA 1FWAC 5A8QA 1R47A 1CXHA 4H19A 2XGZA 2FJKA 3M5ZA 2G3NA 2F7FA 4KS0A 4NYYA 1XLAA 1TPFA 3TK7A 3N2TA 1TRIA 3O16A 4F8XA 1X6LA 3GNNA 2VNCA 4C5ZA 3TYBA 1X7IA 1O1HA 1XV8A 3AJ7A 1LLWA 1W56A 4OIFA 3M07A 2OYKA 4QGCA 5GNYA 4OV4A 1UA3A 2VDGA 3O2LA 4NYUA 2KAUC 4EPBC 1JZ2A 4YJ5A 1SFLA 3LCHA 4PUWA 3A23A 1UH3A 3UCDA 1XGEA 3W01A 3G6MA 1V3KA 3B4UA 3PTMA 3FLUA 1DE5A 2OKTA 4UCFA 1A80A 3E0VA 2I9UA 3C2RA 1QPNA 3Q45A 4BI6A 1UOZA 3UQNA 1C8YA 4HVXA 3PY2A 4QFUA 1JXJA 5EMKA 3N2XA 3GVVA 1PL9A 2FGBA 1RVGA 5HR7A 3FSTA 2WCGA 3H26A 1BVWA 4JFVA 4LS1A 1N55A 3FDKA 4NZCA 3PULA 3ITGA 5I0DA 1W9VA 1M9HA 2YA0A 4GMEA 1EGZA 1Q6FA 2I5GA 4IMDA 4C7DA 3S9ZA 5C9ZA 3LM7A 1XFBA 4FPSA 4HNNA 4WX2A 4CKQA 2XIIA 2QCLA 2A85A 2PURA 1EX5A 2Z1KA 3N3TA 3P7YA 3BE7A 2RHGA 1KNWA 3C3UA 3T81A 1G4EA 1EC7A 3VKAA 4HGXA 4PRTA 4DJEC 2EGZA 4CQAA 5FL1A 1K02A 4AZ6A 1GNXA 3AQUA 3CT2A 2QVNA 2DUZA 2GOUA 3S5YA 4ZFMA 4FIQA 2ISSA 1KWGA 1ODZA 5I3IA 3C8NA 4D1IA 4FR1A 2CHRA 2FGLA 3KHJA 4Q32A 4O18A 4DJDD 5LXEA 1JZ5A 3T7VA 3UG5A 2YB1A 1J0JA 1QBBA 3BW2A 4WY0A 4Q4RA 1YTKA 1W1IE 4F0HA 2J7GA 3DERA 5D8WA 5FJRA 4LAZA 1CX9A 3GR8A 3CC1A 3GQYA 2NXIA 2DY3A 4DUOA 4AHQA 4PBGA 4CQ9A 7REQA 3PP7A 8RUCA 3SM0A 1J01A 5I7GA 3B0UX 1O5RA 1Q2RA 1I60A 5CJ5A 1KM0A 3UJFA 3H21A 2ISFA 2PDQA 3ZJ8A 1OINA 3PSVA 5T9BG 3L23A 1S5VA 4JTKA 1KFKA 3DIPA 3BZJA 3BDKA 3AIVA 3UG3A 5LA2A 3KRBA 2GQ3A 1EDGA 2B4GA 5D09A 3BAJA 4L4OA 3EWDA 2J66A 5I5RA 1U5JA 2Y8UA 4AG0A 3M4HA 2W79A 1ZENA 3VI2A 4UC5A 2VVSA 3QPEA 1I2OA 4OV9A 1JIBA 3T8QA 3E2VA 4QQUA 1E1CB 3I68A 2ZZ5A 4UQCA 2DSZA 3TLLA 1GVQA 3WJWA 3B0PA 1KM2A 3QZAA 3WUBA 2VX7A 3CQKA 3WQ6A 1KM3A 5MF5A 3ZJKA 3SUUA 2J8FA 1XH2A 1QXLA 3EB2A 4ZA0A 5LA0A 3S83A 2ZC1A 2X7WA 2G5WA 3SI9A 1ZRQA 2QCNA 2C1IA 1AQ0A 2ZA3A 2QUVA 1EJWC 1B54A 3GDKA 3IGSA 4JTSA 5F4WA 2W63A 3AIWA 1NQ6A 4V2XA 3CH9A 2VZTA 1CW2A 3OPSA 3TTEA 1UKQA 1UUMA 4NJKA 2WC7A 1B9BA 3N25A 2PWDA 4DO7A 3CPUA 1OX4A 2OPJA 1WDSA 4HZ6A 3PZVA 1V93A 5A2AA 1R46A 1M03A 4LH8A 4GVIA 3LCFA 2EPNA 4DPPA 1IGWA 3RHGA 3GVQA 3UU0A 5F2GA 4MF4A 4N6FA 3GU1A 4J27A 3BG3A 4W7UA 1QHOA 4W4QA 4J3VA 3WQCA 2ZE0A 3CQHA 4XSMA 5CGQA 4FALA 4HBKA 3UR8A 3NPUA 4O50A 1MFUA 3I3DA 3UZXA 4A8IA 4ATDA 3SUWA 3H2NA 3DDMA 5BRQA 3KLKA 4IIHA 3L68A 3IAPA 3IK4A 3WLMA 1UWIA 1MVYA 3UBPC 1CT5A 3H4WA 5DF0A 1NDVA 1S5MA 5C2GA 3HPFA 4TTGA 4IIFA 4O1EA 4ATLA 2JIEA 5HQMA 1C8XA 8XIAA 2E9LA 3Q37A 3PJUA 3GH5A 2VD9A 3PVFA 3NIYA 2YR1A 1TCDA 3LPFA 3CHDA 5JXQA 2YYUA 1CBGA 1TV7A 3SRDA 3EDFA 1QATA 2FQIA 4LVDA 4P7OA 1JPKA 4HJFA 3VOFA 2FPTA 3EA3A 3PZ9A 2YJQA 5SWUA 5AFDA 2XWDA 1IZCA 4F0LA 3XIMA 3KDOA 3LCXA 1QHZA 2OX1A 2PAJA 5LHEA 3HPXA 2Z2BA 3W00A 3CMJA 2EF9A 4GUGA 1O60A 3C86A 4O8AA 4D6FA 4P7NA 2J8TA 3ZLGA 3DFOA 3OVQA 3AIRA 1G94A 1VCFA 2E4TA 1DWFM 3SCRA 1LZOA 2NW0A 2X05A 1MW1A 4OQVA 3S1WA 3FGCA 3FEQA 1V4YA 3O63A 3MJYA 1UIOA 3E74A 4KBXA 3ZVHA 3WK0A 2P3ZA 4XZNX 3LMZA 3U9IA 2DVTA 3W7PA 2WHJA 3LV5A 4AYGA 1RSCA 4H1ZA 1HVQA 1GZGA 4H7VA 3BAKA 1EKOA 4XK2A 4G1KA 3LY0A 1XGZA 2PDLA 2CZVA 3LXAA 3CUJA 1RBAA 3DBNA 4DYKA 3MBFA 4FO4A 3TAKA 1AJ0A 1E0VA 5FAJA 3V1HA 4ZOCA 1LOQA 2PWHA 2F6XA 1PKMA 4CGTA 4MJ4A 1JNDA 4W86A 3C6CA 2OFJA 3APYA 3EX1A 6CGTA 4JBRA 1WPCA 5ABFB 1HL9A 4ZO8A 2R1KA 5EL1A 1IZKA 1VBGA 1J6PA 5ECVA 1TR1A 1CDGA 4H7ZA 1I2NA 2C16A 1V3HA 3FYOA 3NQ8A 1IEIA 2QJIA 5E9XA 2ZBTA 2W4XA 3QV8A 3AXIA 1FCQA 4K1GA 5HULA 1IXQA 2PDKA 4DUWA 3NQ7A 7REQB 4UXDA 1XCXA 3DOPA 5CPQA 4GNVA 3SQMA 3BGJA 4JQ2A 2AKZA 1K1DA 4EAYA 5FL0A 1NDZA 3OIXA 1RK5A 3CHFA 1P6CA 5BYWA 4MG4A 1P5BA 1GUVA 3BAWA 4XUGA 5G2WA 3H2EA 5DMYA 1Q4WA 4FK9A 3RDKA 4E4PA 2QUMA 3LA4A 2XN0A 1XLHA 1OM0A 4EF9A 2ZYFA 1NOFA 3CUZA 3UXLA 2GSEA 1OIMA 2GVEA 4HYVA 5DRIA 4RDWA 4DXKA 3HG3A 4LANA 1GTHA 2Z29A 4B15A 4LB4A 2BB0A 3W70A 5DMMA 2JKEA 4GYKA 4IFKB 1OK6A 1BEUA 2ZC8A 3KBJA 1LQ2A 4LS2A 3VIJA 1JUEA 2CEQA 2GK1A 2X30A 1G6CA 1GWJA 3A3WA 3NVTA 5I03A 3SEPA 3REQA 1U5VA 4JS3A 3R13A 2CLMA 4JTIA 4J4KA 1X8CA 3GK0A 2NV2A 2FTWA 3W2UA 3ARTA 6ENLA 4DEFA 3LPOA 3BO9A 3CUFA 4GACA 4UFIA 4B92A 1HF6A 1TV4A 3BLFA 1MDRA 1TQXA 4NX5A 3WJZA 3E49A 1LCOA 1ME9A 1F07A 1V3IA 5E1QA 5JMUA 4ERGA 4D6IA 3RX4A 2PTXA 4ZZ9A 1XD0A 2CW6A 1BF2A 4XBSA 4GNKB 2QMJA 2G37A 5CKSA 1D3CA 5ABHA 2FTYA 1TTJA 3F4WA 5CSSA 5H8PA 3WN6A 2VDHA 3EWCA 1NDWA 1VKFA 4Z2GA 1S5WA 1J4EA 1UWSA 2QF7A 4OVXA 4KT2A 3VIHA 1GQKA 3LTYA 5CAHA 3L0NA 3BOXA 5A6KA 1QNQA 3C4UA 2TRSA 2FZ8A 1JYWA 4FI4A 3LHWA 3W3OA 4IG2B 4I7WA 3PZOA 2ESCA 3IRSA 1HX0A 3LRKA 3RJYA 3ORWA 3G0XA 4E2DA 2PA6A 4PCPA 5LKYA 3WD2A 4ML9A 4NJHA 1J5SA 1F4AA 1ZNNA 5EMYA 2O4MA 2YYTA 4AUBA 3PZQA 2KZHA 2ZWYA 3PZIA 5K3VA 3AWOA 3UA3A 3A5FA 4F0KA 1VLWA 2YXGA 1NWUA 1PEZA 1TVNA 3WLKX 3W72A 1JUKA 2OR2A 2VYOA 3B8DA 5GQBA 1O94A 4QE1A 4LV4A 2VOTA 1A5LC 4LOCA 2YDQA 2FYMA 2Y8VA 4KCUA 2VRKA 3VD3A 5F7UA 2V5KA 2FHBA 1QW7A 4ASTA 4KCTA 1TX2A 5AC8A 3S6OA 1TG7A 3EWXA 4NAFB 2B7QA 4QXIA 4P8WA 3BQ6A 4DXXA 3LI1A 3CB8A 4DO5A 1A47A 2QULA 3OTRA 1SZNA 3O7UA 4AX7A 3GC2A 2NQHA 2X8RA 3R58A 2X7VA 3NSMA 3E0LA 3PZUA 3WNKA 2J13A 4KEZA 6PTDA 5HPOA 2C0AA 2DZVA 3IS4A 3MW7A 1IEVA 1K9FA 1L0PA 1UBSA 1QO5A 3BLIA 3SCTA 4ONVA 3ARWA 3VM5A 2D0FA 1W8SA 3QKEA 3CL8A 3R94A 2FHCA 1JCTA 3AICA 1XW8A 3O6CA 3QSTA 1PJ9A 4Z1DA 4A21A 4PFMA 4IOTA 4JKLA 4ZMGA 1KCZA 1ZCCA 5CJNA 3LNMA 1Z42A 1XLBA 4I7VA 1B3YA 1RALA 2Z1BA 2Y5JA 1XWYA 4HA3A 4YHEA 3CV7A 1XIFA 4FZIA 4B9ZA 4P5UA 1WBHA 1E6SM 2V2HA 1KM6A 2B7OA 2XM2A 4DELA 4K7YA 4JTDA 1CXLA 1EWDA 4LAUA 3PBWA 4PN2A 3U2ZA 1M7OA 1XSIA 3TIMA 1AJ2A 1SJBA 2V5DA 4WGXA 1P0EA 5LZLA 4D6HA 1VGAA 4F3HA 1TV5A 2JBMA 4BJHA 1NU5A 5DXXA 3TJLA 3MB9A 1XYZA 4XX6A 3FFSA 2WAGA 2XFWA 3A9BA 4WUIA 3NZPA 4IZGA 3A3XA 2BVWA 3MZNA 3OQEA 1UPPA 4ADTA 4H04A 4R3UA 5C6MA 3W25A 3W1TA 4PTMA 2XH4A 2CC0A 5J5RA 3TW6A 1S3HA 1VYSX 3QVQA 1PZ2A 2H3BA 3NSXA 3IJ9A 2RDUA 3T05A 1RY8A 1Z8AA 1V0NA 2F61A 4M1BA 1H09A 3ME3A 1B9ZA 2Q3RA 4LU0A 1C8QA 3HJEA 5CAKA 4Q33A 1HJQA 5GNXA 3REQB 3LDVA 2NSXA 4KFNA 3SO7A 4PCNA 4TVCA 2DZSA 2ATMA 3EDEA 2F8QA 3LPGA 1JCYA 2OEKA 3UETA 4B5UA 4MB1A 1V77A 4HU0A 3N17A 1ENUA 3SQLA 3VCNA 4WXYA 1ZUAX 3ONBA 4CNNA 3CT7A 4Y9AA 3CLMA 4GQGA 3MQTA 4ZXLA 4GC4A 1O7AA 2QCGA 4IIDA 1GT8A 4LF2A 4HYRA 3BV7A 4HCHA 1Y65A 1XXXA 2H3DA 3DH7A 3E02A 3E0IA 3OBAA 3R79A 5DX7A 4IQLA 4LF1A 1S2CA 2WZTA 4F2BA 3D47A 4XISA 1A49A 1G69A 1M01A 3H24A 3CEPA 3SGUA 1I8JA 3P5ZA 4UR9A 1DTUA 1XH1A 4J2MA 3VKKA 1EF3A 1KTNA 1UOKA 5JIPA 2G3FA 4GO8A 3UJSA 3E5BA 1WKDA 1OGGA 2PRLA 4UZSA 1P0KA 4DNMA 1A4MA 4GUJA 3OEXA 3MCNA 2WM1A 2DEPA 3HGOA 4A05A 4KCWA 3RR4A 2R91A 1YE6A 3G1AA 1YBQA 2I16A 4JQ1A 4H9UA 3SCVA 5D8ZA 3NQVA 4IUGA 4S2BA 4AY1A 5HDRA 5HPCA 4EXBA 3FY1A 3QZEA 3ITOA 5H6HA 1PUDA 1GEHA 4A3QA 1DL3A 2VCAA 3VGEA 1MRQA 4O17A 3KL5A 1Q6CA 3WNMA 4H2HA 3USZA 1KBJA 2OXNA 4J40A 1VYRA 5DANA 1KM1A 4GISA 3NYDA 1H61A 2XPKA 2MANA 3OLIA 5HJYA 2BXVA 1GW1A 3DYOA 1UR4A 1R6WA 2WC4A 2IXVA 3A22A 1ZL1A 4XD4A 3R0UA 1DXIA 3T6CA 2R14A 3DCPA 5HUOA 1BYCA 4RZ6A 3BMVA 5D38A 3ITYA 2WMHA 3N12A 2QCDB 5LNWA 1WCGA 2BG5A 1Q6OA 3SAZA 4C6MA 3UPWA 1CI1A 4PUMA 3IACA 1W1VA 4ES4A 2IMRA 4YVXA 4M56A 4CQCA 3WFLA 2RGLA 5FSDC 2JQXA 4RR4A 3K4DA 1Z48A 3G1VA 1YRRA 3B8SA 1Q63A 1Z69A 1TTPA 3NCOA 4CNSA 2CHOA 5D9OA 1OCBA 2VFDA 2OSXA 3AYSA 4I5UA 2ZVIA 4PR4A 3KW3A 1XP3A 4HB7A 3SZ8A 3SBFA 3KOXA 3EA2A 3SQSA 4DZ5A 1WNOA 1KFJA 2XVNA 5CPLA 4AU0A 5LIXX 3UA4A 1M5WA 3DKLA 1O12A 2F6KA 1W54A 3BWWA 4LUTB 1PB0A 1R3WA 5GPRA 3CWNA 3POCA 1VFUA 4REQA 4ZOAA 3E2RA 1GKQA 4W85A 4EXAA 3JUGA 3PM6A 4OJYA 2VX4A 3KRUA 4PMOA 4RE3A 3N14A 3LZ5A 4JTLA 3WDQA 3PUGA 1SUXA 5HJXA 3IJQA 3WMBA 1W8GA 1FWJC 4NX0A 4X9SA 3MP5A 1TZ7A 3EGJA 1F73A 1YKWA 1XUUA 2F2HA 3R0DA 2NUXA 4WZHA 1V7AA 1KV5A 4H9XA 5C9WA 2HDJA 1LYXA 5C55A 1XGDA 3ATYA 5FJTA 1K6AA 4FOJA 1REQB 2YL9A 2VWTA 5FEWA 1LROA 4GBUA 5AOUA 3TZFA 5H2ZA 2O9RA 1GONA 4ZSTA 2PSNA 2FZBA 2VZUA 2ZUSA 5CC3A 4DM1A 1EC8A 4AVNA 3P81A 1J18A 5IHSA 3KRZA 4DWSC 1PHWA 4JX5A 4Q4OA 1KXVA 3T40A 3QTPA 4L65A 5I3FA 3M47A 3IAQA 4MZ1A 2GK1B 3PN8A 4QLLA 3FHAA 1E55A 1FBAA 3L12A 5A6BD 1TMHA 1GYMA 1PX3A 1TO3A 1VJIA 2PTWA 1BGGA 3M64A 3VKCA 3PHAA 4Z1CA 1IZJA 2EBNA 5BXPA 2FLIA 2HVNA 1MNZA 1FP8A 4XQ6A 4UNKA 3EWZA 2Y7GA 4ZQNA 1ESWA 3ES8A 1GOIA 3WQ4A 3L4WA 3PBMA 3TN5A 2WHKA 1EYWA 2O7SA 2GPTA 1B5TA 2P3EA 3QC3A 4O1DA 1ZP3A 4L7ZA 3UW6A 4ORIA 2J75A 4GE8A 3MUY1 1UG6A 3ARZA 2QCEA 4IPLA 1Y5WA 3MUCA 2DVXA 1Q3NA 1Q6EA 1XISA 2FZNA 2G50A 1GG1A 4HU3A 4FAMA 1E70M 1FA2A 2BZNA 2EKGA 2Z6JA 5C8BB 4KIEA 1TFVA 2ZUTA 4LCSA 1E0TA 1ZBWA 4GOAA 1POKA 3KP1A 4H8UA 2PDBA 1CYGA 2DFAA 4UQ9A 4CLMA 4MB4A 1JCJA 3BSHA 3R43A 4HZ7A 4LV9A 3S2CA 4F0MA 1UR3M 1W5MA 5JVLA 5AECA 1Y0EA 4HPGA 4C7FA 2VGBA 3BLEA 1ZJBA 3W1UA 1FX6A 1EDQA 5DXYA 5U4NA 2OQLA 4IIGA 2IQDA 4QQ3A 3CUHA 2XFFA 4Q7NA 5HQEA 1ZGDA 3CQJA 1M53A 3C0JA 3V5OA 1KGUA 1S46A 1E43A 2V6AA 3O6YX 5GJNA 1R0MA 3V35A 5AHIA 3RXZA 4UUIA 1NJJA 3LLDA 1F74A 1BLIA 2B81A 2W0UA 2XVPA 3W7EA 4Y8FA 1NSJA 4AISA 2PWFA 2OT1A 3NQFA 3HV9A 2D1ZA 2XJ7A 2O55A 1YADA 2AAMA 3LCIA 4E38A 4O52A 4C6BA 1DJIA 3C61A 2VTFA 1FRBA 3Q65A 1R3YA 3GBEA 1XYBA 3B05A 3WDIA 4A3RA 3BLLA 3QKZA 3P6LA 3PB0A 3RPDA 2GDVA 1D8CA 3TJIA 2Z28A 4IMEA 2JALA 3SGGA 2WKJA 3GTXA 3E38A 4LXFA 3LHYA 3TAOA 3KDNA 2E6FA 3ZVIA 1A5OC 1RJPA 2CITA 4S3AA 4JFUA 2I5QA 5DT5A 3SRFA 2BP1A 4HA1A 3UWWA 3QGAC 3WNNA 1RA5A 1THFD 1C91A 4QAWA 3N13A 3E12A 7ENLA 4HA0A 4D1JA 2Z25A 3WJSA 2VD8A 4PYSA 3NGFA 1XCWA 4WOQA 2ABBA 2ACUA 2ZUVA 4MPKA 3PBYA 4PUKA 3MHFA 1SO5A 4HQVA 4DWSB 1EHAA 2Y63A 3WSUA 1P1MA 2Z0IA 4D8ZA 2QUUA 1RR2A 3GBDA 1GPWA 2PODA 3AROA 3CZLA 1UWRA 4L4PA 3W7IA 4S3DA 1R3VA 2XN2A 2PDWA 3DFNA 2O56A 4YTTA 4L64A 1QI3A 2WV8A 4QISA 4P61A 1QWGA 1KCLA 3KOFA 4LY4A 1RQEA 5CBJA 3IWPA 3PS7A 5CEWA 4S39A 4P7QA 3UT0A 3RK8A 1UP3A 4MVAA 1TSIA 2VZSA 4K1WA 3Q58A 4C91A 1HKKA 3WDPP 2A6NA 2ABAA 3VIKA 1ADDA 2V68A 1RH9A 3HB9A 3GFYA 1XKYA 1CGUA 2ZRVA 3M41A 4D6EA 1X6NA 3MBDA 4QG8A 1O5QA 3I7QA 3OZPA 1UP2A 1EPVA 3HM7A 5B80A 2PGEA 4NJJA 4XZWA 4ACZB 2DT0A 1WDWA 3LUTA 1NQKA 3BG5A 1OX4B 2VEFA 2WKGA 3WH6A 3VX1A 3G1RA 1US3A 2D22A 4AB4A 2OTDA 2HZGA 3QMSA 1JXKA 4O1CA 3CEUA 2YBUA 4PH6A 3TQPA 5IDIA 3IJ8A 2IQ0A 4MKVA 2PGRA 3ABXA 1AD4A 2C1HA 3U4AA 1KGWA 4H7CA 4IF2A 3S2LA 4J3WA 4P8VA 4CUCA 5C2CA 2ZVRA 4YWSA 3DFTA 3CPRA 2G95A 1A3XA 1UZ1A 1PDZA 4GI8A 1UA7A 2VWSA 5EKYA 5DN1A 3A21A 1XI3A 5KINA 1JULA 2QGHA 1A5SA 5D33A 2VI0A 4GG9A 4ATWA 2NXHA 3VOGA 5D02A 1I45A 1V8EA 2DVUA 4QDWA 3EB3A 1VEMA 2IPJA 1VFLA 4XD5A 1YXYA 2OELA 2J7DA 2PDNA 2HVMA 3EZ4A 2G96A 2QIWA 1W1A1 4BS0A 1E6XM 2WJEA 4PGLA 1XJBA 4H8NA 3PWAA 3WDJA 4CD4A 1F2JA 4ADSA 3NL6A 3AMLA 1TV3A 1HUVA 4D72A 4PTVA 4GA8A 1OK4A 3SN4A 1X38A 4E8DA 4WRHA 1WXJA 4XKMA 1TWDA 1RD6A 1JNEA 5HNTA 7TIMA 1JPIA 1TCMA 3BTNA 3WQEA 1UC4A 3GDTA 5REQA 1YQ2A 1KXHA 5FEPA 3BCDA 2J9ZA 4KERA 3DC8A 4N9DA 4JGDA 3BW4A 1ZFJA 1XG3A 1ICQA 3K46A 2I56A 4JICA 2ONEA 3W1MA 4PMQA 4GFIA 3THAA 5D32A 2DH2A 4LWWA 4W8AA 1JDAA 1OCQA 3NQEA 4H01A 5AC6A 2DORA 4XZBA 4M0XA 4H9TA 2E68A 3EYPA 1R3SA 3R12A 3L9CA 3ZJ7A 3F5JA 3GSMA 4M8UA 4Q4QA 3L4UA 2P88A 4ICNA 3M9YA 3G1HA 5MKGB 3UXAA 5FJJA 3QQ1A 4ZFCA 1AG1O 3UGRA 1TX0A 2WVVA 4H6EA 3CMFA 3EOOA 1PXGA 5AZ1A 1SU5A 3M0JA 5TQLA 2J9YA 4W89A 3UD6A 3Q2DA 2TMDA 3HQPA 2A21A 2HXTA 4D9PA 3GVGA 3VE9A 3W1NA 3CUGA 1TPDA 4MLJA 1QPOA 3VX0A 4AC7C 5EBAA 3RCMA 4JFTA 2IXUA 4RDVA 3QY8A 4HNVA 2PDMA 2ZUUA 1PZ1A 4U33A 4HK6A 1GOOA 1QJWA 4KEVA 1B90A 1MSSA 5FF3A 5HA7A 4JL1A 1Q6LA 1U1JA 4H9VA 3HURA 3CASA 1M1BA 3NDYA 3NGJA 3KBMA 4NILA 2Q8LA 1D7FA 4WOZA 4RPQA 4U3AA 3W7HA 3B3DA 3DENA 1UHVA 2PU0A 2QCCA 3GDLA 4DHGA 3PNUA 3VIPA 1H3GA 3QHOA 1PKYA 1XLEA 1F8IA 2PMQA 4UFKA 3WENA 1XQKA 3VM7A 3B8TA 4BCEA 9RUBA 4UQDA 2UY5A 5K4ZA 6ALDA 2E6AA 3QTGA 5K9XA 4XZIA 1W3TA 3TR9A 1QCWA 5IHRA 1TA3A 3VINA 4QDPA 1GORA 4FXJA 2VFGA 4RXFA 2CFFA 1RLDA 4GK8A 2ZFAA 3FKRA 4JL2A 2G97A 4LALA 4WK9A 2XIBA 1NOUA 4N9EA 2QGYA 4F9DA 4KEUA 4K8GA 1FWDC 4RDZA 3KOZA 3G3DA 2OJPA 4J3XA 2P8BA 5BCAA 5L6UA 5CJMA 2FZ9A 1XDLA 1VRDA 1HKVA 1DKWA 4QTGA 3FYYA 3VD4A 2YSWA 2GDUA 1HJUA 4Y9MA 3O15A 2FKPA 3NA8A 2OEJA 4YWIA 2CZDA 3AHXA 3HV8A 2NV9A 3NQCA 4A22A 1V79A 1QOPA 1GJWA 4AZBA 4QG6A 5AYZA 2QUTA 1OWQA 1NIUA 4ZVJA 3AMDA 1M7XA 1B57A 1W9XA 1VJZA 1B4KA 5FF7A 4KWWA 4QAIA 3M1ZA 7ODCA 4OFCA 6XIMA 4TTUA 4LQ1A 4LBRA 1S5NA 3MYPA 4AEOA 4A2SA 2JGYA 4BWLA 4ECLA 1GVYA 4TO8A 2JFEX 4S3BA 3TN4A 4WLCA 3A5VA 1H7NA 2WYSA 1O95A 1FCVA 1JZ6A 1RV8A 1NM9A 2D23A 2BVTA 2A3EA 1QK2A 2QCFA 4HK5A 4B3ZA 3LZ3A 1CTNA 2MUCA 1LLZA 4HN4A 4DRSA 2E28A 2BWGA 1GVOA 2INEA 1BFNA 4HK7A 2YW4A 1Q65A 3OZYA 1XCFA 1TJ1A 2H6RA 3A4WA 3VC6A 3N2OA 1GVEA 4M6QA 3JR2A 1MWOA 2VP8A 2CLLA 1L6GA 1UYQA 2Z6IA 1YIXA 3V7PA 2C91A 4BF5A 4QJ4B 4NAEB 3SCPA 1J0HA 3D6NA 4LX4A 4H9ZA 1XD1A 1U83A 1VQTA 3ARVA 4WSHA 1D8WA 2WZMA 3GNDA 5JBFA 3LX9A 3RLUA 3UP8A 3B8UA 1VD6A 2XVKA 1KWKA 3GW3A 3WQOA 3S5ZA 4ZGYA 2OCZA 4YIWA 3RMEA 3OLDA 4UFMA 5LXXA 3SIMA 1QW8A 3H4GA 3UPBA 3ZLFA 3T44A 5EBUA 4KH2A 3VOIA 1BQCA 2YCLB 4BZYA 4Y7EA 3PUDA 1E6RA 1HKIA 2EXOA 3VIGA 3AUJA 4MNLA 1EEXA 2WSYA 3PUOA 2BHZA 4G5DA 1NF0A 2DUXA 4L9ZA 5HATA 4JEQA 1XLJA 4V28A 1S2VA 3FKKA 4NJIA 3HA1A 3IANA 2ICSA 3VABA 4CD7A 1AMKA 3PUEA 3W7KA 3EOSA 2Y8KA 1NFGA 1GJUA 5G1YA 1W17A 3VOHA 3N6JA 1BXCA 4UTMA 4FLQA 4DB7A 1U1HA 1QNOA 3S5OA 2E8ZA 4GXWA 1IV8A 1OFAA 4CCZA 1K9EA 5EMLA 3GXTA 3SSJA 2DZUA 3R4IA 5DEZA 1CGYA 2PTZA 2PDCA 2VC5A 2DQXA 1XS2A 2DZPA 1JRBA 3WUEA 4K39A 2VRJA 2YA2A 2PD9A 1HGYA 5FACA 2GLKA 1MW0A 2WWCA 2HJPA 3BSMA 1SO4A 2CIPA 2Z27A 1DVJA 3FX4A 1ZQ5A 2V9DA 2X1SA 5FF0A 5LIUX 1A0EA 2VM8A 1GQNA 1FWWA 4OTKA 3ES7A 1J79A 2FMNA 2V2DA 4IT1A 4FR6A 4H8VA 3CMGA 1L6WA 3GH4A 1D9EA 1JR1A 3ZXWA 4FLOA 2Y62A 4BA0A 5FESA 3UXKA 3WEOA 1NF7A 4N0RA 4HHMA 2WMGA 4MMWA 4XD3A 4KW2A 4B5VA 3H23A 3IJLA 3G1DA 1VEOA 2HE5A 2XZ9A 3T4CA 4JDBA 3RRAA 1CXEA 4AC1X 3EEGA 3S1UA 1V0MA 3MO4A 1Y8BA 4LRTA 5I79A 2VR5A 2O92A 4GXMA 1UUOA 2F9RA 3MWCA 4V27A 2PDPA 3P14A 1G4TA 2OKOA 3STPA 1JPMA 4BQ5A 1AODA 4HIBA 3QV7A 2HTMA 5CZTA 4ERAA 3H70A 5KZ6A 2VENA 4JFSA 2TODA 1ICPA 2A7PA 3LQGA 3USBA 3RM9A 2J27A 4IX0A 1K77A 5DBTA 3PPHA 1VFOA 1LRQA 3KUMA 3WDRA 1CXFA 1IEXA 1EHNA 2EJAA 1XX1A 1JDCA 1NWTA 3RAOA 4N7QA 2E5BA 1XLKA 2QJMA 2WPBA 2WSPA 3NM3A 3GXNA 2WZEA 4MWAC 1QOXA 3U2CA 2WANA 3SRHA 4N2YA 2GJXA 2NLYA 3ZM8A 1I1XA 1EUAA 1LTDA 4WD0A 2UBPC 4IPNB 1Y7VA 5T9CE 3WBEA 2E5DA 2G8ZA 3AAMA 2VEIA 1WYIA 3B0YA 5KETA 3LNPA 3NO5A 3E2SA 2ZZ1A 1GOXA 2DZBA 1QMLA 2Q3OA 5HUPA 2GSJA 3N73A 5I09A 2NT0A 4US6A 1NARA 2X0YA 1VFTA 1EJ7L 3KP0A 3IVSA 3VO0A 1SMDA 3KHDA 4WF7A 4AD5A 4C6DA 2VC6A 2HVOA 1H51A 1SZRA 4UFJA 1BXNA 2YXOA 3M5VA 4O19A 3LBOA 1M04A 1BWLA 4JYEA 1AL8A 2RKXA 1RD5A 2CCRA 1JZ7A 5G2HA 3NZQA 3VYLA 2O7QA 5F4XA 1FHLA 4G1NA 5CPMA 3ELFA 2Q8ZA 2RUSA 2DSKA 3S9IA 3MCOA 1DHPA 3V16A 1FHDA 1VLIA 1RUSA 5CH9A 5E0CA 4HOWA 1OX5A 5JBEA 3SJNA 3HMJG 2C14A 1FY6A 1UCWA 4G8TA 1B3OA 3MHGA 4HOZA 3P80A 4A29A 4V15A 3VIOA 2J24A 1LL6A 4ICCX 3HMCA 3S2JA 3DKJA 4C6EA 1B30A 1ME7A 2OZ3A 4BI5A 3MU7A 5ABTA 4US5D 1TIWA 3C56A 3CZGA 1TPVA 3N9KA 2ZUMA 2P10A 4UFHA 2PWGA 4FMVA 3EX2A 3HO8A 4JTRA 5H1WA 2YL8A 4PB4A 2CBJA 3W07A 4QM1A 3NAVA 4Q8QA 2HSAA 1QPRA 3UWZA 3ANVA 3OB8A 3ARQA 1A5KC 2CESA 1SMAA 2NVAA 3W74A 4YTSA 2UV8G 2OLAA 3NZGA 1ISYA 3H53A 4GKTA 1OYCA 1HVXA 3DEQA 1FHUA 1FWGC 1JF6A 1QDSA 4O11A 1WV2A 4PUJA 1XC4A 3K8MA 4W93A 3VOJA 3CO4A 3O0KA 5DBUA 2YCLA 3MKVA 2D2JA 3PNZA 4JHMA 2WJDA 3ABSA 1RLCL 4UIOA 3KS5A 4PB5A 1XIBA 3WLRA 2HQAA 2ASHA 2HPIA 2XIOA 3W7NA 2ZE3A 1OFPA 3L5LA 4GIYA 5DRCA 5EY5A 1G7VA 1GOKA 3AZSA 2E9BA 4FSAA 2PUZA 4KCVA 4HHHA 4GXPA 3G0UA 1FWIC 2R24A 3G77A 3AU6A 4CVWA 4CNTA 2C7FA 2E0PA 3WH7A 3C2EA 4IMAA 3ANUA 5CG0A 1BSLA 2QV4A 1OVDA 1EQCA 3W84A 2JEQA 1V5XA 2F6UA 1E5JA 4RZBA 5CLTA 3F2DA 2VZOA 5H8MA 2CKSA 4UFLA 3UJRA 1L6SA 1HO4A 4ZCWA 1PYMA 3SIZA 4ZTXA 3DZ1A 3LYEA 1TMLA 1VBRA 3KTCA 3SUTA 1HJXA 3N04A 1V3MA 3W7RA 2OOGA 2VUNA 5LNVA 4Z2LA 4UNIA 1W2VA 3R8GA 4ORMA 3T42A 2Y7DA 4FEZA 1KRMA 2PBGA 4K3ZA 3KTXA 2VO5A 3RX2A 2KX9A 4Y96A 4JFWA 1WUFA 3FEMA 5CSRA 1C9WA 4CCCA 5DMLA 1DXEA 1S3TC 4GWEA 4C5YA 4NHVA 2X41A 4GQQA 3S1VA 3BVJA 2E25A 5DCEA 3VMNA 2GVJA 6XIAA 1VP5A 3CIXA 2XM1A 3B9NA 4MM1A 4ADUA 2EG7A 4UTFA 3ATZA 2GVGA 2V30A 3SUSA 5GNZA 2X2GA 3T09A 4QDMA 1OIFA 1TA3B 1XFCA 2XYLA 5K2ZA 3QMRA 1Q66A 5HK4A 1QPKA 5XIMA 3BANA 4ICMA 2WCAA 4QS6A 1H11A 1EXBA 1OGSA 4HSNA 4KWOA 2WJZA 4E2BA 3BLPX 5HAOA 2ZDRA 4JTAA 3UY8A 4ZQCA 3S6DA 4WQ6A 5I3GA 1E40A 1ZBKA 4FA3A 3TXZA 4W5ZA 1LBMA 3VUSA 1Q8JA 4A3YA 1LJYA 5AHNA 5A1AA 1JD7A 2D2OA 2J78A 3BXWA 2BY1A 4C6IA 3BW3A 1QT1A 1QUMA 4DUVA 2YL5A 2BTMA 3G24A 1TTIA 3AHYA 3C0QA 1UZHA 3Q94A 2I5IA 1A0CA 3QW3A 3LCWA 4HN8A 1YNQA 2IPWA 3QXBA 5KEZA 3WF4A 4ALDA 2DSWA 3NQ6A 3VIMA 3IIOA 2PLMA 3W6YA 1DJZA 1Q7QA 1OG0A 4E4UA 1AW5A 4JYDA 1Z9AA 1FTXA 5FJPA 4AY7A 2WZIA 5EMJA 4U5KA 4HYWA 3LK6A 3O6AA 1OFEA 1RP8A 2IUZA 1VBUA 2G3JA 3E0FA 3BARA 4IX2A 2J77A 4PMRA 2V38A 3TJ4A 2Y7EA 2OU4A 1YNYA 2E77A 3WMCA 4LCQA 1KQZA 4FB7A 1KM5A 4C6KA 1XKJA 1LUCB 5JH1A 1I75A 2BX7A 4DUXA 3NO1A 1Q2SA 1WAWA 4K2SA 3ITCA 3G8RA 2VCBA 1LL4A 3L4TA 1GOWA 2C79A 4ROPA 3O9NA 4DY1A 4H6RA 5M03A 1UB3A 4NIRA 3VIIA 5A2CA 4ZO9A 3IVUA 3QQ0A 1JI2A 5E0KA 2DT2A 4TIMA 4J3SA 1QAPA 5HINA 3U2OA 1JEZA 4IL2A 2AAAA 1TJ2A 3NZ1A 1H60A 3NJ3A 4NSBA 4DX3A 3TQKA 3W82A 3S46A 1A5NC 1EUNA 4HMDA 5FOOA 4N02A 4AZ7A 4BKNA 4I8YA 1QWKA 3VKJA 4EXQA 2ZX5A 2BOEX 2FB3A 5FSEC 2R9RA 1TVPA 5AHEA 2I17A 4GCAA 1XF0A 1W3KA 3SB0A 1JDDA 5LNUA 3MVIA 4FXSA 1MW2A 1LDCA 3VNLA 1EOKA 2YX0A 5IM51 1OYBA 4BI7A 1IF2A 3R11A 3WBYA 4AX6A 1T5AA 3B40A 4PCFA 5G5IA 1VJSA 4OU1A 1KFBA 1OFBA 1R30A 1TPC1 3AMCA 2EPOA 5BOFA 5AYBA 1QK0A 4ERIA 4IPJA 1UJQA 4EK7A 2FPYA 2FZDA 3PZTA 4GY1A 2VGIA 4HT3A 3N4FA 4W84A 2XGIA 4K8HA 3QR1A 3T0BA 4PMVA 3FGCB 1DWGM 1AH3A 4RV3A 1YDOA 1EJVC 3CJPA 1FHVA 2V5LA 6TAAA 3WLTA 4Z0JA 1NWRA 3F1QA 3UVIA 4CD8A 3WK1A 4EVZA 2XTKA 2A3AA 2Y5SA 1IXPA 8CGTA 3L2IA 2BODX 3W29A 1E0UA 1DIDA 3P82A 2X0SA 1OCNA 3GHSA 3GFXA 2DUAA 3TQ0A 1QBAA 1ALDA 3PB2A 4EWJA 2AQWA 1JJKA 2X1TA 3DHUA 1FVPA 3T9PA 2B7NA 4H6KA 3MV11 4RPPA 2PB1A 3CAVA 2G3IA 3ZSSA 1FQ0A 1MXGA 3MDWA 4WKHA 3EXTA 3GR4A 4AFYA 2ZWZA 4P8XA 1TPUA 1UR0A 4DJDC 5LIKX 1DPMA 4WKAA 3TV8A 3C0SA 4YPJA 5RUBA 1XLGA 1NTHA 3T0AA 3EX3A 8TIMA 4MGGA 1JFHA 3MTWA 3JZEA 3VDGA 5HMDA 4AY8A 2RFGA 2WMJA 4XZMX 2CXGA 2XIQA 5FIPA 5H8UA 3EDJA 4AIBA 1G4PA 3HFYA 4HSOA 2CLPA 3S5NA 5HNRA 1E0WA 3PPCA 3KS6A 4NU7A 1ZAHA 3LSBA 4PL1A 5BU9A 4X0NA 2FFIA 1JCLA 3CH0A 3MC5A 3DI0A 3DHDA 2OLSA 1EWEA 3IVTA 3WD1A 3W71A 2JKPA 1YTEA 1EEPA 3S8HA 3GHRA 2XFRA 4B2DA 5BROA 3LEPA 4KEMA 3GG1A 3QR0A 3QSRA 5C9UA 5HNNA 1J2WA 3JS3A 1XIJA 1ZU8A 2MNRA 3GR7A 5CBBA 2XDFA 4PB3A 5TF0A 1A3HA 2HK1A 3BAYA 3H2OA 3IIZA 4KESA 5HNUA 2V8ZA 3NL5A 1WKEA 1FWEC 4PEKA 3LPPA 1IWBA 3DG3A 3ZR6A 1EIBA 2OMAA 1IIHA 5C71A 4UZUA 2P50A 1ELSA 3AS1A 1V02E 1F3EA 1UQYA 4U4MA 5FA5A 5A95A 3F4VA 3STEA 4GJJA 4DBUA 1GKPA 2VVNA 5HXMA 2VZVA 4CD6A 4R33A 1VFMA 1YE4A 4DN1A 3NQBA 2PDFA 2ZXQA 4ZXOA 1E6PA 5E70A 3GG8A 2A2IA 2ZZ3A 3MVTA 4LC6A 3WBWA 4DI8A 1PZ3A 3LSCA 3EKLA 2V82A 5AYXA 1HP5A 3BOFA 4R9XA 4KQNA 3TJXA 2GVLA 1ZAJA 4JYFA 1SJAA 2J7BA 5D03A 3CUXA 3GW0A 4F0SA 2FIQA 1VRXA 4C1NA 3LS9A 4LUSB 3GDBA 4BY3A 2QF8A 3CV2A 3WQ5A 3MMUA 1Q13A 4IMCA 2AGTA 1UBPC 1RK6A 4GIEA 4OE7A 1W31A 1MQQA 4BF9A 1T40A 3BJTA 2INZA 4AMCA 5PTDA 4LAOA 4LB3A 4AQLA 2OG9A 2ZX8A 4IXHA 4QJ3B 4DF0A 3H55A 4A3HA 3DESA 3UGVA 3GH7A 4DBSA 3U5YA 3N34A 4H6QA 4PULA 1E4IA 5DY3A 4DZHA 3NPWA 3WQVA 1MUWA 2YDRA 2A3BA 3U48A 4UQEA 4RE0A 3WQPA 3QPYA 2DZWA 2PU1A 4JTCA 2ZADA 3RLHA 4RLIA 2J6XA 1ECEA 3WJXA 3I6RA 4JIHA 4JR5A 1JAKA 3EWWA 1XM3A 3F4NA 2PDUA 2Y2WA 2ZZ2A 3OLEA 2VFHA 5I78A 1UZ4A 2ATSA 4DLFA 4IISA 4IP7A 1XHGA 1PDYA 2V67A 3HPZA 1DQXA 1RY0A 1MZRA 5IBXC 1DWAM 2J79A 1AH0A 2DW6A 2DSUA 4FXRA 3CS2A 3SCWA 1J8VA 2WKLA 3UG4A 1Q5MA 2PPGA 3H54A 3BCJA 3T78A 1TWZA 1SZGA 5IFTA 4DBEA 1GKRA 3MV01 4URIA 1TPH1 1T99A 2QJGA 4IJRA 5LNRA 1E9YB 3GAKA 5CSYA 3KWSA 1V08A 3PR2A 1MMFA 1KCXA 1XLMA 4HNUA 4R53A 1KFEA 4EANA 1DQWA 2PDIA 3TC3A 3WDHA 3G18A 5JU6A 1AA1B 1NFBA 2EEXA 1AUSL 5A8PA 4ZB0A 3MA8A 1VIWA 4XVEA 3VE7A 1PTGA 3FCPA 1CIUA 2PGFA 4WR3A 5F1VA 3T08A 3M0ZA 2Z1VA 3HGJA 1OFOA 4LEQA 1HL8A 3TW9A 4GUIA 3N19B 4HOXA 1N8IA 4DZIA 1B4EA 3SUVA 3N11A 3TSBA 1LM1A 1E6NA 1FDYA 3VK5A 2EPMX 1XSKA 3W83A 2BDQA 2R1NA 3ALFA 3GC5A 4EIVA 1F3TA 3DBPA 2C13A 5KZMA 1DEDA 1XBYA 3WLNA 3RPTA 4HZMA 4KGJA 4C6JA 1H5VA 2OSWA 2B7PA 4H9MA 1TE1A 2Y88A 3ITVA 4OECA 1CLXA 4GUHA 5FKYA 3O07A 2J4GA 2CZ5A 4C6PA 3VCCA 3KVMA 1OD8A 4PZVA 2W3ZA 3S2NA 2JK2A 3PJTA 3WMSA 3C2VA 4GY7A 3LCLA 4MYXA 4R7OA 2QS8A 1VCGA 1KQYA 4X2RA 4P7LA 2NWRA 4PFHA 1YPXA 1F76A 3WEZA 3TFCA 2ZRZA 5BMXA 4LFYA 1CB2A 1FWBC 3T2QA 1XG4A 3FXGA 5AHLA 2AGKA 1PS9A 2QDDA 2W9MA 4R5EA 3AJXA 1G9HA 1V6WA 2HCVA 4BEQA 4B5WA 3SN1A 4E2VA 4XAFA 1UROA 4CEXC 1ONEA 3HZ3A 3L2LA 1CGXA 4LUTA 1KR1A 3A4XA 1V03A 5CC7A 4YVVA 4I5XA 1FFRA 2AQOA 1XPGA 5EMUA 1NWSA 4FLSA 5A94A 3NSNA 4TMBA 3UZJA 1R3RA 3GU9A 1LWIA 3H6OA 3MMTA 3KCOA 3QFWA 3U2EA 2EHHA 3U57A 2PCQA 3G3MA 4S38A 3HTWA 4M80A 1CGTA 3N9SA 1BSIA 4D8AA 1F05A 4JN6A 4NI3A 2HEJA 5E93A 4AIUA 3S6TA 2NV1A 1TPEA 4W87A 3NDOA 1MFVA 2TAAA 3R25A 3P8JA 4HD5A 1LLOA 1KGXA 1HP4A 1AVAA 1E4NA 1XIEA 5TNVA 1S1PA 2DT1A 3R8HA 4U3CA 4GYFA 4NT0A 5I3JA 5J5DA 1XYFA 1K6WA 1XIMA 4DJED 4NRSA 1YPFA 3AHTA 1VH7A 4TV5A 3A3HA 3W2JA 2PCEA 2J47A 3W87A 4PC8A 3SGZA 1US2A 3W22A 4PBEA 3U6WA 1V0LA 1S38A 4GZJA 1E6ZA 1K9DA 4AZIA 5KITA 3P62A 2BOGX 2GOKA 4S3KA 3ANYA 1J0IA 4NZ3A 1M7JA 2VUYA 5IRPA 5BU6A 1BYDA 1GOMA 1UWTA 3BGGA 4FNSA 1G5AA 3GFZA 4UWMA 4ZTYA 1JG9A 2XINA 1ISVA 3MMDA 2Y70A 3DFSA 3GHUA 4C60A 4MJZA 3M43A 4GBDA 1K7XA 2XUCA 3E3HA 3WF3A 2G4FA 1PIFA 2AKMA 3IV3A 3ZSTA 4HSHA 5C5YA 3NR0A 2CXEA 1GEQA 3F5KA 3NFUA 4I9MA 3DC0A 1NP0A 1FWSA 2GJNA 1LRTA 3RG6A 2VELA 1SJCA 1L6YA 3L7RA 3R6IA 3ZOAA 1YBQB 1W32A 4MY1A 5DO8A 3B4YA 2DZTA 3FSUA 3SCSA 4P7RA 2PLCA 4MB5A 2OWWA 3RCYA 3RMJA 5T91A 1LP6A 3SCQA 3FS2A 3EWBX 1UR1A 3SADA 3WNLA 2C0HA 3VUPA 1DXFA 1I2PA 3KBVA 2YBTA 1EO5A 3P60A 1Z6KA 4WKFA 1W9PA 1R3TA 2D20A 1KFLA 4HNLA 3RFAA 3S42A 3QMTA 4QSFA 3VNDA 4LEFA 3ITTA 3M5YA 2L5HA 3LG3A 4KWUA 3VKBA 1R5YA 5B7ZA 1PYFA 2Y7FA 3LU2A 3NTYA 4IICA 3AOFA 3M7WA 1K3UA 5D9MA 4IP5A 4I9AA 1SJDA 3BG9A 3IJ6A 3HQNA 3LXCA 2QYGA 4NNAA 4MNKA 3V5CA 3QGKC 1YDVA 3BMXA 4HP5A 5EFFA 2XHYA 3LERA 1H62A 1ISXA 2YCKX 4Z17A 4JN8A 2WMFA 1AD1A 1ZAIA 3I6EA 4FNPA 1K4HA 2D2GA 4UOZA 3BH4A 4TMCA 2EJ1A 3TONA 4QX4A 4KWVA 3EMQA 3QH2A 1PAMA 4ZQRA 3AUOA 3WD3A 3W53A 1ITCA 1VF8A 4DO4A 1IWPA 4LNYA 4O0ZA 1W1TA 4UMBA 1JL8A 1K9TA 4HHLA 3DGBA 5AY7A 1W3LA 2WNZA 3D0CA 1AL7A 3I4EA 4AEEA 3CAWA 3EPOA 4M6VA 3VD7A 2HV5A 3CPGA 1OJXA 3IRDA 1EGMA 2ZRUA 3LB0A 3M0LA 3RU6A 3GC4A 1XUZA 3WH8A 2D2HA 2DH3A 3PBVA 3TNOA 2CLEA 2QHAA 3CWOX 1L2UA 1T7LA 2NXGA 2BASA 4JIEA 4E3VA 1H7OA 1TJPA 2CWXA 3C3NA 4XSLA 2HROA 3LI0A 1BGAA 4NZJA 5CC6A 2C6QA 3GE7A 2ISDA 3GXFA 2E9MA 2GDQA 4B5NA 1KRBC 2FPVA 2QJNA 5G1TA 3W24A 2QJJA 1D2KA 1H5YA 2FVLA 3R10A 1UKTA 1OG6A 3M0VA 4M24A 2ZRWA 1OZQA 3PPGA 4IM4A 4U28A 5BNKA 1GVSA 4CU8A 1BTCA 1IQ8A 2CU0A 4D6JA 1KO0A 1SO6A 4J9JA 2CKRA 3EOLA 5JBDA 4PTDA 3GDMA 1YDYA 4O8RA 4XG1A 4M6PA 3ECQA 3VOCA 4ILSA 1K7EA 4FHAA 1IYXA 1GW9A 1XYCA 3V3WA 5A6AA 2VFEA 4J3TA 4ZE4A 2H9AB 1ONXA 1MYRA 3BLKA 3SRKA 3L2MA 3FV9A 1DJNA 3LGGA 1WDQA 1BAGA 4S3FA 3SR7A 4QJ5B 4JHOA 2ISWA 1QNSA 4D6DA 2OGJA 1UH4A 1JPHA 3EB4A 4Z2KA 2WZHA 4HCLA 2XGBA 1J11A 5HMEA 3QBUA 2FHFA 1DJYA 4UR7A 3U3HA 4NVTA 1VPXA 3MUIA 3STGA 2TSYA 4C6QA 3SY5A 3OOQA 3PZGA 2BY0A 3UR7A 1BKSA 3BSGA 5DY2A 1J6OA 2FVKA 3CZEA 3OLGA 3FA3A 1L2QA 5ECUA 4NAFA 2VQUA 2VEMA 1M68A 5F4SA 4E3TA 1DWJM 2OSYA 4AXKA 4G9PA 4AYSA 2WBKA 2WCSA 3UFYA 1GQLA 4JTJA 5CPSA 3I3EA 4O0QA 3UZWA 3HFTA 1FWHC 1MQPA 1XRFA 5XINA 4ZEPA 3W81A 1DYSA 1ISZA 4B16A 3ZLHA 2Q8XA 3KWXA 3AALA 4IGMA 3H2FA 3VILA 1JCXA 1LQAA 3AI0A 3ALGA 4H8HA 4WSKA 4AIOA 1HIZA 4DBWA 4IG2A 3CAKA 1M3UA 1G01A 2E3ZA 3CBWA 4F4RA 4C6CA 3ZS4A 4JIRA 4J35A 2PDYA 1T6MA 3AIUA 1E3ZA 2HE8A 1T8XA 4B5SA 4ZQOA 2H8XA 2XH2A 3WF1A 4RE2A 5HWMA 3QFEA 4C65A 1UKSA 1Q6RA 4M3PA 3MANA 3UJ2A 4OBSA 1DOSA 1KLZA 3GRIA 4JHZA 3GZ3A 4WDTA 4PUNA 3TROA 7TAAA 4L6DA 2C18A 3HGRA 3EMZA 1Z3NA 3HJZA 4UB9A 4YU1A 4D2JA 4NKCA 2D24A 1MZHA 1EH9A 4MB3A 4LAMA 3VNIA 2YOCA 3ZJ6A 1VR6A 1EBHA 3VGDA 2REQA 2WC3A 1NDYA 1H1ZA 1L8NA 1UD2A 1BRLB 3SCOA 3WY1A 1CGWA 5HWJA 4F0RA 4Y9PA 3TKFA 5AYYA 2NUYA 2J7EA 1XLLA 1RAKA 1BWVA 1HXJA 3HG2A 1EJTC 2Y4SA 1AJZA 1D3HA 2C19A 3RRXA 4IIEA 4LVBA 5AZ0A 5BOEA 3URAA 2A5HA 1HTIA 4AWUA 1SQ7A 2PP0A 3OW1A 5IXEA 4N4QA 2YLLA 4RX0A 1UKPA 3KBNA 5BZAA 3MCMA 1WE5A 3M0XA 4LT9A 4QCFA 1JYXA 1YLVA 4I90A 4ZO6A 2DZXA 2WQPA 4FLRA 3AHVA 3RO8A 4LTSA 5IBXA 3CM4A 1QI4A 2W91A 1S2WA 4JCMA 3PTQA 4IQJA 1B3VA 2GFTA 5M17A 1W5PA 3TYZA 3WK3A 4OBTA 3PFRA 5EGRA 3PFMA 1ZJHA 1XBXA 3HU7A 3CV1A 2XZ7A 4U31A 5DT7A 3LHTA 3ARRA 2EO7A 2R1MA 1H7RA 4H00A 3SECA 4IHCA 3A9IA 8A3HA 1FH9A 2EPKX 4M51A 1L8PA 3CNYA 2XSBA 1A5CA 1V7YA 4RV8A 4CN6A 1RHCA 1YXCA 1TYGA 2OO6A 1VS1A 3A4JA 4TX8A 2QPUA 3CYJA 1SW3A 4RNFA 3OQ8A 4O13A 4GD0A 2Q6ZA 3H4XA 2YFOA 3OVPA 1JGIA 1UIPA 1VBHA 3INPA 1MUCA 1S39A 4GUFA 3MY9A 2WMKA 1HJSA 3DHPA 3KOYA 1CPUA 3WLJA 3BURA 2BOFX 1KBBA 5BXTA 1QVBA 1F9CA 4WVXA 2PP1A 5CLWA 4XZLX 3RR1A 3TQVA 3UXDA 4HPHA 1DWIM 2WWDA 1PVNA 3W0KA 3OA5A 3F5LA 1SR9A 1YHTA 3VMPA 2NQ5A 4GYPC 1I6NA 2X1UA 3E9AA 3HBLA 1SM9A 4JQ4A 1RZMA 2RAGA 4DI9A 5AVHA 1VHCA 1H7PA 4AD4A 1IHIA 2WNNA 3B8WA 4QRNA 3VNYA 4HTBA 1JI1A 4YL2A 2X1IA 3B9AA 1BXBA 4X3ZA 2XSXA 1DIEA 3UPMA 3E0WA 2F38A 2ANUA 4O28A 2PF0A 2Y5EA 5E5CA 2BHYA 4OWGA 4LCRA 2DIEA 2Z2UA 3IGHX 5CG7A 4PTNA 5CBIA 1EF2A 3UWEA 4Q6XA 3B06A 2CLHA 3QHMA 5C70A 3IJDA 3IUIA 2HPMA 5CPOA 1FUYA 3P3BA 4EWND 2V3GA 4HMEA 4HPXA 2UY3A 4JQ3A 3UF9A 1RCQA 3LBCA 1H1YA 3HN3A 4L9XA 2PF8A 4K36A 2E1DA 4JTGA 3KL3A 7PTDA 4Y9NA 1BYBA 4EPKA 3GVRA 2RJHA 1V51A 2A7RA 2EG6A 4MFEA 3POHA 1OGBA 2Z24A 3BAIA 4GC3A 1R2RA 3WLQA 3K2GA 3OYXA 4JTTA 2NUWA 2A3CA 3NQAA 3OVGA 3G6LA 3F4DA 4XKYA 2YGYA 1TZ9A 1P6BA 3ISIX 1LQ0A 1ZBVA 1FDJA 4WJEA 3TP4A 1FWTA 3MHUA 3DAQA 1AH4A 4O15A 1H7XA 5C2XA 4YTRA 4MWAD 2WNWA 2VR2A 3OU8A 1ISWA 1QNPA 4N9CA 4OT7A 2WXDM 1SO3A 1I0BA 1F4HA 2BS9A 5LYRA 3TSMA 1EPXA 4L80A 2YPIA 4PCSA 2ZTJA 4AXNA 2EQDA 4IH3A 3UZ5A 4X61A 4WJXA 1M41A 3TDFA 3F2CA 3N18A 3N2BA 3LOTA 4L56A 3I3BA 1AW2A 5ABGA 2EPHA 4FOUA 4RE4A 1EGVA 1TMQA 4CQBA 2BGQA 3AS3A 2XIMA 4IGNA 2OQYA 5I06A 2BLEA 1Z7AA 5M1TA 1MEWA 1X1ZA 1NY1A 3P61A 4HZ8A 4XIMA 2F2KA 4E0CA 2CERA 2GUUA 3ENLA 3FOKA 3AFBA 3SCUA 5I07A 1KD0A 3G2GA 1EP1A 2BXYA 1FWCC 4S1FA 3FHQA 1SR0A 1UASA 1QNVA 3RILA 2GSHA 1FH8A 5H91A 2Q02A 4CU6A 2ZZ6A 1JVNA 4TOQA 3M44A 3PPFA 2YDSA 3DN5A 4C6FA 3M0MA 5KZEA 4WXZA 1V6VA 2W67A 4MY9A 1W6TA 3PBUA 5MHBA 3NO3A 1R8LA 4JTFA 1OT1A 5D2YA 3WQWA 3CGTA 4OUEA 2G4JA 3TCSA 4XZ9A 2ISVA 5XIAA 4JTQA 3IARA 5LGXA 3CZ8A 4GLEA 2CBIA 2IPGA 2FDSA 1SW7A 3VVGA 5KSWA 3WYZA 4EACA 1CXKA 3S47A 4K68A 3GTHA 2ZA1A 5FJUA 3A12A 1KRCC 1RCOB 1JQVA 4IIBA 4Z0SA 2Y0FA 4ZR8A 4K8EA 3VZYA 4Z1BA 3BV4A 1LWJA 4DF2A 1KRAC 3DXIA 3IUHA 4XAZA 4KWSA 1FDZA 4I8DA 1H7WA 1W91A 1B3WA 1Z89A 4J28A 1GZ1A 1R9XA 2YW3A 4W7WA 2ZXAA 1W2PA 4FNUA 2HWGA 4CNPA 1EO7A