2NW0A

Crystal structure of a lysin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
189
Chain Sequence
GYIVDMSKWNGSPDWDTAKGQLDLVIARVQDGSNYVDPVYKDYVAAMKARNIPFGSYAFCRFVSVEDAKVEARDFWNRGDKDSLFWVADVEVTTMSDMRAGTQAFIDELYRLGAKKVGLYVGHHKYEEFGAAQIKCDFTWIPRYGAKPAYPCDLWQYDEYGQVPGIGKCDLNRLNGDKSLDWFTGKGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.6 A Crystal Structure of the Catalytic Domain of PlyB, a Bacteriophage Lysin Active Against Bacillus anthracis.
pubmed doi rcsb
source organism Unidentified phage
molecule tags Hydrolase
molecule keywords PlyB
total genus 71
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2006-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2nw0A00
2GJXB 3S6TA 1CLVA 4CU8A 4W7UA 1KWGA 1KB3A 5BXRA 2CESA 1TA3A 1B1YA 4W88A 3GNRA 1JI1A 3AIEA 4RE4A 3WH7A 4H8HA 4WLCA 1MW0A 1RPKA 4AWEA 3CUJA 1OM0A 1MQPA 1CZ1A 1ITCA 2VURA 1WP6A 1OINA 1C90A 2FHCA 3KWXA 4P8VA 4LPCA 4JKMA 1K6AA 1ISZA 4R27A 4AD5A 1GONA 1H4PA 2ZUSA 3AI0A 1C7TA 4BF7A 1TE1A 3L4WA 1CXLA 1E70M 1CXKA 4DWSB 3WDJA 5IXEA 1FHLA 1PAMA 2D3LA 2XGIA 3ZQ9A 4BQ3A 2ZXDA 1SMAA 2O9PA 4V28A 4AD0A 1CGXA 3N12A 2HVMA 5ABEA 2X1IA 2CKRA 1GQJA 1UZ4A 1KXQA 1PX4A 3WF2A 5HPOA 5EMYA 1KXVA 3IK2A 1H49A 1Q6DA 3VMPA 2QLYA 1EGZA 1OIFA 4MJ4A 1HF6A 1I1XA 1LG1A 4UQAA 3OLEA 4MNMA 3VGEA 1JD7A 1G9HA 1VBRA 3VTRA 1I75A 5CQ1A 4D1IA 2OSYA 4HU8A 4K68A 4PBGA 1K9DA 1CGWA 3W82A 2ZX8A 1QOXA 5CLWA 1GORA 2J77A 3SCOA 3GXIA 1GUVA 4NF7A 4HA4A 3W6LA 1E4LA 3GDBA 2WANA 3NJ3A 1JI2A 1XH2A 2ZE0A 2PBOA 2ZWZA 3WMSA 3CTTA 1BGAA 1PJ9A 1XH1A 4DWSC 2ZUUA 4H8VA 2YL6A 3WD2A 1WDRA 3WL1A 3CUIA 1WAWA 1HKIA 2YJQA 3CPUA 1SYTA 1UKTA 3VDCA 4AMCA 1V3MA 4BA0A 3QHNA 5EBAA 1E6SM 4RE3A 3NCOA 3QR3A 4W84A 4FK9A 1E6XM 3GNOA 1KWKA 3ARUA 4HOWA 1GVIA 4JL1A 4MNLA 3VD7A 3OLGA 3WH8A 1B31A 4Z2HA 1BAGA 1WKYA 3WUGA 2J7HA 3AYRA 1R85A 1SFSA 1NWUA 4X9YA 1GQIA 1W2PA 2BV9A 3U7BA 2XWEA 3MMUA 3MUIA 2CCRA 2VQUA 3VIKA 1G1YA 3ZJKA 3VGGA 2J47A 4YHGA 1XD0A 1E9LA 1C7SA 5M17A 3RJXA 4EANA 2WBKA 2ZUWA 1XH0A 1WZKA 5TD4A 2DT0A 4P8WA 3CIVA 1NARA 1LWJA 2EXOA 2CKSA 4XZBA 2PWDA 2NW0A 1HJUA 1VFFA 1HKJA 1UQZA 4CCEA 4W5ZA 4A3YA 1QNOA 4X0VA 4HMCA 3WNMA 4JFVA 2OYKA 1BVNP 1BHGA 1UR0A 1H1NA 4QFUA 1EOKA 1WDPA 1JF6A 1GCYA 1UWSA 1CGUA 1GHSA 4KRUA 2BHZA 1Q6CA 1W9BM 1JIBA 1H41A 4W87A 1R87A 2X2YA 3F5KA 3WDQA 2CYGA 4J3XA 4U5IA 2D2OA 1HIZA 4IUGA 1OIMA 2E9LA 4MB1A 5JIWA 1UKSA 2W61A 3K4AA 4LYQA 3MMWA 1JD9A 3K4DA 3A4XA 3VIJA 1DWGM 1FH7A 1TUXA 3BGAA 5IFPA 4CU6A 1DWAM 3LPPA 2BVDA 1E43A 3EMCA 3MS8A 3FNDA 3W25A 5I2UA 1E4IA 2J7DA 1NM9A 3N15A 1ZJBA 2CNCA 2FH6A 3AMDA 4PMDA 3AHTA 2WVTA 7CGTA 5KZ6A 3WQVA 1UWIA 2OSXA 3G6LA 4GKLA 1C93A 2CBUA 2WVVB 2OWCA 3VX1A 3ARXA 3WH6A 3WFZA 4JZ5A 1V6UA 4QCEA 5EFFA 2DDXA 1OGGA 5F7UA 1AQHA 4YN5A 3D5HA 1X6NA 3GYCA 4Z2IA 1HVQA 2BY3A 1C92A 2G4FA 3TTQA 4AZ7A 3WBAA 4HTYA 5A69A 2XM2A 1OWQA 1UA7A 4WJXA 1BYBA 2PB1A 5A8PA 2XHYA 3VO0A 3AIRA 2DSUA 4UQBA 3M7SA 4Y7EA 4V2XA 1E5JA 1Q6FA 1WZAA 1HT6A 3ZJ7A 1JAKA 1QHZA 3BAWA 3POHA 1W9UA 2VMFA 1UQYA 5CJ5A 3MMDA 2CBVA 1OD8A 2QF8A 2V3DA 3ZOAA 3HN3A 1EQCA 3OLIA 1OT1A 1ZU8A 4MADA 1HJQA 2Z1SA 3ARPA 5CPSA 4ZFMA 3ZMRA 5C8BB 1BGGA 3EDDA 3WEZA 1J0KA 2XYLA 4JFUA 2RGMA 3AMLA 4CVWA 3WF3A 3VX0A 4PUEA 1DWJM 3POCA 2JF6A 4KRTA 3SUTA 2J74A 3PTKA 3W0KA 2C7FA 4P7QA 1HKMA 1EO7A 1FA2A 4E2OA 2ZOXA 6A3HA 4TOQA 5A1AA 4CVUA 1V6WA 2JIEA 4OOZA 1L8NA 4J3SA 1Z32X 3VIMA 1JXJA 3BAXA 5DT5A 3PZUA 1QW8A 2A3AA 1GJUA 2VR4A 1ISWA 2PC8A 3KE0A 2G41A 1MW3A 4PCTA 4M1RA 3PZQA 3T2PA 2JEQA 3AXXA 2PF0A 1PEZA 1BVZA 2DH3A 3RCNA 4AEEA 1E0WA 3UCQA 1CXHA 2AAAA 1DP0A 2J8GA 2A3EA 1UWRA 1JZ6A 1D3CA 1MYRA 4AISA 3CUHA 1NOUA 3FXYA 4GI9A 2XGBA 3PZTA 1KR1A 1W9PA 3WNPA 3WNOA 1MQRA 3SIMA 3M46A 5KEZA 1G94A 5LA2A 1MXDA 4WSJA 2VO5A 1JYWA 2YKKA 4EE9A 5FCZA 1RP9A 1VF8A 3LMYA 5CLTA 3W81A 5A6LA 1GOIA 3DYOA 2CEQA 1K9EA 1NWTA 3MV01 4AIUA 3WQ6A 1WO2A 1E40A 2UY3A 3AIBA 2GFTA 1OB0A 2WKGA 2YDRA 5D9OA 1MW1A 2YA0A 2WMFA 4Z2LA 4NZCA 1JFHA 4KH2A 1W1VA 1VJZA 3PZNA 3ZM8A 2V3EA 1RP8A 1BYAA 2BHYA 1QHPA 1BLIA 4MNKA 5C70A 3NUKA 1H0IA 1V6YA 4S3KA 1CIUA 3CZJA 1JDAA 1FH9A 1OD0A 3SCVA 3WDHA 1JAEA 4KWUA 4AD4A 1E6ZA 1JL8A 1CGTA 2WSKA 5IDIA 3CMJA 1E6RA 5A95A 3T2OA 4HZ6A 5GNXA 2Y4SA 3WD1A 1J0ZA 1UH4A 1DTUA 4HOXA 2ZXBA 4GQRA 3DECA 1VFMA 1E72M 1QI2A 1HL9A 3EMQA 1J11A 3WL0A 1KQYA 2WK2A 4QLLA 5IFTA 1LQ0A 1YQ2A 3CHCA 1C8YA 2WBGA 1M04A 7TAAA 2V5CA 5A6SA 3ZSSA 1DEDA 1ODUA 2YA1A 3AZSA 2Y5EA 5BXSA 1UD2A 2UY5A 1LJYA 4UQ9A 1UG6A 1X1NA 5DEZA 3B8SA 3DHPA 3GBDA 3FW6A 5D9PA 4MAVA 4RL3A 3L4XA 1J9YA 1J12A 1E71M 1V3LA 1UD6A 5CGTA 3WQ5A 1CXIA 3BAJA 3VGBA 2G3IA 4JFSA 4D72A 1JFXA 4PMXA 1VBUA 5JUVA 3PTQA 4W7VA 4AD2A 4M29A 3VDHA 2ZX6A 2WMIB 3N1AA 1KGUA 5JIPA 1MQQA 4ACZA 2VL4A 5ABFB 4BQ5A 1J01A 3MSGA 2VJXA 4P8XA 5I78A 4GINA 4HA3A 5E0CA 2WKLA 4D6EA 2J7BA 2WWCA 1H09A 4HMEA 4AZGA 1UWQA 1E6QM 2J4GA 2VZVA 2YBTA 5CXPA 4ATLA 1H5VA 2ZX5A 4FMVA 3AMCA 2XPKA 3O9NA 4MB5A 3OIHA 4C7GA 1NH6A 4TVCA 3MUY1 2DEPA 2CHOA 9CGTA 3NYDA 4UFMA 1SMDA 3AXIA 1CWYA 4H04A 4UFHA 3VIOA 3VGHA 2J79A 4CN4A 1LG2A 4UFIA 5CSUA 1KBBA 3IAQA 4TTUA 2ZIDA 4JCMA 3GH7A 5E09A 1CXFA 1VFOA 1ZJAA 1D7FA 2WAGA 5GQBA 1IV8A 2V38A 2WNWA 3GH5A 7A3HA 2XWDA 3JUGA 1V3IA 4U33A 3FAWA 5DF0A 1BSIA 1EDTA 1GW1A 3AIWA 1QW9A 1JZ5A 3ZO9A 3WNKA 3WN6A 4AZBA 4AEFA 4UZSA 2YL5A 1W32A 1VB9A 3GM8A 3SCTA 1XD1A 1E56A 5I24A 2WPGA 2WZEA 4S3JA 2PBGA 2QPUA 4CD5A 2UY2A 2X0HA 4IPNB 1AVAA 4KGLA 3N04A 1K9TA 1GPFA 1WNOA 5A6BD 2D23A 3VM7A 4MPKA 1JXKA 1Q4NX 3I3EA 4UNIA 3HMCA 3A3HA 1DWFM 4D71A 1ZBWA 4YPJA 3O2LA 3UR7A 3BMVA 4U5KA 4PMZA 4DWSA 4X0NA 4UOJA 2J78A 4GI6A 3WQ4A 2DSWA 1GOKA 2JIWA 4MNJA 2XFYA 1DHKA 1HP4A 3ARQA 4J28A 3WDIA 5FIPA 3NSNA 3WMCA 5DFAA 2D0FA 1CECA 2VX7A 1W3HA 1XCWA 1XHGA 1R8LA 2BFGA 2VVNA 4AZIA 5M3WA 1M53A 3CZEA 1WPCA 3FAXA 3UERA 4A3HA 1TCMA 2VRJA 4D6JA 2DT1A 5E6ZA 4MB4A 1GJWA 2WMHA 2XSBA 2DT2A 1V03A 1UOKA 3M6DA 4IPLA 4PTXA 3CUGA 3OGSA 4AZCB 3VIHA 2YDQA 1XYFA 1PBGA 2NSXA 3RIKA 5AY7A 3AISA 2ZX9A 3ALGA 2IXVA 4HZ7A 2GK1B 2QPSA 1UUQA 3VDBA 2Y2WA 2VRQA 3GXFA 1WZLA 1BYDA 4CD4A 1HJVA 2VTFA 5BCAA 3BCFA 3SUSA 1D2KA 1KXTA 4HP5A 4W86A 3U7VA 3TTYA 3K1DA 4OZOA 1JDDA 3MSDA 1EXPA 2E9BA 2V3FA 1W1YA 3VD9A 1BTCA 1V02A 2JEPA 2VZUA 3ZT7A 1NWSA 2Y8KA 1B3XA 3MU7A 2ZUNA 1PIFA 2J75A 2VCAA 3NDYA 2YL8A 1W3KA 2CETA 4CCDA 1WDQA 2VOTA 3ZR5A 4PCSA 4EAMA 3FY1A 3EBVA 1W1TA 2J7GA 5M03A 5LA1A 2W62A 3WNNA 3PZVA 2VX5A 3AJ7A 3I3DA 5BROA 1H0GA 2YLAA 3NIYA 4CD7A 1ISVA 2WHJA 2BVYA 4JKKA 1GOMA 1I1WA 1EOMA 3CZKA 2VX4A 1LLOA 2X0YA 1KQZA 4Z2KA 1W9XA 5FD0A 5A94A 1UD8A 4ZE4A 4ZEPA 4B9ZA 3KL0A 3J7HA 3GZAA 1G0CA 1TA3B 6TAAA 1G5AA 2TAAA 3MUAA 1US3A 4U2ZA 4WSKA 3L4ZA 1UZ1A 3WF4A 4U31A 1E73M 4CUCA 2XVPA 1B3ZA 3VD4A 5E6YA 4C7FA 3G6MA 4B3KA 1E4MM 1JNDA 3W6MA 2ZUVA 4CD8A 5HBFA 5FL1A 1MW2A 1HNYA 2X09A 3EYPA 1TZ7A 2XIBA 5AYIA 4OIFA 4ZE5A 3PTMA 5BRPA 3W53A 4J3TA 2W91A 4OJYA 3AXHA 3VD5A 2Q8XA 4D6IA 3SCSA 3AS2A 1CTNA 2EQDA 3AS3A 1CYGA 3CHEA 3TOPA 3MANA 4GZIA 5A6BA 3IANA 1G01A 2WVSA 1MXGA 3W26A 3AS0A 1BPLB 3AYSA 1E4NA 2G8ZA 3UG5A 1OSEA 5GPRA 1NOWA 1J18A 5BXPA 3WF1A 2XIIA 4QCFA 3UG4A 5FKYA 3ZT5A 4RE2A 1VIWA 3WH5A 3KL5A 2FHBA 1UR2A 1BF2A 1IZJA 2BXZA 1R7OA 4W89A 1PZ3A 2XVGA 3TA9A 3VIPA 3A4WA 3WBEA 4BZYA 2V3GA 3DHUA 1GOOA 1EH9A 4L4PA 4PMVA 5CGMA 4H7VA 3EDFA 4AZHA 4PSRA 2QMJA 2NT0A 4ZXLA 4JHOA 1JF5A 3GBEA 2EPMX 2W5FA 3II1A 3K8LA 1B30A 4W8AA 4CD6A 1V6VA 3MUZ1 2E0PA 1W9DM 4D6HA 3VIIA 1EHNA 4PRWA 4WKHA 5GNZA 3FHAA 2O9OA 4AXNA 4UZUA 3U57A 1CEOA 2WLYA 3CMGA 1H2JA 5ABFA 2PWFA 1EHAA 1CDGA 2C8NA 3WDPP 3ZR6A 2UY4A 1UD3A 1FHDA 3VUPA 4PSPA 3WSUA 4F79A 4BQ2A 1GQLA 2XM1A 3ARZA 1FOBA 2GDVA 3SCNA 1JYVA 4URIA 1LL7A 3AZRA 3VNZA 5I5RA 4WK9A 4W8BA 1UH2A 4AW7A 3AHZA 5I23A 4J27A 3WEOA 2EPNA 1JGIA 4EK7A 2WHKA 4D6DA 2B31A 4GIAA 4EKJA 4ZENA 1ISYA 1E6NA 2WVVA 4DUWA 5DMYA 5JBDA 2IUZA 2OYMA 3AQUA 1UR8A 4MJ2A 4R5EA 3DYMA 3PZGA 5HXMA 3RO8A 5CSYA 2WZHA 1XSIA 1E3XA 3SUUA 3AFBA 3AOFA 3T09A 1O7AA 1BG4A 3TTOA 1UH3A 5A2BA 5BRQA 5ABGA 3BLPX 4MDPA 1HJWA 2WYSA 5I77A 3OZPA 4NRSA 3VM5A 3CHFA 1ZL1A 3B9EA 2WMKA 3QHOA 3EDKA 4JHZA 2D0HA 3OA5A 1XC6A 2MANA 2WHMA 2Y24A 3SUVA 3K8KA 1F4HA 2PWHA 4GPNA 2WMIA 4XUYA 1HX0A 2D20A 3BSHA 3AIQA 4HPGA 1XRVA 2VZTA 2VR5A 3CHDA 4MDOA 2CBIA 2VT0A 1ZBCA 2ESCA 3BH4A 4QAWA 4IISA 3VKKA 4D1JA 4PMRA 1VFUA 3TONA 1ODZA 1VJSA 3ARSA 1GOWA 3CUFA 4XZWA 1E0VA 2BXYA 3VU2A 3TP4A 1QNQA 3A47A 3FHQA 4XX6A 1GNXA 4AC1X 5A2AA 5HDRA 2OWXA 4JL2A 1JYNA 4CKQA 4UQDA 3THDA 4WF7A 5A8OA 2A3HA 1J10A 2CIPA 3WKZA 2F61A 2VZSA 4HMDA 3VDAA 1V0NA 1YHTA 3BMWA 4TVUA 4QDMA 1PZ2A 5BYWA 1R7AA 1IT0A 3W4RA 1LWHA 1JZ8A 4WKAA 5M5DA 1JYXA 5D8WA 3CGTA 2YOCA 4PTMA 2BS9A 2VC9A 3QHMA 3UETA 2E4TA 2WC3A 3T0DA 1B90A 3OGRA 3RM8A 1E55A 1KFWA 1B0IA 1WDSA 2HISA 1EDGA 4CGTA 4PN2A 1JZ2A 1HXJA 2VCBA 3BAYA 4JCLA 4PUDA 3L4UA 4TVDA 1Y7VA 4FF5A 3U5UA 2J25A 4V27A 4J3UA 2CITA 1QPKA 1VEPA 3MKKA 1JDCA 3IJ7A 2E3ZA 4W5UA 3RM4A 4ATDA 1UR9A 2J62A 3M07A 1KGWA 2VX6A 3N17A 3WMBA 3PZ9A 3HU7A 5JBFA 4FLOA 3PZOA 2WW5A 3NSMA 1B3WA 5HOSA 4FLRA 3F4VA 2XVNA 4B16A 2UWFA 4JKLA 4H8UA 2DIEA 3OGVA 1OGSA 3CBWA 1FP9A 2E8ZA 4BCEA 3QOMA 1PX3A 5FL0A 4PMOA 1JZ4A 1NOFA 1W3JA 2YDSA 2O9TA 3VMOA 3K46A 2DSVA 4H41A 1O6IA 3IAPA 1CNVA 5I0DA 3N11A 3DYPA 1V0MA 1QBAA 1U2YA 1W1PA 4D6CA 6CGTA 2EO7A 1AQ0A 1KXHA 3AROA 2CPUA 4J3WA 1RH9A 4Q7NA 1E6PA 2X05A 2OWWA 4FLSA 2E9MA 5D8ZA 3GNPA 2XSAA 2D22A 4CCCA 4NSBA 5A6AA 2YL9A 4PTVA 2VQTA 2BHUA 2DIJA 2WMGA 1J0YA 3B9DA 4HA1A 3VVGA 1QNSA 3VILA 4MTVA 3DC0A 4DUXA 4F9JA 3ARRA 5LYRA 3VD3A 3SCPA 1TVNA 4UFJA 2WHLA 4UOZA 4M24A 1EQPA 2DSKA 3CLWA 3AICA 3KEHA 2QHAA 4UFKA 1QI3A 2D3NA 2DH2A 2Z1KA 4M8UA 4QLKA 3WQWA 2YBUA 4UQEA 4P7NA 1DWHM 1UD4A 4XB3A 3U5YA 3WH9A 1E1FA 5AC4A 1HJSA 3PN8A 3VGFA 3F5LA 2VRKA 2C0HA 3WUBA 2CXGA 2PI6A 3L2LA 5E0FA 1CGVA 2G3NA 2GJRA 4GZEA 2WSPA 4XV0A 8A3HA 4LGXA 2IXUA 1F4AA 3OBAA 3UG3A 4CN6A 1M7XA 1KGXA 1DWIM 5CG0A 2JF7A 1J0JA 1XYZA 1VEMA 2W66A 3O6AA 4PTWA 4OBSA 3RJYA 1BYCA 1J0HA 1V08A 2DGAA 2BY1A 2FH8A 4NI3A 1L0PA 3WENA 4AZ5A 2YA2A 1E5NA 1FFQA 3LPOA 3VPLA 4AZCA 1UR4A 2QV4A 1UHVA 2QMKA 2BVTA 5C71A 3VIGA 5DO8A 4AIOA 3RM9A 3T0AA 3K8MA 4W85A 1TVPA 3T08A 1AMYA 4LYRA 2VUYA 1UD5A 3BXWA 3WNLA 1V6XA 3VOCA 3TTSA 1V3JA 1TMQA 4GXPA 1NP0A 3IJ8A 3MV11 3WF0A 1QI4A 4HPHA 1ZBKA 3ZT6A 1KR0A 2ZWYA 2WM0A 4TTGA 4ATWA 4TUFA 1CENA 4AYSA 1M01A 1FP8A 5D9NA 2GDUA 4N42A 1SR0A 4H2CA 1QBBA 1EDQA 2O9RA 2FGZA 1P6WA 3RMEA 3FN9A 3W27A 3APGA 1ISXA 2G3MA 4JFWA 4GI8A 1PPIA 2ZXAA 3ZIZA 3VMNA 2EPLX 4AY1A 3OZOA 1OBAA 3GH4A 2X8RA 1MFUA 2EPOA 1TG7A 2JE8A 2F2HA 1UKQA 1GOQA 5ECUA 4BS0A 2ZX7A 2WCAA 4E8CA 3N9KA 3A4AA 3VIFA 4AD3A 4OKDA 4WKFA 5GNYA 3L2MA 5A2CA 5HPCA 2J7EA 5I3DA 5LA0A 3WQ8A 1VRXA 1B3VA 1BQCA 3ARTA 2WC7A 4TX6A 1ITXA 1HN1A 2VZOA 1CPUA 1QHOA 5CPQA 2XVKA 2ZICA 4AD1A 2XVLA 2CHNA 5CZKA 1Q6EA 1NP2A 2JALA 3EDJA 1W3LA 2WC4A 1QNPA 2NT1A 4UFLA 1IZKA 3AIVA 2FGLA 4U3AA 3W28A 3WUFA 4C7DA 1HP5A 1GHRA 2PWEA 3D3AA 2O92A 1TFVA 4GO8A 1C8XA 4Z2GA 2XUCA 4Z2JA 1EA9C 5HNNA 3LPGA 3SEPA 2DQXA 3AMKA 5IHRA 3T0BA 3WFLA 4B3LA 1XSJA 5ABHA 4W8LA 1MWOA 1JG9A 1C8QA 5BWFA 3N13A 5I79A 1OGBA 3WD0A 3SURA 3OG2A 1UR1A 4DM2A 3CZGA 1MFVA 4PMNA 5DT7A 2XG9A 5D9MA 3RILA 3WUEA 5A6MA 5FOOA 1U30A 3S2CA 2PWGA 3ZSTA 4A4AA 3WELA 2GK1A 3PHAA 3W29A 1LF1A 1JZ3A 2WWDA 4ZXOA 1V3KA 3A6OA 3RPMA 2BY0A 2A3CA 1W9VA 4NRRA 2EEXA 8CGTA 2DPEA 4D6GA 4PMYA 1HKKA 5BXTA 1V0LA 1NWRA 2WXDM 3AHXA 4E4PA 2D0GA 4N0RA 3EDEA 3AMGA 3SCRA 4ACZB 3ARYA 2EJ1A 1U33A 2AMGA 1TR1A 1CLXA 1QNRA 1W2VA 3T2QA 1NQ6A 2V5DA 2YIHA 3WD3A 4J3VA 1KCLA 2DT3A 2FDMA 2EBNA 3SCQA 4B9YA 3OLDA 4ACYA 3BSGA 1Q6GA 2XJ7A 4TXEA 4JFTA 4OBRA 1HVXA 1PX8A 1KBKA 1FH8A 4P7LA 3BC9A 4QP0A 1LL6A 3VNYA 4JAWA 4L4OA 5A6JA 1FFRA 3RDKA 2F8QA 1OT2A 3W24A 1BFNA 2VVSA 3BLKA 1B9ZA 3ECQA 4OOUA 5AC5A 3AHVA 4OUEA 1GVYA 4GO9A 1KCKA 2VCCA 1A3HA 2GUYA 1E3ZA 2BNJA 3SUWA 4AZ6A 1QI5A 2AOSA 1N82A 3BAKA 1J0IA 4PEEA 2G3JA 2W67A 4LX4A 2WVUA 1UKOA 3PBGA 5JBEA 2W63A 2CBJA 3AZTA 4UR9A 3NSXA 2YLLA 4P8UA 1H3GA 2EPKX 3L4YA 2J8FA 3GTNA 1UA3A 2VNCA 4TX8A 3WY1A 3PZMA 4U3CA 1ZS2A 5EFDA 1C3FA 2WB5A 2XTKA 1WB0A 1GQKA 1W91A 4M82A 5A6KA 1PIGA 3VINA 4UCFA 3GXMA 3N18A 2E8YA 2ZXQA 4M81A 4ML4A 2D24A 2GSJA 1E15A 2WZIA 5A8MA 4F66A 1EO5A 3WDRA 4GQQA 1ZBVA 4JIEA 2GJPA 4P7RA 1VAHA 4DUVA 1WCGA 1UKPA 4LQ1A 4MAZA 4HZ8A 5A8QA 1CBGA 5I6SA 3UEQA 2BY2A 5CPTA 5D4YA 2JFEX 3KL3A 2Y8VA 2A3BA 3W37A 2WLZA 4KGJA 4KMQA 3UR8A 1CXEA 1HL8A 3ARVA 1JNEA 1B3YA 3I3BA 4W7WA 4D6FA 3CH9A 5IHSA 1GZJA 3CO4A 5AYBA 4HU0A 4J7RA 1XV8A 2OLHA 4GZJA 1CGYA 1ESWA 3WEMA 4PMQA 4QLJA 1AQMA 2E40A 2J7CA 2GJXA 5E9AA 4IM4A 4B15A 1BG9A 5E70A 2ZUTA 3WIJA 1V0KA 4DM1A 4UQCA 4Q22A 2W92A 1R86A 4F8XA 3SCWA 3CZ8A 4LYPA 4M80A 4E8DA 4YHEA 1V3HA 2WMJA 3AS1A 1H11A 1VENA 3EMZA 4M56A 3GXDA 4WIWA 3VGDA 1XSKA 3AIUA 5A8NA 4MB3A 5EB8A 1A47A 1V02E 3B9AA 3UESA 3BAIA 3PZIA 2WCSA 4CN1A 2RGLA 3QGVA 3ZJ6A 2D1ZA 1E0XA 1QI0A 4UTFA 1OCQA 3SCUA 2XFRA 2DSZA 1ZB5A 3L4TA 4PYSA 4U2YA 4CU7A 3NDZA 3OB8A 3CZLA 4F9DA 3QOKA 1X6LA 4DWSD 1RD6A 2FHFA 1WE5A 3AHYA 3W38A 3MO4A 3L4VA 1EIBA 1JZ7A 2W4XA 1B2YA 3ZJ8A 2WCGA 1E1EA 3ARWA 2J7FA 4FLQA 4UOQA 1K9FA 1UWTA 1WZMA 1MVYA 4AIEA 2GVYA 1M03A 3HJEA 3ALFA 5A3HA 1UWUA 4W93A 3BCDA 1HJXA 1UYQA 3IJ9A 1XGZA 1US2A 4LXFA 4BQ4A 1LL4A 1QVBA 3WD4A 3THCA 1XCXA 1S46A 4PMUA 2VI0A 4HOZA 3KZSA 2OSWA 4P7OA 3E1F1 2ZUMA 3LPFA 1C91A 2XFFA 3F5JA 1VEOA 2CERA 2OYLA 1ECEA
chains in the Genus database with same CATH superfamily
2P88A 2IKJA 3I6RA 4BWLC 1R30A 1H1YA 1QAPA 4H3DA 3UG8A 1B1YA 1JI1A 2MUCA 2VC7A 2PDIA 3WH7A 4GX8A 4MYXA 4KCVA 2QV5A 4AVNA 1H51A 1TYGA 1S1PA 2FHCA 3GUWA 1XQKA 4HSNA 3V5FA 4AD5A 1H4PA 4G6CA 3CUZA 1XC4A 1I2OA 1BRLB 2Z6IA 3CWOX 4DWSB 5A8GA 1FHLA 1PAMA 3ZQ9A 2BGQA 4XG1A 2I5QA 2P3EA 1QK0A 5AZ1A 2J27A 3U6WA 2OMAA 4DZHA 2VEFA 2O9PA 1EC7A 3BLDA 5ABTA 3LHWA 1CGXA 5D30A 4NJGA 2X1IA 4ASTA 5CC7A 1Z89A 4PBFA 2PDQA 3IK2A 1FKWA 3KOFA 1G6CA 1EGZA 1JGMA 4MJ4A 4RW5A 5LNRA 4XZHA 1FCQA 4LAKA 2FMOA 3VGEA 4RNHA 4FNUA 1VBRA 2R1KA 2OOGA 4AY8A 4S3DA 5C9WA 3DC8A 1QJWA 1K02A 1NJJA 4DXXA 3W82A 2ZX8A 5CLWA 3IJ6A 4NF7A 4TR9A 3GDBA 2PBOA 3VCCA 1XH1A 3T44A 4H8VA 3WL1A 2QCNA 4UTUA 4JNMA 3E5PA 1SYTA 5FAJA 4US5A 2YCJA 1UKTA 2PGWA 1SSDA 1XLLA 4JTSA 1RSCA 4AMCA 2VXNA 4C60A 3M0IA 1LORA 1E6SM 2NLIA 4RE3A 4GYPA 2OO6A 1Y65A 1KWKA 4HN4A 3VD7A 3OLGA 3WH8A 4C6DA 4RZ4A 1BAGA 3TDFA 2RKXA 3BSMA 4S39A 1ZRQA 3ITYA 4XAGA 2PTWA 2XWEA 4A05A 3MUIA 4DIAA 1G1YA 3ZJKA 3N3MA 4AH7A 3M0JA 3W84A 2J47A 1E9LA 3RJXA 3TYDA 4EANA 1XH0A 1RJPA 3W85A 2DT0A 1AMKA 2BB0A 1OC6A 1LWIA 2R6OA 1IXNA 2PEVA 4DJDA 4JEQA 4XZBA 2PWDA 1HJUA 8XIMA 1HKJA 1UZDA 2IQDA 3VKDA 1ZP3A 4PB3A 3B0VC 4HMCA 4ZFCA 1BHGA 1UR0A 3FX4A 1JEZA 4GD0A 1JVNA 1GCYA 1GHSA 1QDSA 1ADDA 3G8EA 2BHZA 4GVIA 3FXGA 3FJLA 1HIZA 5JIWA 4J3ZA 3N2CA 5CZ0A 3HTWA 1ML1A 3H53A 3TFXA 2PDMA 2WJZA 1UR3M 1R3YA 3NZPA 3I4EA 1IWPA 1GG1A 3BGAA 5IFPA 2BVDA 1E43A 2B81A 3EMCA 3MS8A 1XYBA 3BW3A 5I2UA 3UVAA 3G0SA 4UTWC 3H12A 4AG0A 3W7PA 2CNCA 3JZUA 3IARA 5KZ6A 4DRSA 1XYAA 1XF0A 1C93A 5EL1A 1IGSA 1OFDA 3ARXA 4DF0A 5EFFA 5F7UA 1P5BA 3ITTA 4YN5A 1LOSA 1T99A 3TTQA 4O12A 1OYAA 1OWQA 1SGJA 1YXCA 4IX2A 3UZ5A 4GI4A 8TIMA 3NVTA 3HQPA 4V2XA 2DV0A 3W1UA 1Q6FA 1E5JA 1HT6A 3KDOA 3LSBA 5FEWA 3XINA 1W9UA 3NXFA 1UQYA 5CJ5A 3GS6A 3GKAA 4NU7A 3GU9A 3G0XA 4UTTA 5LIYX 1KM1A 2Z2AA 1ZU8A 2QPXA 3MB9A 2Z1SA 3QLLA 1KKRA 5CPSA 4ZFMA 1BGGA 3H6OA 3P80A 2RGMA 4CVWA 3POCA 1A3XA 4K6AA 3O07A 3PTKA 3MJMA 4P7QA 3S42A 3W01A 3HGRA 1FA2A 1LDCA 4E2OA 3T78A 4TOQA 3LBOA 5A1AA 2JIEA 3U2OA 1VFTA 5EMMA 1OQFA 4WX2A 3TU9A 1UASA 3ZVIA 2XIJA 3H7VA 1LBLA 4PCTA 4M1RA 5C54A 5CKSA 3AXXA 1Z8AA 3UCQA 2J8GA 4LUJA 1W5NA 3UWQA 4AISA 2IPJA 3QW3A 1SQ7A 1NOUA 4FX7A 3REQB 5FF0A 1KR1A 3IUHA 5HULA 4K2SA 4MIMA 4WSJA 3ONCA 3WG6A 2PDGA 2CZDA 3EWBX 2W9MA 4EE9A 3NXLA 5FCZA 4PCFA 5FJUA 1VF8A 3BV4A 3RPTA 3W81A 1W1IE 5HJLA 1IIGA 2CEQA 2QDDA 3MV01 2F9RA 3XISA 4R7WA 1E40A 3RR1A 1QTWA 3AIBA 2VFIA 2WKGA 2Y61A 1M65A 3CQIA 1W31A 4KH2A 4I8YA 4G56A 1O1ZA 1VJZA 3PZNA 4BI7A 2VUNA 1TPUA 1L6YA 5C5YA 1LRNA 1BLIA 3BQ5A 4DX3A 1H60A 1V6YA 1CIUA 3CZJA 1VFSA 3WLQA 3QFEA 3QPEA 4AD4A 1E6ZA 3BCJA 3HGJA 3ELFA 2GUBA 3NNTA 2VD8A 3T2OA 1D3GA 1TPH1 4HZ6A 3M64A 2Y4SA 4LRTA 4QISA 1ENUA 1UH4A 3A21A 4GQRA 4LUTA 1VFMA 1QI2A 4CQDA 5B80A 3EMQA 4B5UA 2WK2A 4QLLA 3B8VA 1EFZA 9XIAA 3OVGA 4FR1A 3H2AA 3S8HA 4I6KA 7TAAA 4YTQA 2V5CA 3PY2A 2J9XA 3W7HA 3OYXA 5BXSA 3B4YA 1UD2A 1TE6A 1L9WA 3B8SA 3DHPA 3NQVA 4JYFA 5AKQA 3WK1A 4UTIA 5JMUA 1Y0EA 1UD6A 4JFSA 4W7VA 5BMWA 3GXTA 4M29A 2GWGA 4B2DA 3HPZA 1UP3A 4RNIA 4R34A 1MQQA 3HFTA 2V5BA 4BQ5A 1WKFA 4DUOA 4Z08A 4JX6A 4RK8A 4GINA 5HAOA 3CHVA 4H4IA 4D6EA 4F0MA 4QBXA 3CEUA 3GNNA 1A5UA 2R1MA 1E6QM 2J4GA 1OJXA 2YBTA 3QBUA 3WYZA 3BUVA 5XIMA 1K8YA 3VC6A 3UGVA 4DI9A 4PFMA 3NO3A 4F0HA 1QMLA 1EJTC 2WKJA 2CHOA 3PUOA 2B0MA 3LV5A 4HNTA 3AXIA 4AF0B 4UFHA 3P93A 3A24A 5CSUA 1KBBA 5DCBA 3SY5A 3UXAA 5LNWA 3GH7A 2NWSA 5C9XA 3CB3A 1ZJAA 3A23A 3BE7A 2ZZ5A 5LXXA 3HF3A 4UTKA 4EACA 1O95A 2WNWA 1G7UA 2XWDA 3JUGA 1V3IA 3CIXA 1BSIA 2NVAA 3PJUA 3LGGA 1A4LA 1QW9A 1JZ5A 2C18A 1Q8JA 3WNKA 3LERA 1VFHA 4AEFA 4UZSA 2YL5A 2VM8A 1FWAC 2WZEA 3KBSA 1F8MA 4Y96A 4CD5A 2UY2A 2X0HA 3N04A 2POTA 1GPFA 4ERIA 2FZ8A 3MUXA 4MPKA 1JXKA 1K8CA 3SZ8A 5CZSA 1E51A 3R10A 3I4KA 4J9JA 4WQ6A 4GUHA 3QMRA 2J78A 4H83A 1GVFA 3A4JA 5FJOA 3GB6A 4NG3A 4MNJA 1GWJA 4O53A 2XFYA 5LXEA 2ISSA 1DORA 1EWEA 2P8BA 3ARQA 1CB7B 2PWUA 5CPOA 2INFA 2VFGA 1IGWA 4IJRA 2PD5A 2R1NA 4C6JA 4QSFA 4B5SA 2QUMA 4AZIA 3S9YA 3LTSA 4KS0A 1KTNA 3FKKA 4A3HA 4KEZA 4D6JA 1S5NA 3HB9A 3MI6A 4MB4A 1GJWA 5DXXA 4BWLA 2DT2A 2PDNA 1V03A 4UR8A 3AC0A 4PTXA 4IPLA 1VKFA 3VIHA 2IMRA 3AISA 4KEVA 1UBSA 3LCGA 3QEZA 2QPSA 4D2JA 1OFPA 2Y2WA 3GXFA 1WZLA 3UY7A 2BLEA 4IJCA 2ZZ6A 5G2WA 5BCAA 3D6NA 1XUUA 1KXTA 3WQFA 1XIBA 4KEMA 3RLHA 4US6A 2V3FA 4IIEA 1BTCA 2JEPA 3KZPA 4DJEA 4L4MA 3C2YA 3ZT7A 1V4YA 3C0LA 4KQNA 1XLFA 1EBGA 1XS2A 1JQXA 2BOFX 5FSDC 3MBDA 4G7EA 2YL8A 1W3KA 1WDQA 2PTXA 4EAMA 5DBUA 3EX6A 3WJYA 1SO5A 1W1TA 4NAFB 2W62A 3PZVA 4QHRA 4AX6A 4LUIA 5MKGA 1KTCA 2PD9A 2Z26A 5CAKA 1H7PA 4CD7A 2WHJA 3OO2A 1GOMA 1I1WA 2A5HA 3OPSA 1RBAA 3E9AA 4M5PA 3G0UA 2VX4A 1LLOA 2X0YA 1KQZA 1W9XA 3N25A 3SRFA 1SJBA 4RNFA 2VYOA 3IJDA 3KL0A 4PH6A 3GZAA 1J79A 5EA9A 2YFOA 4KWSA 1HQTA 4U2ZA 4WSKA 3VCNA 4CUCA 3T1GA 3KLLA 3NEVA 1B3ZA 3VD4A 4LU0A 1I2QA 3NZGA 4GH1A 3W6MA 4IH3A 2CLOA 5FL1A 1HNYA 2X09A 1TZ7A 3LQLA 1YNQA 1HFBA 3PTMA 4LAOA 4YYCA 2FPTA 3SCSA 3AS2A 1F73A 2P3ZA 3NQFA 3TTEA 2EQDA 1V93A 2CU0A 3LCIA 4Z17A 3E12A 2WVSA 1BPLB 2GVLA 3AYSA 2QVNA 1Q2RA 1KBLA 1PHWA 1NOWA 1J18A 3WF1A 1RZMA 2XIIA 2YX0A 4QCFA 5FKYA 3UG4A 3N6JA 1ZAIA 3KOZA 1UR2A 4KWWA 1XBVA 1R7OA 5LSMA 8XIAA 4W89A 1PZ3A 2XVGA 3V1HA 3W1NA 3TA9A 1PWMA 3A4WA 4BZYA 4UTTC 1XW8A 3FVDA 4BF5A 1RALA 3H2CA 4H7VA 5CGMA 3R89A 2QMJA 4O1FA 4L56A 3LHZA 2INEA 4ZXLA 3GBEA 3VKJA 1E1CA 3G1YA 3II1A 3K8LA 4W8AA 2NUYA 5CG7A 1DL3A 1REQA 1DOSA 1W9DM 1I0BA 3VIIA 4GLEA 3AUJA 2REQB 3QMSA 4JIPA 2O9OA 3BG3A 2H3BA 4UZUA 1W8GA 1VS1A 2PWFA 1CDGA 4Q8UA 3ZR6A 4L61A 3TXZA 1KM0A 4J40A 1FHDA 3VUPA 3CJPA 2V67A 1GQLA 1GEHA 4IHCA 3E02A 3ARZA 1JYVA 1TPFA 1LL7A 4XAFA 3VNZA 5I5RA 3G3DA 1UH2A 1UCWA 1GZ1A 5CJMA 3S5OA 3SI9A 3UJFA 1JGIA 4ZO7A 2FVLA 3FOKA 2Y8UA 3NL5A 1ISYA 5DMYA 3BG9A 2IUZA 3AQUA 3IVUA 4MJ2A 3IRDA 4R5EA 5K4ZA 4REQB 2ZDSA 3RCMA 5HXMA 2Y63A 3NPWA 3QZEA 1GGOA 3TTOA 3LBCA 3W2JA 7ENLA 3LMZA 4HA0A 5ABGA 3N2XA 2WYSA 3R1ZA 3PJXA 3VM5A 4UTWA 2YGYA 2ZRVA 2QCDA 3PUDA 1SSGA 4XZLX 4OUIA 3G1AA 3K8KA 1F4HA 4MYAA 4GPNA 2NQJA 4A29A 1JCMP 2HSAA 4WDUA 3FSUA 4EF8A 4C6LA 2OOFA 3T81A 3HJZA 4L4LA 2ESCA 3BH4A 5HR7A 1S5VA 4IISA 4Q8MA 1QR7A 3MT1A 5AC6A 1A5KC 1PCWA 1ZQ5A 1VFUA 1V7AA 1VJSA 3MDUA 3VNIA 4XAYA 4HCLA 3BV7A 3TP4A 3A47A 2F2KA 2XIOA 4NJHA 2NXIA 3H21A 3EZ4A 1J8VA 4JY9A 1IEIA 1PCKA 4DY1A 1VHCA 5K9CA 4GMEA 2HNHA 3P6LA 3THDA 4QROA 1SJDA 4I6VA 4XIMA 4WF7A 5IDZA 2A3HA 2CIPA 1OC7A 2F61A 4HMDA 2XIMA 1FRBA 1R6WA 1CX9A 1YHTA 4M6UA 1PZ2A 4Z1YA 3E3HA 1R7AA 1WBJA 4WKAA 2C15A 1BTMA 3VKCA 4PTMA 3UETA 2E4TA 3O6CA 4JY8A 1DYSA 2Z25A 1E55A 4PN2A 3CU2A 2Y6ZA 5REQA 1YXDA 3CC1A 1IT8A 5XINA 2IW0A 3ABRA 4C6IA 3QQWA 1GKQA 3KVMA 1B57A 4V27A 4B90A 3LLDA 2CITA 1VEPA 2DFAA 3EA2A 3W22A 3LI1A 2PCQA 3RM4A 4RX0A 3DU0A 1KGWA 2VX6A 4RDWA 3PZ9A 1XLCA 4H9MA 1SFJA 3NVDA 1LT8A 4B16A 1ONRA 5I03A 1DJHA 4L6DA 1US0A 3TN4A 2OELA 1FP9A 2HV5A 2E8ZA 3NQMA 4BCEA 3QOMA 1PX3A 2PTYA 5U7SA 2QCEA 1JZ4A 1W3JA 3GHRA 4XSLA 3K46A 2DSVA 4HHPA 2FB2A 1O6IA 3EOLA 4CNNA 3PSVA 3QYSA 5I0DA 1OK6A 3TNOA 4QG9A 3MHUA 2WPBA 1W1PA 3WLJA 4JPGA 2PZ0A 4UMAA 1EJ7L 2EO7A 1KXHA 3CNYA 5AHFA 1FWBC 4QITA 1TKKA 1E6PA 4XZ9A 1ZZMA 1O94A 5A6AA 1OFQA 4Q8PA 2DIJA 1J0YA 3LY0A 1XI3A 1QNSA 4MTVA 5TBOA 3F7JA 1TVNA 2WHLA 3W1TA 1EQPA 3CLWA 3OP2A 4R9OA 3AICA 5TAOA 4K8GA 1W3NA 2D3NA 4QLKA 3KXQA 1NF7A 1W37A 1FWIC 3TJIA 3AXMA 5GJPA 3B9NA 3GE7A 3LXCA 2CLEA 1HW6A 1SU5A 1RJQA 1PXGA 3VGFA 3PBMA 3NQGA 3WUBA 2QKFA 1AH3A 5AYYA 3S6OA 3L2LA 5E0FA 1CGVA 2QUTA 3WQPA 2G3NA 2FJKA 2WSPA 7REQA 2B7PA 2V81A 1F4AA 4PEKA 4OT7A 3CO8A 4M19A 2W66A 4GQ0A 3RJYA 1J0HA 2EAWA 1NDZA 3WENA 5FF7A 4F0KA 2R9RA 3LPOA 3VPLA 2QV4A 2V30A 4I7UA 3RLUA 4IG2A 1MNSA 1GZGA 3T55A 4JYDA 4QG6A 3VIGA 5DO8A 4AIOA 5D33A 3RM9A 1A5LC 3K8MA 1TVPA 1AMYA 3WNLA 3QV9A 1V6XA 4JTEA 4GXPA 2GQ3A 1N55A 4XVEA 2WM0A 1GTHA 3BDKA 4ATWA 2NQ9A 3CV7A 4DBWA 1SZNA 3MPGA 5D9NA 4N42A 1SR0A 4Q33A 4DJFC 2G3MA 1D8CA 3IIXA 4GI8A 4JFWA 3N9RA 3ZIZA 4KT2A 1OBAA 3CEPA 1FWCC 2X8RA 3W74A 2ZADA 1UKQA 5AHIA 4OBTA 1DVJA 3P61A 3M0LA 1RHCA 4EWND 1MUCA 1GTEA 2YZRA 1DJXA 3T6CA 1WQ5A 4AD3A 4AEOA 3IIPA 2X1TA 5HMDA 5GNYA 1PHQA 2GQAA 5A2CA 3CQ0A 2AAMA 5LA0A 1B3VA 1BQCA 4NL1A 3GVVA 4TX6A 1CPUA 2NQHA 4K38A 2DUZA 1CB2A 3AXKA 1F07A 2AGKA 1NP2A 2JALA 3E96A 4XIAA 1GPWA 3QKZA 3BK0A 2PRMA 4ZB2A 3NURA 5FAGA 4UFLA 1O66A 1SW7A 4U3AA 2FGLA 4C7DA 2MNRA 3SY1A 4IIDA 3D3AA 5K7JA 3QYQA 4ZTXA 4PB4A 3SEPA 2PLJA 3T0BA 4NVTA 2YDAA 4NZ4A 4N9BA 1MWOA 3T9PA 2ON3A 1C8QA 5HK4A 3DHFA 1OGBA 1B9BA 3WD0A 1N8FA 3TQ0A 4PRTA 5D9MA 1F74A 1W17A 2FIQA 1QW7A 3S2CA 2W6RA 3TV8A 4NYYA 4ZSUA 3YPIA 1FUYA 3W29A 1V3KA 3A6OA 2A3CA 3FV9A 4NRRA 2BGSA 8CGTA 1GT8A 1P1XA 3C52A 1XX1A 1NWRA 1OF8A 2W79A 3G24A 4H9VA 3EDEA 2G96A 3AMGA 4H01A 3ARYA 2OKOA 2AMGA 4MLRA 1GK8A 3CYVA 3EXRA 2V68A 3ES7A 3WD3A 1G69A 4J3VA 5FACA 1A5OC 1K8ZA 2EGZA 1Q6GA 4RNJA 2RDUA 4ZCWA 1VLIA 2GJNA 4ZGYA 3QPYA 2BG5A 3ENLA 4NASA 1FH8A 3SGGA 4L9XA 3VNYA 1DIOA 1FFRA 1ITUA 3WLSA 3GD6A 2QR6A 3DX5A 1BXBA 1XJBA 4UR7A 1T6MA 3PULA 5AC5A 4OUEA 1HUVA 3FA3A 1KCKA 1NDVA 1A3HA 2V5KA 4UNKA 4Y9NA 3SUWA 3IS4A 1QI5A 2AOSA 4PEEA 2W67A 1IHIA 1Z9AA 3W87A 1UKOA 3PBGA 2J8TA 3I7QA 4UR9A 1VZWA 5H8MA 3TCSA 3DI0A 3L4YA 1GVOA 5AN7A 4TX8A 4E3VA 1EKOA 1XPYA 3P0XA 3M43A 3WJXA 1W91A 2VP8A 2XH4A 1RQBA 5AYZA 3VINA 1F7BA 4LALA 2CWXA 3SB0A 3W7GA 2E8YA 3CPGA 3H2MA 2PDWA 3ZZ1A 4XD5A 1MZHA 4GQQA 4LUTB 2GJPA 3C0JA 4MKVA 4MAZA 2HXTA 4PCNA 5A8QA 3ZLGA 4EPBC 3UZWA 2BY2A 5D4YA 3MJYA 3DBNA 2WLZA 3MC5A 4KMQA 3UR8A 1CXEA 1HL8A 1B3YA 1FKXA 1FQ0A 4TU1A 3A3WA 1XFBA 2CLIA 4GZJA 1ESWA 3WEMA 3SN0A 1DXIA 3G3MA 3GU1A 1AQMA 2E40A 1YPXA 1KV5A 2PSNA 1FWRA 4DYKA 2P10A 5LNUA 5F4XA 4DM1A 4UQCA 2GQ9A 4RV3A 1R86A 3VKAA 3DUGA 2GLKA 3CQHA 1V3HA 2WMJA 3EMZA 3ITXA 3GXDA 3VGDA 4NJIA 4YXGA 5CPMA 1XR2A 1TTJA 3GDKA 1HGWA 2ANUA 2D1ZA 5HATA 5M2FX 3SCUA 3RK8A 1HL2A 4NX5A 2PA6A 4MG4A 2Q01A 4RDVA 3QOKA 3GDRA 3U3HA 1X6LA 1I2NA 1IEVA 1Z3NA 4R53A 2FHFA 1QCWA 5EKYA 5HUOA 1FDYA 1UMLA 4GACA 3ZJ8A 1VPQA 2WCGA 5BRBA 3VNKA 4GY7A 1E1CB 4BKNA 5JXQA 1WZMA 4DO4A 1IEWA 4AIEA 1M03A 4LVAA 3HJEA 3JVAA 3ALFA 4XK2A 1LQ2A 3ITGA 1WAUA 5I3HA 4GHRA 1K7FA 1US2A 4LXFA 3MCMA 4BQ4A 1LL4A 4NZJA 2RAGA 4GUGA 3DG6A 3HPAA 5A5WA 4PL1A 4HOZA 1F8IA 3NPXA 4O19A 4BK9A 1C91A 1UP2A 3KLKA 1VEOA 2GGGA 2Z6JA 2OXNA 1MO0A 3E0WA 2GJXB 3GX9A 1CLVA 3KOXA 2ZE3A 4W7UA 2C0AA 1PE1A 5BXRA 1TA3A 1SZFA 1H62A 1OCBA 4INFA 1GW9A 4KW2A 4W4QA 3RRXA 4HVXA 1WA3A 3WK0A 4RE4A 1U83A 4WLCA 4UCGA 1XFCA 3W02A 1MQPA 1ITCA 2VURA 1C90A 2QJMA 2PFHA 3KWXA 1ICSA 3QSRA 4ILSA 1FWEC 3ES8A 4JKMA 1K6AA 3EOSA 4DYEA 1I2PA 4LS1A 3L4WA 1AH4A 2O7QA 2XGIA 4KESA 1FCVA 2YB1A 4BQ3A 4DN1A 5CGQA 3UW6A 1XDMA 1SMAA 1O5QA 4V28A 2NWRA 2F38A 3PB0A 4LANA 4AD0A 4LFYA 1OX4B 5ABEA 1GQJA 1KXQA 1EL3A 4Q6JA 4GZ7A 3TSMA 4JN6A 3R7MA 2QLYA 1XLAA 5AVHA 1OIFA 3FS2A 1HF6A 2WQDA 1EF2A 4LC8A 4H6EA 3OLEA 1G9HA 4B4FA 3VTRA 1I75A 3QRHA 3QH2A 3P5ZA 2OSYA 3OQEA 3W1LA 5KETA 1AZ2A 4ROQA 2NZLA 5G2HA 3GY1A 2QJHA 1DJNA 4UMBA 1KFLA 2Q09A 2J77A 4IICA 4FEZA 5CCZA 4M3PA 4GJ1A 1KBJA 3W6LA 5EBUA 2WANA 1UOZA 2OU4A 1JI2A 3UF9A 4ADSA 3W7QA 4DWSC 3MI3A 1WAWA 3SFWA 1HKIA 4QX4A 2YCLB 1ZAJA 1C29A 4NJKA 5JU6A 3D0CA 3S2LA 2OZTA 4XAZA 3EOEA 1V3MA 3S9IA 5IRPA 3QHNA 2BGNE 4JTJA 5EBAA 2AKZA 3QR3A 2YB4A 1XXXA 3ARUA 3IJLA 4NAFA 5EMUA 4JL1A 1DPMA 1GKRA 3EWDA 3QC3A 4F2BA 3W2KA 4YVVA 2J7HA 3AYRA 4HCHA 1R85A 1NWUA 1W2PA 2BV9A 3U7BA 2VDHA 1KM6A 1JCJA 2BXVA 2A85A 1YTKA 5LNSA 4IFKB 3BJTA 1DV7A 3VGGA 4LEFA 5HNUA 1C7SA 4MWAB 5M17A 1RK6A 1WZKA 5TD4A 1VIZA 5I06A 1SZGA 4KCTA 3DHDA 3CIVA 1LWJA 2EXOA 4ZR8A 5CSSA 3F4NA 5G4EA 3RMJA 1VFFA 1QK2A 2LLEA 1TTQA 3F4CA 4W5ZA 1J96A 2I9EA 4C1KA 4X0VA 3N2OA 1KA9F 3WNMA 2OYKA 3QGKC 1FCUA 2ZA1A 3NGFA 1L8PA 3HG5A 1K03A 4U28A 3GC5A 4PODA 4Q3MA 1JCLA 4NT0A 2DZVA 2DQWA 3QJAA 5HWNA 4BEQA 1UWSA 2Y7DA 4DO5A 1KFKA 4FAMA 3RX2A 4WXYA 5C9RA 2DP3A 1Q6CA 1W9BM 2P8CA 1R87A 3WDQA 4J3XA 2E9LA 4MB1A 1FCBA 3DFPA 2W61A 1C9DA 2J6XA 3K4AA 3UJSA 3K4DA 1XIFA 3S47A 3A4XA 2CWNA 1JUKA 1KFBA 1XRTA 3FNDA 1ZCOA 1FTXA 3W25A 1DQXA 2X16A 5TNVA 3OA3A 1ELSA 3CASA 5D32A 3XIMA 3APTA 5HANA 1B4KA 4A22A 4GY1A 1UWIA 1XIIA 4GKLA 4NQ1A 4NAEB 3O0KA 4OVXA 2WVVB 2OWCA 1WXZA 4HYWA 1OGGA 5T9CE 1H63A 3EWCA 3D5HA 3H22A 3ABSA 1XYMA 1X8CA 2ACSA 1Y8BA 1P6BA 2Z1WA 1C92A 3WBAA 5A69A 3MKVA 1UA7A 4WJXA 1S3HA 3N9SA 5A8PA 1XPGA 2I1OA 4JDBA 1EJWC 3W7DA 2DSUA 4UQBA 3E2VA 4Y7EA 3KW3A 3ZJ7A 2C13A 1QHZA 3V16A 2V3DA 3APYA 2X1SA 3ZOAA 3NPUA 4FA3A 1EQCA 3OLIA 1OT1A 1Q65A 1YNYA 2XN0A 4N4PA 3ARPA 5C8BB 3WEZA 3FJ4A 1Z41A 1BWLA 5CH9A 3CH0A 3B8TA 1AK5A 4JFUA 4AIBA 2FQIA 2JF6A 4JICA 3R4IA 4QNWA 1HKMA 1EO7A 2FTYA 3G1RA 6A3HA 1A80A 2YZ5A 3PANA 1R9XA 4CVUA 3REQA 4KCWA 2WOQA 4KWVA 3S2MA 2A7PA 2A3AA 4LEQA 2PC8A 1A49A 4I5RA 5JH1A 3UT0A 2G41A 3NOEA 2X1UA 4EWJA 1R3VA 3GIYA 1PEZA 3DESA 3KAOA 3W76A 5C2GA 1H7RA 4AEEA 1CXHA 3M41A 4C5ZA 1JZ6A 2POZA 2E68A 3EX4A 3FXYA 4GI9A 3MW7A 2XGBA 3A64A 5LIKX 3WNOA 1X7FA 3PWIA 3TNBA 5I3FA 5KEZA 1G94A 3O8AA 2CW6A 2ZC1A 3RLVA 1Q7QA 1MSSA 1XDLA 4EXAA 3LMYA 5KINA 5A6LA 1GOIA 3DYOA 4H19A 1K9EA 1NWTA 4BI5A 3RU6A 2YSWA 1WO2A 5LZLA 1KO0A 2UY3A 3N6QA 1B4EA 3CAVA 2GFTA 2YDRA 2WMFA 4Q7IA 1JFHA 1W1VA 3VFCA 5HMFA 4M51A 3VZYA 1RLDA 1BYAA 2BHYA 2RJHA 4MNKA 3W6YA 4J35A 1E0TA 4ZSTA 1OD0A 3TAOA 4KWUA 1XRSA 2A7NA 3W72A 1N8IA 2ZYFA 1M7PA 2WSKA 3TX9A 3U4AA 3ID7A 1E6RA 3AYVA 1H1ZA 5GNXA 1YPFA 1ZTVA 1K70A 4TQTA 4ZZ9A 1J0ZA 1YE6A 3P81A 3R5EA 4HOXA 3BO9A 2ZXBA 3FJ6A 5K9DA 1HL9A 4F0RA 4E4FA 4NILA 3V0TA 3W88A 1LQ0A 4HT3A 2XZ9A 1YQ2A 1C8YA 2WBGA 4WDXA 1XIGA 5AVNA 5BWAA 3PR2A 5A6SA 3CAQA 4M6QA 2HRWA 1AL7A 1BSLA 1M7JA 2R14A 1TPEA 1JRBA 1BF6A 3B8UA 1LJYA 2EJAA 4DJDD 4UQ9A 5I00A 3P0WA 5IBXC 3GBDA 5D9PA 3L4XA 1J9YA 5E93A 3LRLA 2ZRUA 1TJ2A 4LCSA 1JFXA 1NTHA 4Z1DA 4PMXA 2XFWA 4GOAA 5JUVA 3PTQA 2VEIA 4AD2A 2HROA 5U4NA 3BZGA 2ZX6A 3VDHA 2BBFA 1BWKA 3N1AA 1KGUA 5JIPA 4V15A 3MSGA 2VJXA 2ZZ2A 1TWWA 1O5RA 1FHVA 3VZZA 4F48A 2WKLA 2QDEA 1WKEA 3EB2A 4AXKA 1F5ZA 5HR6A 2J7BA 3GNXA 3KRSA 4MKSA 4AZGA 1UWQA 1TJRA 2Q8ZA 1H5VA 3ICJA 4HPJA 4FMVA 4WZHA 2QEZA 4R3UA 3GFYA 2E1WA 2ZA3A 5FEPA 3V4BA 4C7GA 3QF0A 2P50A 9CGTA 4UFMA 2HE5A 3P60A 1CWYA 3W7KA 4YYFA 1KFCA 3VIOA 4JTTA 2CFFA 3RUBL 3UZYA 4N4QA 4HIBA 2RFGA 4N6FA 1CXFA 3NQ6A 3L68A 4E3TA 2HE8A 4DXKA 3JU2A 3PUEA 1D7FA 1UWAA 1EB3A 3HO8A 2E5DA 5GQBA 2X7VA 1IV8A 3ZXWA 1T8XA 4QNEA 5DF0A 2C79A 4HGXA 3AIWA 5CEWA 4QE5A 3COTA 4PA8A 2IQ0A 3IIVA 3GM8A 5I24A 1RXOB 3FEMA 3W2UA 1S2CA 3TUUA 2QPUA 4IPNB 1AVAA 1Y5VA 2XDFA 1VBHA 5A6BD 3VM7A 4B5VA 3RX3A 1NVMA 5G2IA 3B0YA 1Q4NX 3OEXA 3DG3A 4UNIA 3A3HA 2DVTA 3VZXA 1DWFM 3H23A 1QPNA 1MDLA 3UR7A 3MCNA 1VCVA 1E9IA 4O57A 4K37A 4X0NA 4AHPA 4GH3A 4UOJA 2VWSA 2JIWA 5D02A 3W7JA 4NI8A 3WDIA 1J2WA 1UW9A 2FZDA 5FIPA 4JS3A 1AD1A 3RO6A 5DFAA 4G7FA 1CECA 3NQ2A 2ZC8A 2I5GA 1XCWA 5TIMA 4V1YA 1CT5A 2YYTA 5BW6A 5B7YA 3TYCA 4LAUA 1M53A 3CZEA 3HQNA 4LT9A 4LBSA 5DY2A 4ZQOA 3LM3A 3FAXA 3UERA 4WJEA 4FOKA 2VRJA 2XH0A 1AW1A 2DT1A 1KLZA 3L5MA 3OHMB 4M0XA 1UOKA 3CM4A 3CUGA 5AHEA 3SQSA 5JVLA 1XYFA 3RIKA 5AY7A 3MP4A 2AQVA 1UUQA 2VRQA 4TMBA 1G4EA 1BYDA 4CD4A 1HJVA 2VTFA 4DJFA 4JNZA 2VGGA 2NV9A 1D2KA 3RGTA 2C19A 2B4GA 4I7VA 3H4WA 4RCXA 1F05A 3TTYA 4GFIA 3M0XA 4OZOA 3G22A 3W7NA 1EXPA 1W1YA 1V02A 2YR1A 2Z2BA 1JCNA 3PBYA 5LGZA 1WUFA 1EJSC 1B3XA 1RPXA 2OT1A 3S5YA 1KM3A 2V0TA 4CCDA 4PCSA 1AH0A 4HU4A 2INZA 3P8JA 4ZQNA 1JDFA 3N2TA 5M03A 3C2VA 4F0LA 6REQA 2B7NA 5F2IA 2VX5A 3AJ7A 5BROA 3B97A 4FX6M 1H0GA 3NIYA 1XLBA 1EP3A 4JKKA 1XKYA 1M7OA 3LEPA 1UD8A 4ZEPA 1X6UA 3M0ZA 5KZMA 4B9ZA 3KTXA 1O60A 4FXRA 3J7HA 2X41A 4RR4A 1TMLA 4YJ5A 4IPIA 1TA3B 6TAAA 1G5AA 1US3A 3GSMA 4AAJA 1A5AA 3WF4A 5D2XA 4U31A 4ZOAA 1E73M 4ZB0A 4Q4SA 4R85A 3G6MA 4B3KA 4R7JA 5PTDA 1J93A 5H8PA 2XIBA 4KPLA 3QM3A 2QGYA 7ODCA 2QUVA 1IXPA 3W53A 4J3TA 3K4WA 4UB9A 3OBKA 3PJWA 2YW4A 1AFSA 2V2CA 1CYGA 3HM7A 1H7WA 2CZFA 4GZIA 5E1QA 5HWMA 5LIWX 3W26A 6PTDA 3DFTA 4UNLA 2IPGA 5H2ZA 3QR0A 3ZT5A 1X39A 4RE2A 3KL5A 2FHBA 1BF2A 1L6WA 4JTCA 4O1AA 4NY2A 5EMJA 3MQTA 1Q6OA 6XIAA 4PR4A 4E38A 3A22A 3E0IA 3R13A 3DHUA 2G3FA 5AECA 1GOOA 1EH9A 5DXYA 3DEQA 1DKWA 3DZ1A 1VH7A 2KAUC 5LHFA 4YMZA 4PMVA 2PZNA 3W2MA 4PSRA 1A5CA 4HK5A 3W7OA 3E2RA 4PZVA 3UD6A 2YBVA 2GQ8A 3L23A 1KM5A 1J4EA 1OFRA 2EPMX 2W5FA 4OE7A 1B30A 4CD6A 5EGRA 2EG6A 3NO5A 4IFRA 3IPWA 2E0PA 4D6HA 1EHNA 3I7RA 4PTNA 1CEOA 2C8NA 3WDPP 2UY4A 1UD3A 1JUBA 4PSPA 1S2UA 5AHNA 5FF3A 2GDVA 3MP5A 3AZRA 3R0KA 3UA3A 3PS7A 4WK9A 3H2EA 3EPMA 4Y8FA 4AW7A 3AHZA 5I23A 3WEOA 4EK7A 3KTSA 1T40A 4Y9PA 1OG6A 1W54A 4ZENA 3EEZA 1E6NA 2ZRYA 2WVVA 4DUWA 4NHVA 2OYMA 3NR0A 1UR8A 3DYMA 3PZGA 1EGMA 5CSYA 4YVPA 1XSIA 3SUUA 3G1VA 3CK5A 4JN8A 4M7SA 1BG4A 4F3HA 1PUDA 1UH3A 3URQA 5HJYA 5A2BA 3V1PA 4MDPA 1HJWA 4HHHA 3Q37A 4NRSA 3CHFA 2WMKA 3QHOA 1NSJA 2D0HA 2WHMA 4HU3A 4OFCA 4ADUA 2PWHA 3AAMA 2WMIA 1HX0A 2D20A 1BKSA 4GNJA 3GXPA 1T96A 2VZTA 3EOUA 3CHDA 4MDOA 2VT0A 5KMYA 2Q02A 4LSBA 5FA5A 4QAWA 1IR1A 4RE0A 3VKKA 5K2ZA 1NQKA 1V6TA 4ZA0A 1S5TA 4PE8A 4H9ZA 4E4UA 4FNPA 6ENLA 3TONA 1GOWA 4Q8WA 4HN8A 1P0BA 4S3AA 2A6LA 2BXYA 3M0VA 4JTGA 4IQJA 3FHQA 1M1BA 3I65A 4AC1X 3WLKX 3I6TA 7XIMA 5I02A 4JL2A 4QS6A 4B5WA 3RX4A 4UQDA 3DFYA 4H9TA 1J10A 1NU5A 3W3OA 5CBIA 3WKZA 1W3IA 3BMXA 1NFBA 3ABQA 2X0SA 3O1NA 5BYWA 3DENA 4DBDA 3O0FA 3BQ6A 3W4RA 3MI2A 2VC9A 2E6DA 3W7IA 2HNEA 1Q6QA 4ZO9A 3F03K 2Y7GA 2F6UA 1B0IA 4C91A 1EDGA 1AJZA 1XLHA 1YNPA 4DZ5A 4DBEA 2G5WA 3WX7A 4PUDA 5JQ9A 3L4UA 4TVDA 4FF5A 4GGHA 3U5UA 4F2UA 4DNHA 1HGYA 4N02A 1XIHA 1W6TA 4XWUA 1TZ9A 4D9PA 3OU8A 1UR9A 1POKA 2IKHA 3EXTA 4JTQA 3N17A 3WMBA 3B0PA 3PBUA 3SN4A 1VR6A 4MSSA 4FLRA 3F4VA 2UWFA 3B05A 4ZQRA 1YIXA 4JKLA 4H8UA 3A12A 1JPKA 2DIEA 3CBWA 1TV5A 5FL0A 2ATSA 2OR2A 4HB7A 2O9TA 2YCLA 3VMOA 2JK2A 3UJEA 3V0SA 3IAPA 1TIWA 3MCOA 4AU0A 6CGTA 1AQ0A 2CPUA 2OX1A 4CQ8A 1MUWA 4J3WA 1RH9A 1GVRA 2X05A 4C6CA 2E9MA 3M9YA 5D8ZA 3GNPA 2D22A 2GGHA 4XTDA 4DJDC 3CQKA 2Q71A 4UFJA 1TX0A 2EKCA 4UOZA 1RQHA 3UA4A 4HNCA 1Q66A 2OCZA 4MOZA 2Z27A 4UFKA 5DRCA 4RZBA 4L6OA 3WQWA 3T0TA 2XH2A 3LZ3A 3SECA 3N34A 4WY0A 2GUUA 1UD4A 3W71A 3WH9A 4O28A 1RY8A 1T41A 2Z4GA 4Q8NA 3HGOA 4MZYA 4MKNA 1W1B1 3R12A 2VRKA 4O17A 2C0HA 2CXGA 3L9CA 3P14A 2GJRA 4GZEA 4XV0A 2FDSA 3OBAA 4CN6A 1M7XA 1KGXA 5CG0A 1J0JA 4Q4QA 3KRUA 1XYZA 1VEMA 3F2BA 1ZP4A 4YCOA 4OBSA 1BYCA 1V08A 4HTBA 1LUCA 2BY1A 2FH8A 3Q58A 4YTUA 4AZ5A 1YBQB 1E5NA 2FZBA 1UR4A 1PV8A 1O5XA 1UHVA 4K36A 3NQDA 4LTSA 2BVTA 2GVEA 3P84A 1PSCA 1X98A 1UD5A 1XLDA 2VUYA 4LYRA 1TMQA 1NP0A 5LGXA 3MV11 1NIUA 4MUZA 3TMLA 4HPHA 1ZBKA 3ZT6A 5LIXX 2ZWYA 3FKRA 1LRQA 4UTMA 1SW0A 3C56A 4TMCA 1EX1A 2NVCA 2XISA 4H2CA 1QBBA 1EDQA 2O9RA 2FGZA 3RMEA 3LQGA 5CAHA 2QQ6A 3KVKA 3RHGA 4UWMA 5C6MA 3ZWTA 1AUSL 2PDPA 2R1PA 2X42A 3A5FA 3ITCA 3KBNA 2JE8A 4DJEC 4FIRA 4N7QA 4F2TA 1PDYA 1GOQA 1TPB1 3NM1A 5KTLA 4JEJA 2ZX7A 1KFEA 1MEWA 2WCAA 1S2WA 5H8UA 3S0CA 3UZZA 3W73A 3KS6A 1VRXA 4YS1A 2GDQA 3ARTA 1PIIA 1O1HA 2VZOA 1XLJA 5CPQA 2XVKA 2ZICA 3PG8A 1SR9A 1KRBC 3GG8A 2NQ5A 3RR4A 4UTLA 4DYJA 1OF6A 2YYUA 3AIVA 4EOUA 5FJTA 4JD4A 1XDJA 1TFVA 1C8XA 4Z2JA 2ZZ1A 3LPGA 5HNNA 3LSCA 3T8QA 2DQXA 3AMKA 4B3LA 4HNLA 3GUGA 5ABHA 4DZAA 4CNUA 1JG9A 3KWSA 5BWFA 2XN1A 4C1NB 3LA4A 1UR1A 4DM2A 2VEPA 4PMNA 2XG9A 2HS8A 2D69A 3LLFA 3THAA 3G5EA 4MFDA 2C71A 4IJBA 3AWOA 4FNSA 3ZSTA 4OV4A 2GK1A 3FLUA 3K13A 1RA5A 1EJRC 4YTTA 1SFTA 3GFXA 1KC7A 2WWDA 3E0VA 4JXCA 2EEXA 4H00A 4YL2A 3HV9A 2W3ZA 1YTEA 3E38A 3N4AA 5BXTA 1V0LA 1RR2A 4HK6A 4O50A 2WXDM 4N0RA 3SCRA 3BANA 2VEKA 3FYPA 5K9XA 3TE9A 3TJ4A 3V5CA 4E8GA 4RJEA 3RITA 1QRQA 4ECLA 1CLXA 1PTDA 3T2QA 4C90A 1D8WA 1S1RA 2C91A 2QCHA 2BODX 1RD5A 3OLDA 4GIYA 3UYCA 2VWTA 2W0UA 1P4CA 2PU0A 3VABA 4IUOA 1KBKA 1MRQA 4QP0A 4JAWA 5AOUA 2YXXA 3BWWA 3UU0A 4IGMA 1OT2A 1M5WA 3W24A 2CLLA 1B9ZA 4MZ8A 5DELA 4H8NA 4J2MA 3AHVA 4RUBA 2QJGA 4GO9A 5D2WA 2NSOA 2VCCA 1D9EA 1MUMA 3BOLA 1PS9A 1J0IA 2G3JA 4LX4A 5IM51 2IPWA 5AB3A 1P7TA 1W3TA 2PDBA 3BVJA 2W63A 1KD0A 1TSIA 1IIHA 3NSXA 3HGSA 4Q8TA 2YLLA 3TWBA 3DIPA 2PF8A 4P8UA 2EPKX 1JULA 1VLWA 2J8FA 3C4UA 4H9XA 2VNCA 5DN1A 3STCA 4ICMA 4IPPA 5I3GA 4J4KA 1F3WA 1KLYA 3R79A 2QCDB 2IQTA 3ABZA 3Q65A 3WK2A 5A6KA 3TSBA 1PIGA 4N9EA 3UYIA 3GXMA 3CYJA 3GDMA 4M81A 4HQVA 4ML4A 1E15A 2WZIA 1A4MA 4F66A 3HURA 1KM2A 2AL1A 2OZ3A 5EYWA 5CC6A 5XIAA 4JIEA 1OFEA 4DUVA 2ZVIA 3CV6A 4HZ8A 1CBGA 4TV6A 5I6SA 1UJQA 2A4AA 1IE7C 4Q8VA 1HKWA 1TO3A 3UEQA 1TV3A 3UWZA 2A3BA 4AHQA 3CT7A 4FNTA 4KGJA 1A5SA 3L67A 4W7WA 1F6YA 5IHSA 2OLHA 5G1YA 2AKMA 4QEEA 2NX9A 1P48A 4V33A 4WY0B 1D3HA 2J7CA 3ANVA 4IM4A 1LZOA 2HJPA 4XVDA 3SRDA 5E70A 4JTDA 1XBZA 4RPPA 3CZ8A 4LYPA 3EA3A 1LOQA 4E8DA 4YHEA 4M56A 4S23A 1EZWA 1UROA 4M6PA 5EB8A 1HO1A 3B9AA 1FXQA 3PZIA 2HK1A 1FDZA 4GABA 4CN1A 3STPA 1E0XA 3TQPA 1Q4WA 2XFRA 4IFOA 3FDGA 1ZB5A 4PYSA 4U2YA 4GKTA 2A79A 3QZ6A 1RBOB 3CZLA 4X22A 4MVAA 3VOJA 3W38A 2L5HA 3L4VA 1UP0A 2W4XA 1B2YA 1OX4A 2VGBA 1E1EA 3ARWA 1UJPA 2J7FA 4FLQA 1K9FA 5HWJA 1QU4A 2FZ9A 1UWTA 5K3VA 4LRSA 2DZBA 1MVYA 3M0YA 9RUBA 3UXDA 1WBHA 3WLIA 3NZRA 3HIJA 3GW3A 4NXSA 1M6JA 3TN3A 5A3HA 2PDCA 1UWUA 3EX2A 3BCDA 1UYQA 4O14A 3IJ9A 3AALA 3WD4A 3ZWSA 3TZNA 1XCXA 1S46A 4DBSA 4HYVA 3E1F1 4C6MA 2ABBA 2DZUA 3WBYA 4AQLA 3F5JA 4MM1A 1DHPA 1PB0A 3UQNA 1ECEA 1J5TA 2Q3RA 2XINA 2PLMA 5DMLA 4CU8A 4WGXA 1KWGA 5ECVA 1KB3A 3QQ0A 3W1RA 1TPVA 3O16A 4DEFA 4W88A 2PUZA 1ZCCA 3C3UA 3NA8A 1GVEA 4H8HA 1SO3A 4MJZA 1MW0A 1RPKA 4AWEA 2BSLA 3UWEA 3CUJA 1RVKA 1PZ1A 4XISA 2VGFA 4LPCA 3STEA 2BOEX 4XQ6A 3HQOA 1K77A 4R27A 3R25A 3AI0A 2ZVRA 1ADSA 2IKGA 4F40A 4XTIA 3WJZA 3H55A 5C2XA 3MSRA 3WDJA 5CC5A 2D3LA 2FMNA 3W1AA 2E7FA 2HVOA 1R2TA 4OQVA 3TOYA 4R9XA 4HCDA 1ME9A 3O6DA 2OX4A 2CKRA 3THQA 4L1WA 1PX4A 3KRZA 3R11A 4HHLA 4LJ3A 3WF2A 1PKLA 1H49A 4HNVA 4KEUA 1Q6DA 1DIDA 3VMPA 1XICA 3URNA 4O1EA 2QUNA 4LF2A 4QXIA 2QT3A 3L7RA 1LG1A 4UQAA 4MNMA 1VP5A 4WCJA 1DJGA 5G4WA 3IJQA 1DXFA 1JCTA 1O68A 5CQ1A 4HU8A 3MA8A 4PBGA 1UUMA 3FCPA 4L9ZA 2V2DA 4LAMA 1K9DA 4WDWA 1TMHA 4C5YA 3LD5A 1QOXA 1GORA 1GUVA 2JKPA 4JNYA 4AUBA 4ZBCA 3NJ3A 4QR6A 2ZWZA 2ISWA 1BGAA 1F3EA 3WLTA 4GISA 3ERPA 2D2GA 2ZUUA 3UXKA 1A5NC 4GUFA 3WO8A 4MY1A 3WD2A 4WUIA 4DPPA 3K2GA 4Y90A 3VE9A 4QE4A 4KIRA 3CPUA 1A3WA 2DZTA 3V3WA 3WBXA 3VDCA 2FPVA 4Y2WA 3NM3A 3DOPA 2PURA 1ONXA 3EWYA 3KOWA 2PAJA 1BWVA 4EF9A 3RG6A 3NCOA 3PNZA 4GC4A 3GNOA 1I6NA 3KS5A 4IGSA 4IIGA 4HOWA 1YRRA 4M1BA 2AGTA 2V6AA 2DORA 4GIEA 3NQCA 4L64A 4Z2HA 1U5JA 1WKYA 2GSEA 1FWNA 4A21A 3WUGA 4X9YA 1GQIA 2UZ9A 4WOQA 2HDJA 3LI0A 3H2FA 2VQUA 3VIKA 4IXXA 3ANYA 1VYSX 4FSAA 5AHMA 3N2BA 2ZUWA 5I7GA 2QUUA 4GUIA 5AZ0A 2OT0A 2EG7A 1NARA 4H7ZA 1N8WA 3NEHA 4GBUA 5D03A 5AC8A 1UQZA 4CCEA 2FLIA 2ISVA 1QNOA 5BZAA 4I9JA 4XKYA 3OZMA 3NWRA 3M0MA 1I8JA 4QSHA 1EOKA 4C1LA 3UWWA 4AF0A 4DNMA 4XAPA 2Q6ZA 1FDJA 1Z44A 5I3KA 1JIBA 4GVHA 3TH6A 3F5KA 1G7VA 2Y85A 2CYGA 1OIMA 2VDGA 1XIJA 1TWDA 1OYBA 4LYQA 3MMWA 3GNDA 4POCA 2TODA 4LVFA 1TUXA 3CLMA 2OEMA 4QGCA 2GSHA 4CU6A 2HXUA 1YDVA 1OCNA 1VC4A 3IGXA 4FNRA 4UIOA 3GWQA 4EIVA 4ERGA 2J7DA 4LWWA 4LY4A 1NM9A 3N15A 4A2RA 8RUCA 4PMDA 3AHTA 1J5SA 3WQVA 5FJJA 4O8RA 2OSXA 3UXLA 1OZMA 1OFBA 3PBVA 3PWAA 3HG3A 2ZZ3A 3EAUA 4Y8EA 3IIZA 3WFZA 1V6UA 2DDXA 1AQHA 4CQBA 5FEXA 2Y5SA 4YWSA 3VCRA 3MUCA 3TLQA 1X6NA 3DI1A 3RN6A 3TJXA 3AO0A 3P74A 2BY3A 2G4FA 4DJED 5LNVA 2XM2A 3WFAA 1WUEA 1MZRA 2PB1A 4H6RA 3GG7A 3QY7A 2XHYA 3VO0A 1QPQA 4XZMX 3SN1A 2CLFA 3M7SA 3ABXA 3DH7A 1WZAA 1JAKA 3POHA 3UPMA 5K4XA 3FA5A 3NQEA 2VMFA 4LS0A 4S3CA 2C1IA 3MMDA 3E74A 5G1TA 3WBWA 2KZHA 3WLRA 5I3JA 1F76A 3PSWA 2XGZA 4MADA 3ZMRA 1R3QA 4QTGA 3MWAA 2PDFA 1J0KA 2PC4A 2XYLA 3GTIA 1RCQA 3AMLA 4C6PA 3HA1A 1RVGA 4PUEA 1DWJM 3VX0A 4Z1AA 4KRTA 1J6OA 4C6EA 3SUTA 3UR2A 2J74A 3W0KA 2C7FA 3CT2A 3L66A 7PTDA 3WJWA 2VGIA 3ZVHA 2AL2B 1V6WA 4BJHA 4OOZA 4J3SA 1Z32X 3VIMA 2VFDA 5HNRA 4W9TA 3PZUA 3A13A 3KBVA 1TIMA 2VR4A 4O11A 1ISWA 3QV6A 3VE7A 3KE0A 3FA4A 1MW3A 3WCZA 3PZQA 2PDKA 2JEQA 4PUWA 2WJEA 5D2TA 1BVZA 2PS2A 2REQA 3EA1A 2AAAA 4MLJA 2PMQA 5FF4A 2VC6A 2A3EA 3L2IA 3L5LA 4P61A 1D3CA 1MYRA 2H8XA 1KTBA 3CUHA 2GGIA 3UZXA 3PZTA 1W9PA 3WNPA 4ADTA 1KW1A 1MQRA 3M46A 4B5NA 3IV3A 5MKGB 3VAVA 1JYWA 3VOGA 3G1DA 3B04A 5BU9A 3IV8A 4A6GA 2CLKA 4RZ5A 2NVDA 3WQ6A 3DFHA 1VBJA 1OB0A 4KWOA 3UZJA 2FFCA 1MW1A 2YA0A 1BQGA 2O55A 4NZCA 3GQYA 4LUSB 4BF9A 3ZM8A 1IWAA 4JOMA 1RP8A 1SFLA 2QCCA 1LUCB 5KITA 5C70A 2CLHA 4S3KA 2PRHA 1JDAA 1FH9A 3EWUA 3SCVA 4DAFA 1JL8A 1O12A 1JQVA 2ISDA 1CGTA 1M41A 4X60A 4M7TA 5A95A 2A1YA 2C14A 2JKAA 3W23A 3MHFA 4YWIA 2ACQA 3WD1A 1GVSA 1DTUA 1P43A 1ZLPA 1WX0A 2BASA 3DECA 4GYFA 4MPQA 2JGQA 3WL0A 3E0LA 4O0ZA 1KQYA 5IFTA 2B7QA 4XSMA 3E49A 1OG0A 4K7YA 4FIQA 1M04A 1Z48A 4I9MA 1DEDA 3GTHA 2YA1A 4C6NA 5H1WA 3NFUA 1E9ZB 2Y5EA 3H2OA 4NIRA 3GZ3A 3ITOA 3CS2A 2Z28A 1X1NA 4LY8A 3E2QA 3FW6A 1EGVA 1E71M 4Y6GA 4EAYA 1QWGA 2DW6A 4S1FA 1CXIA 1Q5MA 3VGBA 1TZZA 4D72A 2G0WA 3KFTA 4JQ4A 1BXNA 1PTAA 1WXJA 1VBUA 2Y7EA 3GAYA 4LV9A 1IYXA 3GVWA 4ORMA 4ACZA 2VL4A 4WD0A 5KSWA 3DXIA 3U2CA 2JQXA 1J01A 1FX6A 2BMBA 3DGRA 5BOFA 3GR4A 2GL5A 4H2HA 1PYFA 2PU1A 4HA3A 1SVDA 2E25A 1ME8A 1UBPC 2PGFA 1T8QA 3R0UA 4GIRA 1QOPA 3BTNA 2V5LA 3PBWA 3VNMA 3VOIA 2VZVA 5CXPA 2NV2A 2ZX5A 1PYMA 4DQWA 3C2RA 3NZQA 3AMCA 1ECQA 3O15A 3O9NA 4MB5A 3OW1A 3LOTA 1NH6A 2WJDA 1PKYA 4TVCA 3A3XA 3NYDA 1ZNNA 3EKLA 3LXBA 1SMDA 4LV4A 3W07A 1K7XA 3GKFA 1ZJHA 3W2LA 3SQLA 4I9AA 4UFIA 5D04C 2G95A 3IAQA 4HZMA 3TR9A 1XGEA 1B54A 2DVUA 2RUSA 3C3NA 1JRCA 3R43A 5F4WA 2WAGA 1K4HA 1EYEA 4WGHA 3LGEA 2J24A 3VOHA 7A3HA 3VC5A 1RA0A 4EVZA 2QDHA 1GW1A 3JR2A 3ZO9A 1H7NA 3I7SA 3WN6A 4DXVA 4AZBA 5D38A 2HS6A 2ZA2A 3P3BA 3H4XA 1VB9A 3SCTA 1E56A 2Y88A 4O8AA 2QGHA 2NV1A 4Y9AA 2FZNA 4AVOA 1WNOA 3GVRA 5CZTA 2D23A 2XIQA 3NOYA 3I3EA 4E0CA 5REQB 4S3GA 5DY3A 3UY8A 4AC7C 3W9ZA 4YLWA 3B8IA 3VFLA 3CAWA 3O2LA 4L1GA 3BMVA 3EKZA 4DWSA 2WV8A 3QY8A 4LS2A 1SJAA 3N4FA 1GOKA 3O6YX 4I7WA 3A5VA 1I45A 4XBJA 3NSNA 3WMCA 4BI6A 2OJPA 4IMFA 4QAIA 2G97A 3JW7A 3N4EA 1XLMA 4LUYA 3U0HA 2BFGA 2VVNA 4IGHA 4AX7A 3N29A 2I16A 1P7TB 2F84A 3G18A 1VRDA 1PTGA 2WZMA 1AD4A 1JUEA 1YDOA 2VC5A 2WMHA 2XSBA 3QR1A 1PVNA 3VK5A 3TMQA 1YXYA 1NAL1 3TW6A 4AZCB 1BRLA 1PBGA 5HMSA 4O0QA 1TJPA 3QLDA 1XBXA 2ZX9A 3ALGA 2IXVA 4HZ7A 2GK1B 2YCIX 3P5YA 3VDBA 2PRLA 2PP0A 2Y5JA 3P82A 4ZQCA 3GVGA 3SUSA 4C6KA 3ABOA 3V5OA 3LCLA 3BLFA 3IUDA 2ATMA 4HP5A 3KVJA 4PL2A 4W86A 3IUIA 4YNGA 4YU1A 3U7VA 6TIMA 1IT7A 2WNZA 2C16A 3SIZA 1TR9A 3GG0A 2E9BA 2BVWA 4K7VA 3RXZA 4I5UA 3PF3A 5E0KA 4CNSA 1F2JA 1NWSA 5DLCA 4GQBA 2BX7A 3UXIA 1TREA 2WO5A 2ZUNA 3MU7A 3Q2DA 4K3ZA 1PIFA 2DUXA 3NL2A 4DLMA 3GHSA 4BR1A 2B7OA 2QNEA 4ZVJA 3FY1A 3KCJA 3EBVA 1THFD 4Q8OA 2J7GA 5LA1A 4BHYA 3WNNA 4ZB5A 3MYOA 4QS5A 5F1VA 2YLAA 3BLEA 3PTDA 1ISVA 2BVYA 2VEMA 4IT1A 1I2RA 4Q32A 4PMJA 5E9XA 3PJTA 2FGBA 2ISFA 3TQVA 5FD0A 4H7CA 4HK7A 2F7FA 1MI3A 4S2CA 1G0CA 1TWZA 2V2HA 3L4ZA 5MHBA 1UZ1A 2PDXA 4AWSA 2AQWA 2XVPA 2ALDA 5E6YA 3BURA 2OGYA 4N9CA 4GYJA 4C7FA 4XBKA 1E4MM 1JNDA 2NQLA 3UVIA 2ZUVA 4NXKA 1MW2A 4UC5A 3EYPA 3TIMA 1GG0A 3HOJA 5AYIA 4ZE5A 5BRPA 3W1MA 2W91A 2Q8XA 4D6IA 4EXQA 3H4GA 1CTNA 2HBVA 3C8FA 4CCZA 3TOPA 2E6YA 2OODA 5GJNA 5A6BA 3VA8A 3URBA 3PWGA 3OG3A 2V9DA 1OEPA 1R3WA 3TFCA 1W5QA 1GJPA 4C6FA 2G8ZA 4FXJA 1TV2A 1ONEA 1OSEA 5GPRA 3UG5A 1EPXA 2BXZA 3MYPA 2A7RA 3SJ3A 1GOXA 1QUMA 3WMLA 4C65A 1C8VA 5HQMA 3C2OA 2V3GA 3ME3A 3SO7A 3B0UX 2H90A 3CL8A 3S6DA 1R3RA 3LRMA 3EDFA 4AZHA 1Q6RA 1X8FA 1EP1A 4R33A 5JH2A 4GQGA 2NT0A 2DZAA 4QQ3A 4JHOA 3T4CA 3HPSA 5CSRA 1X1ZA 2I9UA 1M9HA 1N2VA 5DRIA 3P8IA 1V6VA 3SSZA 1OFAA 3UR5A 3LXAA 4WKHA 1ZSXA 5GNZA 1SJCA 2J88A 4AXNA 1ZENA 4QDPA 3U57A 2WLYA 4V1XA 1H2JA 3QVQA 5ABFA 1EHAA 1SPQA 4S38A 1V7YA 4Q8QA 2QCFA 4GBDA 3WSUA 3T0CA 3LHYA 4BQ2A 3TROA 1EC9A 3NL3A 5SWUA 4QM1A 4O16A 4EPDC 3KUMA 3SCNA 4URIA 1IR2A 2E5BA 1NDWA 3EB3A 1H5YA 1S38A 3WLHA 2EPNA 2X40A 4HPNA 3V18A 4US5D