2NW0A

Crystal structure of a lysin
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
189
Chain Sequence
b'GYIVDMSKWNGSPDWDTAKGQLDLVIARVQDGSNYVDPVYKDYVAAMKARNIPFGSYAFCRFVSVEDAKVEARDFWNRGDKDSLFWVADVEVTTMSDMRAGTQAFIDELYRLGAKKVGLYVGHHKYEEFGAAQIKCDFTWIPRYGAKPAYPCDLWQYDEYGQVPGIGKCDLNRLNGDKSLDWFTGKGEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PlyB
molecule tags Hydrolase
source organism Unidentified phage
publication title The 1.6 A Crystal Structure of the Catalytic Domain of PlyB, a Bacteriophage Lysin Active Against Bacillus anthracis.
pubmed doi rcsb
total genus 71
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2006-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2nw0A00
1UKQA 5HXMA 2OYMA 5GNZA 1V0LA 4A3HA 4WSKA 3BLKA 2D0GA 1UA7A 1AQMA 3UESA 3ZJKA 3WH8A 4S3JA 4AD4A 2X8RA 3AZRA 1E4MM 3ZM8A 4UZUA 3LPFA 3W38A 4CD8A 2VZVA 2J79A 3WNLA 3GBDA 3AIQA 3VTRA 2BXZA 3W82A 1QNRA 3SUTA 1R85A 4UFJA 1JNEA 5TD4A 4A4AA 1F4HA 2EO7A 2B31A 3GNRA 3DYPA 1QNOA 4PMOA 1JZ2A 1KBKA 3VGBA 2QV4A 1H1NA 4BF7A 1CTNA 1KXVA 1LQ0A 1V3IA 5CSYA 3CZKA 2ZIDA 2JFEX 3VIHA 2DIEA 2GFTA 3PZIA 1UR2A 3W26A 2VCBA 4PCTA 1IZKA 3VIGA 1PAMA 3PZOA 2CBUA 1UQYA 2FHFA 2D2OA 2Z1SA 3ZOAA 4A3YA 1C92A 3LPGA 2XYLA 5E70A 2ZXBA 2J78A 2G41A 3B9DA 4P7RA 4DWSD 1V03A 7A3HA 1FFQA 3WIJA 2PBOA 3UR8A 3TP4A 5KZ6A 4J3SA 4X9YA 2VQUA 4PSRA 3SCUA 4IISA 3WDJA 1E6ZA 2OSXA 1X1NA 3L2LA 2ZUNA 2J74A 3MANA 3W4RA 1MW2A 3AXHA 5ABEA 3G6LA 1E1EA 1G1YA 2DT3A 2XHYA 4D6FA 2CPUA 1I1XA 5GNXA 5JIPA 2E8ZA 1XHGA 3KZSA 1LWJA 1E5NA 1XSJA 3BCFA 1CGTA 3UEQA 8CGTA 5AYIA 1UG6A 2EBNA 1CEOA 4JCMA 1EDQA 2VC9A 3UR7A 3K8LA 2WLYA 1MXDA 1W2PA 2YA1A 3I3EA 2O9TA 5FOOA 1DHKA 1J12A 3WN6A 1SR0A 1Y7VA 2JALA 4Z2LA 2XSAA 4XB3A 1BVZA 2VL4A 3EDFA 4ZE4A 3WDQA 4PMVA 2WMIA 4PTWA 2D0FA 1BGAA 3SCOA 4UQ9A 4AC1X 1GQJA 5E6YA 2V3DA 5CPTA 1PZ2A 3VGDA 1MVYA 4P7NA 4J28A 3VIJA 2BNJA 1PZ3A 2XVNA 3CZ8A 2W63A 2EPLX 4B9ZA 3VU2A 1H0GA 1LLOA 1H5VA 3WQ6A 4AWEA 1C93A 2DSWA 4V27A 4J3WA 1LG2A 2C7FA 4UTFA 3AMCA 5IHRA 5JBDA 1CDGA 3CHCA 3W27A 1MQRA 3CMJA 2WVTA 4JIEA 4Y7EA 2G3NA 3OIHA 1UKPA 2D3NA 4UFIA 2CKSA 1K9TA 4JZ5A 1ZBVA 4Z2IA 4ACZB 3CPUA 1H11A 4AZCA 1V0MA 1UD3A 3GXMA 2D22A 4TOQA 2VOTA 1FH9A 5FD0A 3RMEA 4NSBA 1V6UA 3B9AA 1FA2A 1JXKA 2VT0A 1X6LA 1B1YA 4MNJA 1TUXA 1QW8A 1JIBA 1J0YA 1XSIA 2CITA 2J75A 1UWTA 1XCXA 2YKKA 4PTMA 3W37A 4AZ6A 3D3AA 2F8QA 1V0NA 2QPUA 1DWJM 2W4XA 4AD5A 1GQLA 1NWTA 4JCLA 3VDCA 1C7SA 5BYWA 2BFGA 4HA3A 1TG7A 4BZYA 4S3KA 5I3DA 3NSXA 3WD0A 3WH9A 5BCAA 3DC0A 3PZMA 4PYSA 4CCEA 1RD6A 1GW1A 4GI8A 1OINA 4TTUA 4LX4A 1QI3A 1HJQA 4ZXOA 1KCKA 4JFUA 2DT2A 1US2A 5D8ZA 2ZX8A 2FGLA 4PUEA 1E3XA 1HX0A 1EO5A 1GHRA 3S6TA 1NWSA 2C8NA 1KBBA 1J10A 3VX0A 3WF0A 3K8KA 3EBVA 1EO7A 5EB8A 4GZIA 1MW1A 3VM5A 3SUVA 1EA9C 1A3HA 3UCQA 1BF2A 2Y5EA 3WQVA 3CH9A 1TA3A 4JFTA 1E0WA 4Z2KA 5I78A 3AS3A 3MUY1 1UHVA 5IFPA 3UG5A 1UWSA 2HVMA 4CUCA 2ZXDA 2CERA 3BH4A 3VD5A 3ARXA 1UUQA 5ABGA 5LA0A 5FIPA 1BSIA 2WXDM 1C7TA 1CLXA 3WD1A 1J0HA 1CGWA 1E1FA 2XPKA 2J7EA 5CJ5A 1JYNA 1XYFA 2ZX6A 1LWHA 1CZ1A 4AXNA 3A6OA 1LG1A 4HTYA 1RH9A 1HJSA 3WL1A 2GDVA 1V3JA 2XJ7A 4WIWA 4TVCA 1JF6A 3MSDA 5A1AA 3WMBA 3IK2A 2CIPA 1GOIA 2J47A 3N9KA 1W9PA 2DH3A 2DIJA 4AMCA 5A94A 1HIZA 1U2YA 4E8CA 1E55A 3N15A 2OYLA 2DSVA 3I3DA 3WDIA 1QW9A 4JL2A 3WL0A 1QBBA 3VIIA 2EPOA 3VMPA 3OLEA 1QI5A 3CUIA 2WANA 4GQRA 1DTUA 3WEZA 4U3CA 1MW3A 1H3GA 1E40A 2WNWA 5CGMA 2GK1B 1ISXA 1G01A 1EOKA 2FGZA 2WMHA 1RP9A 1KFWA 3CZEA 1GONA 3VDAA 3WF2A 1PIFA 1GNXA 3IAQA 2WM0A 4TX8A 3PZ9A 3TTSA 4LYQA 3L4TA 2EXOA 1ISZA 5C71A 3PZUA 4KGLA 1WKYA 4FF5A 1W3HA 1NOWA 2GSJA 3EMCA 3BAYA 3BAJA 5BRPA 2EJ1A 1WB0A 3VD4A 4J27A 3F5LA 1J0ZA 2XTKA 2J7FA 3FXYA 5DFAA 2V5CA 1CWYA 1ZJBA 4IPNB 5DO8A 3VGFA 3AISA 2ZUWA 4CVUA 3CZLA 1WPCA 4B15A 4MDOA 4ACYA 1H41A 3WNOA 1TVPA 4TVDA 1ECEA 2MANA 3T0BA 3U5UA 4J3UA 4AZBA 1SMDA 2D23A 3WF4A 5M3WA 2PBGA 3MU7A 3WMSA 5A2BA 1JZ4A 4U2ZA 2J7DA 3CTTA 3GDBA 2EPMX 2WMFA 1HL9A 3W6MA 3W29A 5AYBA 1DP0A 2XVKA 1TA3B 4TUFA 1UR1A 3GYCA 2RGMA 1NOFA 2VTFA 2BXYA 1CXIA 1FP9A 3DYMA 2RGLA 2D0HA 3KL5A 4UFKA 3NSMA 2CETA 1WZLA 1TR1A 3WNMA 5FCZA 5E0FA 1BYAA 3WKZA 2E0PA 3ALFA 1EXPA 3AOFA 1BYCA 5ABFA 3UETA 5HPOA 3OGVA 3OBAA 1W91A 1JXJA 5GQBA 1GQKA 2F2HA 1C8YA 1V3MA 4UNIA 5A8QA 4HA1A 1NARA 1CBGA 3MUZ1 2PI6A 3N1AA 3ARYA 4UQDA 1Z32X 1OT2A 2WKLA 3A4XA 4AEFA 5E0CA 1F4AA 4M82A 5I5RA 3ZT5A 2WVUA 5AC4A 3WEOA 2EQDA 1V6WA 5FKYA 1R7OA 4PMQA 1V02E 3WQ4A 3ZMRA 2G4FA 3MUAA 4UOZA 2BHZA 4HP5A 5IHSA 2BY3A 5DT7A 3O2LA 3BAIA 4UFHA 1ZBWA 1VEPA 3FN9A 1CIUA 4UQEA 1E73M 3RM4A 3RM9A 2CHOA 4W5UA 3AMKA 3IJ8A 2JF6A 3NJ3A 3FW6A 4KH2A 2WZEA 1HXJA 4F9JA 3PZGA 3OGRA 1TMQA 3QHMA 4R27A 1R86A 2A3EA 5DEZA 1NWUA 2A3AA 1PEZA 1E4LA 3SCTA 1XRVA 3GTNA 2D24A 3ARWA 1E6XM 1IZJA 3GH4A 3MSGA 4CVWA 3EDJA 5AC5A 1W1TA 4IM4A 3ARRA 3WEMA 2PWDA 2VX5A 1G5AA 3KEHA 2TAAA 1FFRA 1OIFA 1TVNA 1XCWA 3LPPA 1B90A 1CENA 1SFSA 4GI9A 1VF8A 3BXWA 1EDGA 1KXHA 1ODUA 4MJ4A 1NM9A 5BXTA 1ZU8A 1ZL1A 5BXPA 3VIPA 3WH7A 4Z2GA 4BS0A 1GOKA 2X0YA 3AYSA 2W67A 1XD0A 2ZUVA 1E4IA 2XIBA 3SCNA 3WQ5A 1GQIA 3RIKA 5DT5A 3BLPX 3BAXA 3CGTA 2WPGA 1GVIA 1W9XA 1GOQA 2ESCA 1CXFA 4RE3A 1VENA 2J62A 2J7HA 4P8UA 1W32A 4W8AA 3NYDA 1G9HA 4LPCA 1HJVA 3ARZA 3NSNA 2VVSA 2OWCA 1O7AA 2ZX9A 2J7CA 1J01A 4B3KA 3K1DA 3WF1A 2Y4SA 5FL0A 2VO5A 4F9DA 1V3KA 3AS0A 4B3LA 1MWOA 1E6NA 2J7BA 2PWGA 3VMNA 1RPKA 1W9VA 1DWIM 3W24A 5FL1A 3POHA 3CIVA 1HT6A 1QI4A 1W1YA 5A2CA 4U5KA 3IAPA 1HNYA 4PRWA 3ZJ8A 4AZIA 4PSPA 5A69A 1BFNA 2XSBA 5CXPA 3BC9A 2DSUA 3HN3A 3WDPP 1EOMA 1JNDA 5A6MA 3ARUA 1OGBA 5LA2A 1UD8A 2AAAA 1KGUA 4TX6A 3WUEA 2XM1A 5E9AA 4C7GA 1BYBA 2AMGA 3BAKA 2WC4A 1OCQA 5BXSA 4U2YA 4HU8A 3SUUA 2JE8A 3VGGA 4PMDA 1R8LA 2E9MA 1W1PA 1HJUA 1P6WA 5EFDA 2GK1A 4LGXA 2CKRA 4M80A 3CHEA 3OB8A 4PTXA 1CYGA 2CEQA 4JHOA 2CBJA 1B9ZA 2WHLA 4GQQA 7TAAA 4WK9A 1HJXA 1OB0A 4HZ6A 3VIKA 2E9LA 2W5FA 3ZO9A 1H2JA 3ZT7A 3RM8A 4C7FA 4OKDA 3PZNA 4F79A 1KQZA 5I24A 4PMRA 1GPFA 1CGYA 1ODZA 4QCEA 4EANA 1OGSA 1E4NA 4E4PA 3PHAA 1G94A 4CD7A 4WF7A 3SCPA 3VGHA 3VGEA 5E09A 3HMCA 1BQCA 2V5DA 1QOXA 1H49A 3SCRA 4HU0A 3N12A 4D72A 4V2XA 2YA2A 1ITCA 3GBEA 3RJYA 2BY0A 3VDHA 1O6IA 3WH5A 4D1IA 1W9UA 3A4WA 5DF0A 1UWRA 2BVDA 1ZS2A 1ISVA 1B0IA 2NT0A 4PMXA 5CPQA 3UG4A 2D1ZA 5LYRA 1J11A 4MB5A 5A6BD 2WB5A 4GKLA 3NDZA 2PF0A 4JL1A 1JFXA 2WC3A 3FHQA 1M7XA 3BMVA 3AIRA 3DYOA 3POCA 4MADA 3AHTA 4CCDA 4FLOA 1QVBA 3EYPA 1CPUA 1KQYA 3OGSA 1LL4A 3SCQA 2DH2A 5GNYA 2GVYA 1VFUA 3ZJ7A 3WENA 3WD3A 3G6MA 5I79A 4KWUA 4UQCA 4NI3A 3AMDA 1W2VA 1HVQA 3O6AA 1W9BM 2VQTA 2CHNA 3EDDA 5E6ZA 3TOPA 4EKJA 4GZEA 2X1IA 5KEZA 2VX4A 3EMZA 3U57A 3TTQA 4GIAA 3VINA 3CUFA 4W86A 1GZJA 2WVSA 3AI0A 3RPMA 3O9NA 2GJRA 2A3HA 4XX6A 1JD9A 2W91A 4JAWA 1GCYA 3AHVA 3IANA 2DPEA 4BQ2A 2V3GA 2OLHA 4TXEA 2J77A 5M17A 4HOXA 3WH6A 2YLLA 4HZ7A 3SEPA 4GI6A 3TTYA 4E8DA 4WLCA 3GNPA 1HKKA 1D3CA 1E0VA 3CZJA 2DSZA 1W3JA 4ATDA 2XFYA 1HKMA 3FNDA 1NWRA 3ALGA 3I3BA 4Z2HA 3CHDA 1BTCA 1OSEA 4XV0A 1KR1A 1H4PA 4MNKA 1E56A 3ZSSA 2ZUUA 3BGAA 3II1A 2DQXA 3T2OA 1VEMA 4W8BA 1XSKA 3AIWA 2W66A 1PJ9A 3VPLA 3GNOA 4HOWA 1E6SM 2IUZA 3VMOA 5A95A 1KB3A 3NIYA 3GM8A 2QMKA 1QHZA 5HOSA 2EPNA 1JYWA 1KWGA 4MAZA 4V28A 4NZCA 1E70M 1V6XA 1SYTA 1UR0A 3AIBA 2X09A 2NW0A 4WJXA 2E40A 3QGVA 3PTMA 4W88A 4CGTA 1C8XA 3VOCA 3AQUA 3PZTA 4W89A 1AQHA 2WWCA 4AZ5A 4ZENA 3KE0A 4H8UA 4F8XA 1WDRA 3KL3A 1M03A 5D4YA 6TAAA 1J0IA 1TCMA 2YBTA 1H09A 4HPHA 3WUBA 2V38A 2YBUA 4W93A 1J18A 5GPRA 4QLJA 1EQPA 2YL5A 1GHSA 3GXIA 2ZWZA 2WBKA 2E8YA 4ML4A 5D9MA 1UD5A 1VAHA 3AZTA 1W3LA 3ZR6A 4AD3A 1PBGA 1JZ7A 4YPJA 1FP8A 1K9DA 2WAGA 4PMZA 4U31A 1B3ZA 4MTVA 1FHLA 1XD1A 2GJPA 1E6RA 4H04A 2VZUA 3OA5A 1V3HA 1E0XA 4FLSA 1BLIA 1JFHA 1WP6A 4AZGA 4OBRA 1UR9A 3N18A 2QLYA 4ZE5A 4AD0A 3RCNA 1PX4A 2BS9A 3ZJ6A 5HDRA 4CD6A 1UD2A 4PBGA 2W61A 3N11A 1QI0A 2ZX5A 5BROA 1J0KA 1PPIA 4X0VA 1NP0A 1QHPA 2X0HA 1LL6A 4OBSA 1WDQA 3SUWA 3A3HA 1CGXA 6CGTA 1MW0A 1ZJAA 4QDMA 2J8GA 3ARPA 4KRUA 1WDSA 1QNQA 1FOBA 2F61A 1TE1A 1E3ZA 1BG9A 3CBWA 3CUJA 7CGTA 1J9YA 4U3AA 2E3ZA 4N42A 3W25A 2J25A 1CXEA 2QMJA 2G3MA 4PTVA 1CGUA 3AMGA 4LYRA 5DMYA 1VBRA 3WY1A 4MB1A 1V3LA 3GH5A 3EDKA 1HKIA 3MS8A 4NRSA 2WHJA 3L4XA 1JF5A 2OSWA 1V6VA 3U7BA 1R87A 4W7WA 3VD9A 5JIWA 2UWFA 1Q6GA 2E9BA 1DWGM 3WNNA 4OOUA 4UQBA 4M24A 4UFLA 3BMWA 5LA1A 2GJXB 1PX8A 2VVNA 3K4DA 4QLLA 2X05A 3VM7A 3CUHA 3OZPA 1MQQA 2BY1A 3AYRA 4DWSA 2ZOXA 1ESWA 4LXFA 2XUCA 3AHZA 1OD8A 2C0HA 5A6JA 4GO8A 2Y8VA 3M07A 1L8NA 2PC8A 1C91A 1WE5A 4YHEA 1AMYA 1BHGA 3TONA 5D9PA 5I2UA 1D2KA 3K8MA 1YHTA 2VI0A 2X2YA 3VILA 2CXGA 4H8HA 4HMEA 4AISA 3A47A 2XGBA 4AIOA 4D6CA 1E9LA 3WNPA 1EH9A 4P8XA 2VZSA 2O9OA 1AVAA 4OZOA 1FH7A 4MB3A 5D9OA 3ARSA 3AJ7A 1VJZA 4RL3A 1HVXA 1HKJA 5A2AA 2W92A 4ATWA 2PWEA 4CU8A 3SIMA 4HPGA 1VB9A 2XWEA 2VJXA 2ZE0A 3WNKA 2A3CA 3S2CA 2JIEA 4XZWA 1EQCA 1UWIA 4D6EA 3VX1A 3MUIA 2XGIA 3OZOA 5JBEA 1IT0A 2Y8KA 3MV01 4W8LA 3FY1A 1V0KA 4W84A 3VNYA 4W7VA 4D71A 2VRJA 3FAWA 1JDAA 1QPKA 3M46A 5D8WA 2WKGA 1FH8A 3ARVA 4M56A 1E6PA 4NF7A 1UA3A 2VR5A 4CCCA 1DWFM 3CMGA 1B3VA 1IV8A 3MV11 3NUKA 4PMNA 5M5DA 4L4OA 3VDBA 1R7AA 4DUWA 4AIUA 1US3A 2DGAA 4GZJA 5A8MA 1JAKA 1SMAA 1UKSA 3AS2A 3KL0A 3VNZA 1B3YA 3L4ZA 1E72M 1VFFA 4GINA 1UOKA 1NP2A 1J0JA 4ZXLA 3L4WA 2VCAA 3K4AA 4ATLA 4UCFA 1UR8A 1Q6CA 2WSPA 1WCGA 1C3FA 5ABFB 2GUYA 1GOWA 3QR3A 4C7DA 3M6DA 2YJQA 3DHPA 3CUGA 4QLKA 4XZBA 2BV9A 2A3BA 2JEQA 3N04A 4ZFMA 3W81A 1B30A 1D7FA 2XWDA 3SURA 2J8FA 1JZ5A 2WSKA 4UZSA 1VJSA 1M04A 2YLAA 1MXGA 3OLGA 4DM2A 5ABHA 3VIFA 4E2OA 2G3IA 3WQ8A 1JDCA 1K6AA 4H7VA 1C8QA 1N82A 2OWXA 3B9EA 2XFFA 2UY5A 1CXLA 2ZUSA 2O9RA 3WQWA 3NDYA 3N17A 1DEDA 2UY2A 1GORA 2WLZA 1TZ7A 4JKKA 1Q4NX 3PZVA 2VRQA 5CLWA 4MB4A 1UD6A 1BAGA 1JI1A 1HF6A 3THCA 2FDMA 1WO2A 3L2MA 4H41A 1UYQA 4H8VA 5IDIA 1JZ6A 2WHKA 3W6LA 4Z2JA 1Q6FA 1CXHA 1XH1A 4J3TA 1MFUA 1VFOA 1KXQA 3RDKA 4CU6A 4D6IA 4L4PA 4X0NA 4EAMA 4AIEA 2WCAA 2BHYA 2YDRA 3K46A 3LMYA 1XH2A 4WKFA 4BA0A 4JFVA 5A6BA 4NRRA 2GDUA 3ZIZA 2V3FA 1W9DM 5CLTA 4IPLA 4AD1A 5I77A 4YHGA 3SCVA 4R5EA 4QFUA 4KGJA 2VX6A 1OBAA 4Q22A 1MYRA 3BAWA 4M1RA 4P7OA 4QP0A 2UY3A 6A3HA 4PEEA 3ZR5A 4P8VA 2IXVA 3U7VA 4UFMA 2QF8A 4CN4A 1HP4A 4KRTA 3PN8A 3AS1A 2NSXA 2CESA 4IUGA 4HZ8A 3SUSA 3AMLA 1E5JA 1GJUA 2FH8A 4AY1A 3EMQA 1QNPA 2VUYA 1JDDA 2WMJA 1W1VA 5IXEA 5A3HA 4CN6A 3VO0A 3ZSTA 1KR0A 1MQPA 2YL8A 1JD7A 2EEXA 1JZ3A 1ZBKA 4OUEA 5BXRA 2Q8XA 3FAXA 1WNOA 3NCOA 4XUYA 1V6YA 1UWQA 3U5YA 3E1F1 2W62A 3MKKA 3L4YA 1E6QM 3SCSA 3WELA 1AQ0A 1KGXA 1HN1A 3CHFA 2CCRA 2WW5A 2O9PA 4F66A 5C70A 8A3HA 3GZAA 3ECQA 3VIMA 3WDRA 3TTOA 5HNNA 1UH2A 2ZWYA 1HP5A 4LQ1A 4U5IA 1FHDA 1BVNP 3WBEA 5EBAA 1CGVA 1U30A 1UH4A 1H0IA 1EIBA 1UH3A 2BVTA 3A4AA 4D6DA 4CN1A 4AD2A 4P7LA 2YA0A 3QOMA 3CZGA 3PTQA 3WMCA 2CBIA 1E43A 2ZX7A 1KCLA 5D9NA 2IXUA 1JYXA 1K9EA 1PX3A 2ZICA 2D20A 4DWSC 5A8OA 3WD4A 2VCCA 4JKLA 3AHYA 1KWKA 4TVUA 2CBVA 4ACZA 3APGA 4UOQA 3T0DA 3N13A 1DWAM 3W28A 5CGTA 5BRQA 1UZ4A 4CU7A 1GOMA 2VX7A 3T0AA 1QNSA 1HJWA 2WMKA 1ISWA 1K9FA 4OOZA 4AEEA 1NOUA 1GVYA 2YDQA 1TFVA 3AHXA 3T2QA 4YN5A 2J7GA 1E15A 3AFBA 2JF7A 4Q7NA 3WD2A 1Q6EA 3THDA 2VR4A 2EPKX 3F5KA 3IJ9A 5C8BB 1JGIA 1BYDA 4FLQA 5CZKA 2WMIB 4WSJA 1LF1A 4PUDA 2WBGA 4BQ5A 2G3JA 4WKHA 3LPOA 1CNVA 1UKOA 3MMWA 1EDTA 2D3LA 1Q6DA 3VKKA 3AROA 4GPNA 3T09A 3WF3A 2VNCA 4AZCB 4BQ4A 3VUPA 5CSUA 3B8SA 2XG9A 4DM1A 4DWSB 1L0PA 5A6SA 1EHNA 2WK2A 1WZKA 1JL8A 2XM2A 3J7HA 4RE4A 1DWHM 4AZ7A 5I0DA 2GJXA 1E71M 2AOSA 3TA9A 2J4GA 4MDPA 4H2CA 4UOJA 2OYKA 2BY2A 1GOOA 1ZB5A 3FHAA 4JHZA 2DT0A 4W5ZA 1WZMA 4KMQA 5A6KA 1VEOA 1U33A 3WFLA 1UD4A 2QHAA 3PBGA 3MMDA 1VFMA 2WMGA 1OT1A 3RJXA 3UERA 4JFWA 3AIEA 5CQ1A 1VBUA 1JYVA 4BCEA 1BG4A 1QI2A 2V3EA 1OGGA 4WKAA 1GUVA 1YQ2A 3AIVA 4QCFA 2ZUMA 3QHNA 4GO9A 3VIOA 3DECA 3JUGA 1HL8A 1CXKA 4D6JA 2XVGA 3PZQA 3WDHA 4FK9A 4BQ3A 5HPCA 4PN2A 1JAEA 4ZEPA 3ARTA 4CD5A 4P7QA 4CD4A 5CG0A 2PB1A 4AYSA 3T08A 2VURA 4W7UA 4JFSA 2WYSA 1B3WA 3CLWA 4GXPA 2VMFA 2YDSA 2JIWA 1PIGA 1JI2A 1S46A 5JBFA 3D5HA 3PTKA 4DUXA 2Z1KA 1QBAA 3WSUA 3VD7A 1OM0A 2DEPA 4MNMA 2CYGA 2O92A 3ZQ9A 2UY4A 3AIUA 1MFVA 2JEPA 4MJ2A 3SCWA 1QHOA 5A6LA 2FHCA 4B16A 2BVYA 1ISYA 3OLIA 4UQAA 3AXIA 1XV8A 4TTGA 2VZOA 2WCSA 4HOZA 5EMYA 3WBAA 1M53A 2E4TA 1ITXA 1NQ6A 1VRXA 5ECUA 1XC6A 4PCSA 1C90A 1WZAA 2XFRA 1VIWA 1A47A 1OWQA 4K68A 2WC7A 4M81A 3QOKA 1BGGA 3RO8A 1X6NA 4N0RA 3T2PA 4MAVA 3W0KA 3EDEA 4PMUA 4FMVA 3VVGA 3MMUA 3AICA 1JG9A 4B9YA 1NH6A 3F4VA 2WZHA 1LJYA 4J7RA 4D6HA 3L4UA 1V02A 3M7SA 4HMCA 1XGZA 3VD3A 3DHUA 5CPSA 5A8PA 2G8ZA 3ZT6A 3BCDA 1V08A 4P8WA 2YL6A 3HJEA 4RE2A 2ZUTA 3UG3A 4CKQA 1UKTA 4OJYA 2DSKA 2ZXQA 2WVVA 1XH0A 4W87A 3WFZA 3W53A 3OG2A 2YIHA 1UZ1A 1ZBCA 1UWUA 4M8UA 1B3XA 5HBFA 1OD0A 4QAWA 1XYZA 1CLVA 2DDXA 4W85A 5I6SA 3CO4A 3QHOA 5A6AA 2Y24A 4OIFA 1I75A 2BHUA 4AW7A 3BSHA 1CECA 5I23A 2YOCA 2HISA 2WHMA 3WUGA 4J3VA 2Y2WA 5IFTA 4URIA 3RILA 3OLDA 4LYPA 4D1JA 2NT1A 3HU7A 4U33A 4MNLA 1WDPA 2ZXAA 1RP8A 4J3XA 1KGWA 1UQZA 3WUFA 3ARQA 1EGZA 1W3KA 4M29A 5AY7A 3AXXA 2FHBA 2WCGA 1LL7A 4EK7A 1I1WA 3F5JA 5M03A 2PWHA 1KXTA 1EHAA 4JKMA 4EE9A 1G0CA 2WZIA 3GXDA 3MO4A 4D6GA 4AZHA 3BSGA 5F7UA 5EFFA 2QPSA 2YL9A 2XIIA 1BPLB 4MPKA 4HA4A 2OSYA 2DT1A 4DUVA 4PMYA 4HMDA 1WAWA 5BWFA 3GH7A 2XVPA 2CNCA 1GJWA 2WVVB 3KWXA 4UR9A 1M01A 3IJ7A 1UR4A 4FLRA 1JZ8A 5JUVA 2VRKA 2XVLA 3GXFA 2PWFA 1OIMA 2VZTA 9CGTA 3AZSA 5A8NA 1B2YA 3L4VA 2FH6A 2OWWA 1B31A 2WWDA
chains in the Genus database with same CATH superfamily
3W86A 2CXEA 4I3GA 2OYMA 1VBHA 4BI6A 4HVXA 3WBYA 3THAA 3S8HA 6TIMA 2D0GA 1LM1A 3W1TA 3H70A 3W7RA 4QBXA 3WH8A 4AD4A 1EFZA 2OX1A 4NNAA 3ZM8A 1FWWA 1GOXA 1G4EA 3DOPA 4CD8A 3GBDA 3VTRA 3WLLA 3DG3A 2BXZA 1R85A 5FAJA 2Y7FA 1KBKA 2E5BA 4PUWA 4BF7A 5CSYA 4YVVA 1Q5MA 1W5QA 4JOMA 1WUFA 1QK2A 3PZIA 4IGSA 1IZKA 3VIGA 1RK6A 1Z44A 3PZOA 4XWUA 2CBUA 2D2OA 3ZOAA 2VC6A 3G22A 3LPGA 2XYLA 3QTPA 3BDKA 5E70A 4CQAA 4IPIA 3UR8A 4NUWA 3TP4A 4CCZA 4J3SA 3OYZA 5FF0A 4IISA 4N6EA 4DAFA 2J74A 3MANA 3W4RA 2CZFA 4R7WA 3P74A 1G1YA 5D2VA 2DT3A 2VDIA 3HPXA 4IJCA 1Z69A 1K7XA 3GC5A 5G4WA 2E8ZA 3P82A 1EJVC 5AYIA 2ACUA 1T8QA 1EGMA 4JY8A 1GQNA 3K8LA 1MXDA 1W2PA 2O9TA 3VCNA 1SR0A 1Y7VA 3WK3A 2X7VA 5IM51 3N2CA 4ZQMA 3WDQA 4PR4A 4PTWA 5LXXA 3RLHA 3DERA 1LT7A 1A53A 1GQJA 2EKGA 3MI2A 1NF7A 3VGDA 2JGYA 4PRRA 2BNJA 3FYYA 2XVNA 4HGXA 4H6QA 4QNEA 4PZVA 2ISWA 2W0UA 2OO0A 1C93A 5IHRA 3U6WA 2YXGA 1KFEA 1MQRA 3HBLA 4JIEA 4QE4A 3HG5A 5BRBA 3M5XA 1H63A 4XD4A 4JZ5A 3RGTA 1V0MA 4I7VA 3GXMA 3DN5A 1FH9A 1F2JA 1SZFA 5FD0A 4FHAA 5I3GA 3IIXA 2XGZA 1LDCA 1V6UA 3CT7A 1IXQA 1XGDA 3M0IA 4QE1A 5RUBA 2CITA 4IP5A 2BOGX 2OR2A 3GR8A 2VD8A 2YKKA 4PTMA 2ZYFA 3E0FA 1V0NA 1GQLA 4IL2A 1NWTA 1M9HA 3VDCA 1SUXA 2BFGA 3LLFA 2ZTJA 1TG7A 4S3KA 3NSXA 3S9ZA 1LRNA 3PZMA 4M5PA 2NQ9A 2PDKA 4ZXOA 3ZLHA 3R89A 3G77A 2FGLA 4PUEA 3IWPA 4C6CA 4G7EA 1HX0A 3L21A 4RCXA 1NWSA 3WLRA 1HGYA 1YLVA 3EBVA 3QQ0A 3DXIA 3DKJA 5FF4A 3C0SA 1MW1A 2E09A 1A3HA 1X1ZA 3NVDA 1POKA 2Q6ZA 3W7CA 5BOOA 1OZMA 3B4UA 1UHVA 1P5BA 4FNTA 4H1ZA 5IFPA 2WJFA 3UG5A 4RDVA 1UWSA 4H6RA 2HVMA 2XISA 3PF3A 3H21A 3O7UA 4CUCA 2ZXDA 1F7BA 3WX7A 1DXFA 4IT1A 3I68A 1E9ZB 3VD5A 1BSIA 1CLXA 3ANYA 2DVUA 1CGWA 1YBQB 4ZA0A 1RJPA 4AXNA 1RH9A 3G1XA 1HJSA 2GDVA 4LB3A 1KLZA 4E38A 4TVCA 1AMKA 5A1AA 3IK2A 4QEHA 3N2MA 4O4WA 4MZ8A 1Z9AA 4AMCA 2DIJA 2HMCA 4PUJA 3R2GA 2QVNA 1HIZA 4BF5A 2OYLA 3AYVA 4L65A 4RZ5A 2DSVA 1ZFJA 2I5IA 3WDIA 3BZJA 1TPVA 4LH8A 2RH9A 3ABXA 3WL0A 3F2CA 4K8EA 3VFCA 3UWZA 3OLEA 4ICCX 3LYEA 1PKLA 4IPPA 5CEWA 2TODA 5HWMA 1S5TA 2NLYA 4H6EA 3O63A 1G01A 5FJTA 2WMHA 3E3HA 1GTHA 1KFWA 1XKYA 2G37A 1T41A 2Q8ZA 1GNXA 3IAQA 4GHRA 4KS0A 4LYQA 3N19B 5CKSA 4MY8A 3L12A 2IPJA 4PUKA 4FF5A 1NOWA 4GC4A 2GSJA 2QJJA 3BAJA 1WUEA 5JMUA 2GUUA 3C0LA 3VD4A 2OVLA 3F5LA 1J0ZA 1LQ2A 2J7FA 3FXYA 3EOSA 2VEKA 3VGFA 3WCZA 9XIMA 4OE7A 5CH9A 5F1VA 5BU9A 1OHLA 3NL2A 1H41A 2EF9A 5G1MA 1ECEA 4MWAE 1S2AA 3THQA 3G0SA 1IXOA 5DN1A 3C2RA 5H2ZA 4AZBA 3RU6A 3NM3A 5M3WA 3MU7A 4GIYA 4U2ZA 1KM4A 1FWIC 1IEXA 3TN5A 4TUFA 2CZEA 2RGMA 2VTFA 5AVHA 5A8GA 4DO4A 2RGLA 3FJNA 3KL5A 4UFKA 4JTCA 4O16A 4F4RA 4GCAA 4UMBA 3UYCA 3ALFA 1BYCA 3ANUA 3UETA 3OBAA 1VCVA 2H9AB 2F2HA 2A1YA 1R9YA 1DBTA 4JTLA 3VDGA 6PTDA 3B9NA 3GU1A 1A3WA 4R34A 1NARA 1O66A 3F1QA 3ARYA 2HK1A 4Y9NA 5C0QA 3QPZA 2CLHA 1OT2A 1V7AA 5E0CA 4ZOBA 5I5RA 3ZT5A 2VFEA 2G3FA 2EQDA 1R7OA 3PPFA 3PNUA 1D3GA 1DPMA 4FF7A 4UOZA 1MEWA 3B8DA 2BY3A 3UF9A 1SFTA 3DFYA 2QUUA 3WLPA 4C6LA 2CZVA 1VEPA 4O4VA 4MSSA 2FB3A 2ZBTA 2QJMA 3RM9A 3AMKA 5AVNA 4KH2A 4G7EB 3UQNA 3TAKA 3TZNA 3QHMA 3IEBA 2WOQA 5F4WA 3W7DA 3LHUA 3EA3A 2A3AA 3S5OA 1L9WA 3SCTA 3AWNA 3SBFA 3GTNA 2D24A 2VP8A 4HA0A 3I6EA 3MSGA 4PUNA 3EDJA 4WD0A 3MBDA 4IM4A 3ARRA 1DE5A 4DI9A 2OLSA 3H2FA 1OIFA 4GY0A 3MC5A 2EHHA 3GVVA 3CXOA 3BXWA 1KM1A 4WOQA 1KXHA 1ODUA 2QKFA 5AKQA 4C5YA 2XIQA 1O5RA 4Z2GA 4AH7A 4BS0A 2WV8A 4C1NB 1FCUA 3W7EA 3SCNA 2PAJA 1KRAC 4MJMA 1XLBA 2WPGA 3TMLA 1T5AA 2ESCA 1CXFA 4RE3A 1VENA 4PMJA 2J7HA 4YTUA 4W8AA 3NYDA 1A49A 2VVSA 2V6AA 4EWJA 4DBWA 2PLCA 1Q85A 4X2RA 3WQOA 2ZX9A 2J7CA 3UR2A 3WF1A 1V3KA 1FVPA 4QTGA 3HA1A 2J7BA 4A8RA 4AG0A 4NQ1A 4PFMA 4IFKB 1W9VA 3B97A 3PWAA 4JTRA 1K03A 2D2GA 3NQGA 1HT6A 3ABQA 1K6WA 4U5KA 5EMMA 3UJRA 1J96A 3N3MA 2OQYA 2QCMA 5A69A 3HV9A 2P88A 4GQBA 2DSUA 2DZAA 4DBUA 5A6MA 3PWIA 4FPSA 1TPWA 3ARUA 1JVNA 3QH2A 2AAAA 4H00A 3CC1A 4TX6A 2AMGA 4NZFA 4PODA 3BJSA 2GQ9A 2E1DA 1L6WA 4S3DA 1DJXA 4XZNX 2FGBA 2R9RA 4JYFA 5BXSA 4LVDA 1RV8A 5I09A 4LGXA 5G4EA 1AW2A 2BX7A 4JX6A 3BL3A 1BWVA 2VR2A 2OQLA 3Q58A 1YNQA 2YX0A 3W1QA 2CEQA 3M0XA 4O1BA 3G18A 4RV3A 4DWDA 4JTIA 3MHUA 4PCPA 4WK9A 1HJXA 1OB0A 1TV4A 3ZT7A 1LLWA 5I24A 3GB6A 4QCEA 1IR1A 8TIMA 3GFYA 2YYUA 4E4PA 3PHAA 1G94A 3P6LA 4GGBA 3LNPA 1E0UA 1SO6A 3O06A 4JTGA 4Y6GA 1Q4WA 4HCLA 3NOYA 3OP2A 1QOXA 3RO6A 4IL0A 4UR7A 1H49A 3SCRA 1R2SA 1PXGA 4HU0A 1Q2RA 1YIXA 4O28A 4EAYA 1GW9A 3VDHA 1O6IA 3WH5A 3FYOA 4XZIA 3EWWA 3B8UA 3HQNA 3C52A 1KM2A 1B0IA 4WY0B 1KW1A 2QT3A 2A7RA 5CPQA 4NYYA 3QSTA 4LAKA 5E93A 1AJ2A 3MJMA 3TH6A 5LYRA 2WB5A 3DYOA 3POCA 4CCDA 1QVBA 3EYPA 1CPUA 3QY7A 4JTDA 1LL4A 1SQ7A 5GNYA 1VFUA 3G1AA 4NI3A 3CEPA 1HVQA 1I6NA 1XIMA 3O6AA 2FVLA 1GK8A 1SZEA 2CHNA 1WX0A 3TOPA 4GZEA 5KETA 3U57A 3TTQA 1W31A 1R3YA 1UP0A 4F2TA 3UWEA 4W86A 2WVSA 3RPMA 3SJNA 2W91A 3GYEA 1P7TB 2DPEA 3T44A 4ZQPA 2V3GA 3Q67A 1LCOA 2YCLB 2J77A 3PULA 3H4XA 2BXVA 1K4GA 3SEPA 4LBSA 1P43A 4WLCA 1R3VA 1D3CA 2DFAA 3LBCA 3GO2A 1E0VA 2DSZA 4ATDA 4MF4A 3PSVA 3ALGA 1EGVA 1XP3A 1BTCA 1OSEA 4DF0A 1KR1A 5DY3A 3UPBA 1E56A 3IGHX 3FVDA 2WQPA 3DBNA 3R1ZA 3OHIA 4B5SA 3T2OA 3QY8A 3B04A 1LORA 1XSKA 2W66A 5FSDC 1PJ9A 3ICJA 3GNOA 2E68A 2DW6A 4A22A 1KB3A 5A95A 3ZYZA 2QMKA 3WLNA 4GOAA 3L0KA 4V28A 1ZQ5A 1UR0A 3AIBA 2X09A 3TN6A 2NW0A 4IZGA 3E2VA 1JRCA 4Q4RA 3BO9A 4W88A 1PWLA 2J24A 3VOCA 2X30A 3PZTA 3BVJA 5XIMA 2P5NA 4FS9A 3KE0A 4H8UA 4LJ3A 2PP3A 3LQGA 3KL3A 1NY1A 4DI8A 3HOJA 1VLIA 3TNBA 1J0IA 1TCMA 4G1NA 3WUBA 3TW7A 2YBUA 4W93A 4GACA 1KM0A 1GGOA 2V30A 3WYZA 3GW3A 3WQEA 3NPVA 4PGLA 1JULA 2X7WA 2PDUA 4YYCA 5D9MA 1KFCA 2RDUA 1VJIA 1W3LA 4EIVA 2E6FA 4AD3A 3RLVA 1JZ7A 4MTVA 4V1XA 4YTQA 2DZUA 4H04A 3LX9A 3E0IA 2V5JA 3SJ3A 4NJKA 2YCIX 5C6MA 5AC6A 3GAYA 2C14A 1J5TA 1UR9A 3N18A 3ITGA 3W2MA 1AG1O 4NJHA 4QS6A 3RCNA 3MCNA 4NXSA 3ZJ6A 5HDRA 2R1LA 4K8GA 4CD6A 1PUDA 2R91A 2GQ3A 3UR5A 1ZPTA 4DXKA 3WLIA 3CHVA 1XDJA 4NL1A 1J0KA 1TRIA 3R0UA 1RVKA 1YTDA 4QRNA 4YL2A 1QHPA 1U5HA 4GCXA 4OBSA 1SJDA 3C3UA 2GL5A 1MW0A 1S2UA 3LV5A 4LBRA 3L0NA 5D02A 1DOSA 3VYLA 4BI7A 1XRSA 1MZRA 2YGYA 1NDYA 3EX1A 3AWOA 5JXQA 1PDZA 1SJAA 3H7RA 2V5BA 5DMYA 3B8IA 2ZDRA 4MB1A 1V3LA 4DVOA 1HKIA 3L4XA 2XN0A 3MWCA 3VD9A 3LK6A 2UWFA 5HUPA 4ICMA 3WNNA 4XKYA 3BMWA 5DCBA 2VVNA 3K4DA 2X05A 4YWSA 3V1PA 1G69A 3CUHA 4NNCA 1A0DA 1W1IE 4LXFA 2PP0A 4QJ1A 2PZ0A 1OD8A 4LB4A 4GO8A 1C91A 1GEHA 4J3ZA 4GYFA 1BHGA 2AMXA 3W2LA 5FEWA 3VE7A 1YRRA 3VILA 5BOFA 2CXGA 4M1BA 4H8HA 4GBDA 4AISA 1TKKA 5AHEA 4HPJA 2VENA 4AIOA 1L6FA 2PWVA 3V0UA 3WNPA 4EXQA 3M41A 5FESA 4P8XA 2VZSA 3W02A 4K2SA 5K4XA 3KS6A 3LGEA 2GQ8A 3GTHA 1HKJA 4QG6A 3FA5A 2W92A 5EMUA 6XIAA 1OFRA 1WYIA 5F2LA 3B3DA 1AD1A 2XWEA 3H6OA 3DG7A 3SQSA 4NJJA 3W7OA 1ZUAX 3WNKA 3K30A 2A3CA 4OGZA 5A5WA 2JIEA 1EQCA 5JBEA 1M3UA 3LHVA 4Z1CA 4GJJA 4W7VA 2C0AA 1KV5A 1EJSC 1Y5XA 1K7EA 1I0DA 3OVRA 4NF7A 4AVNA 2NLIA 1R47A 1DWFM 3CMGA 3RN6A 1RY0A 2V81A 5LNSA 1IV8A 3O6DA 3NUKA 4FNSA 4L4OA 2O55A 1RLCL 4DUWA 4AIUA 1US3A 5A8MA 5HWJA 4JTTA 3URNA 1E72M 4GINA 3FGCB 3P67A 3KDOA 3W72A 1UR8A 4C6DA 5LIXX 1EP3A 2GUYA 3R12A 2HPIA 2P0IA 2IW0A 3M6DA 3WLJA 4FNPA 3W22A 4LAOA 1K8YA 2JEQA 3N04A 3W81A 3F4CA 3HO8A 2D69A 1WA3A 3FCPA 1OZQA 3N25A 3BUVA 2J8FA 3IJIA 4K3ZA 2DZXA 3OLGA 4DM2A 5ABHA 4FX8A 3CQKA 1TV8A 1TV3A 3DHDA 2NUXA 4XD6A 1AJZA 2NQHA 4H7VA 1N82A 5DY2A 3QTGA 4Y2WA 5G2HA 4Z1AA 3TXZA 3QV8A 2UY5A 1JCXA 4QDPA 2FDSA 2ZUSA 4KW2A 1I9CB 1FDYA 2WLZA 2VRQA 1K8CA 5C7VA 3QC0A 3THCA 1ADDA 5U4NA 1UYQA 5IDIA 4GFSA 2F6KA 3EAUA 1SM9A 5DRIA 1XH1A 2D2HA 1QOPA 4XO6A 2GWNA 2V68A 1VFOA 3RDKA 2QJHA 4RDZA 4AIEA 3KTXA 1A5KC 1NDZA 3K46A 2C1HA 4A3QA 4BA0A 4JFVA 5A6BA 2CC0A 2GDUA 2P8BA 2PDNA 1YPFA 2F9RA 3O07A 3M0MA 1WOBA 4L6DA 4XBJA 4MUZA 1VZWA 4R5EA 2VDGA 2EKCA 4QDWA 4ADTA 4O1FA 3PBYA 1OBAA 4Q22A 1HGWA 3BAWA 4P7OA 2UY3A 3ZR5A 4P8VA 2IXVA 1XIEA 4MOZA 2QF8A 1HP4A 3MI6A 5LIYX 3AS1A 1F6KA 2NSXA 2CESA 4HZ8A 4JTFA 1BTMA 1E5JA 1GJUA 3E0WA 4AY1A 1RPXA 3U48A 1QNPA 1IQ8A 1JDDA 2XN2A 3RX4A 1W1VA 3LZ3A 4DPPA 3DX5A 5C9WA 3LHWA 4H8NA 3FYPA 1ZBKA 5BXRA 2Q8XA 3U2ZA 1VGAA 3NCOA 3Q2DA 3CO8A 5F4SA 7ENLA 1CX9A 2W62A 3KVJA 3WELA 1AQ0A 1KGXA 3G1SA 1HN1A 4I5UA 1EJXC 4F66A 1XX1A 3FIGA 1U5VA 4B4FA 4Z17A 1HP5A 3DGBA 1XLMA 3L67A 4H9TA 4F2BA 1TR9A 1CGVA 1H0IA 3S1UA 4V15A 5CZTA 4Q4SA 1OK6A 4CN1A 4LUTA 4AD2A 2R1NA 3M64A 3SRFA 3WMCA 3LZ5A 4JTKA 5D9NA 2IXUA 1PX3A 2YCJA 2ZICA 4DWSC 5A8OA 3WD4A 2VCCA 3AHYA 2DZWA 1SFJA 3APGA 3N13A 1DWAM 3GS6A 1UZ4A 3F4NA 2VX7A 1QNSA 1HJWA 4IQDA 3A22A 1ISWA 4H01A 3MBFA 4AEEA 2PC4A 3S6DA 4ZSTA 1VC4A 3AHXA 3T55A 3EXTA 3T2QA 4YN5A 4IGNA 3PJTA 4P5UA 3R8HA 3RAOA 3TN4A 4Q7NA 3BURA 1GG1A 3BJFA 3OZYA 3EA1A 3MWAA 2EPKX 4XIAA 3F5KA 3E5PA 2QQ6A 5FJUA 1BYDA 4FLQA 5CZKA 4WSJA 4PUDA 4BQ5A 4WKHA 1UKOA 4JY9A 5DLCA 3AROA 1UR3M 3BOFA 2PRLA 3HPZA 4AZCB 2QZRA 1PZ1A 4C6KA 1YPIA 3GHUA 1YNPA 5BMWA 1L0PA 3TQPA 4M19A 1EHNA 2WK2A 1WZKA 1JL8A 2VEIA 2OZTA 1CB7B 3O1NA 1DWHM 4AZ7A 1RA0A 2GJXA 1E71M 2AOSA 2OYKA 4M51A 1KV8A 1GOOA 3S5NA 4LUSA 1OJXA 1Q13A 1QO2A 1UD4A 2QHAA 5HINA 1OT1A 2XH7A 3P84A 7REQA 3AIEA 1MNZA 5CQ1A 3GK0A 3PPHA 4FX7A 3QY6A 4LBUA 2OJPA 4JS3A 1IE7C 1NIUA 1HO1A 3W2KA 2G95A 2V3EA 1OGGA 1AZ1A 4A8IA 2C71A 1EBGA 3AIVA 3QHNA 4GO9A 1ICQA 1RVGA 3JUGA 3PUEA 4C6MA 1K8ZA 3LRLA 4WDXA 5CC6A 3N73A 4P7QA 1W8SA 4W7UA 1UMLA 2E5CA 2VMFA 3WBWA 1BXNA 1EC8A 2Q3RA 5FAGA 2EG6A 1ECQA 2VEPA 3IS4A 5JBFA 3D5HA 1UP3A 1Z48A 4KF1A 3BW2A 2CYGA 2O92A 2QYGA 2BGQA 5ENLA 4KPLA 3AIUA 1MFVA 4K38A 2JEPA 5CPLA 2FHCA 4LWWA 2BVYA 3PP7A 4QIUA 2PPGA 4CNUA 1Q45A 4UB9A 4BF9A 3NQVA 3S1XA 3LA4A 3USBA 1M53A 3IV3A 1ITXA 5ECUA 4B90A 5C9XA 2YXXA 2XFRA 1OWQA 5LGZA 5C2XA 2WC7A 1P0DA 5BU6A 4RZ6A 3PM6A 1BGGA 4N7QA 1X6NA 3T2PA 4K39A 3N4AA 4OVXA 3VVGA 4FMVA 3FGCA 2PMQA 3U9IA 1A3XA 2AL2A 3FJ4A 3F4VA 1LOSA 5I00A 2WZHA 2AL1A 3LY0A 1LJYA 3QQWA 1HUVA 1RAKA 2DW7A 4PE8A 5T9BG 3W7GA 4RNJA 2QULA 3L4UA 1A5CA 3U8GA 4IQJA 2A85A 4RV8A 1BSLA 1VFHA 1S2TA 4K1GA 4M6UA 1XDMA 3ZT6A 2YPIA 4P8WA 2YL6A 5MKGA 1I4NA 2HBVA 1UKTA 4L5ZA 2A6LA 1JEZA 5C9ZA 2WVVA 1XH0A 3WFZA 2PODA 3W53A 1FWAC 2YIHA 1VP5A 1RALA 3TYZA 1Y8BA 4NP7A 4Q4OA 5M2FX 2AGTA 2DDXA 3CO4A 3QHOA 5A6AA 1YDOA 1CECA 4H7ZA 3WUGA 4URIA 3OLDA 4D1JA 3QKZA 4MNLA 2ZZ2A 5CSSA 1KBLA 4JIPA 2Y6ZA 2I17A 2F38A 5HA7A 5J04A 1IWAA 3HPSA 5M03A 2HBXA 2PWHA 4XG1A 2EGZA 3O3RA 1G0CA 4AZHA 1JUKA 3PBMA 4FXSA 2ZADA 1N8IA 3Q65A 5F7UA 1ALDA 2NXGA 2B4GA 4OUIA 4HA4A 4LCSA 1ZNNA 4IP4A 4DZHA 1E9IA 2FIQA 1XYMA 4RXFA 4HMDA 1WAWA 3R8GA 1XYAA 1RBLA 2REQA 3GH7A 5HNTA 2XVPA 3E12A 4QXIA 4JDYA 5HMSA 2HS6A 5JUVA 3MVTA 1W5MA 3GXFA 5XIAA 4UMAA 1V93A 3AAMA 4Q33A 3G0XA 1BXCA 1UKQA 2BGSA 3EX2A 3W2UA 3W3OA 2J27A 4QJ5B 4WSKA 1UA7A 3BSMA 2X8RA 2YFOA 1E4MM 1LT8A 2X40A 2J79A 1D8WA 3SN0A 2QDEA 3SUTA 2DIKA 4LYKA 4A4AA 1F4HA 2EO7A 3HMJG 3DYPA 1QNOA 3OOQA 4PMOA 3E0LA 3T0TA 3NO1A 1KXVA 1V3IA 3CZKA 3UJFA 2INEA 1POJA 5HMFA 2VCBA 2Z7GA 1UQYA 2FHFA 2Z1SA 3TXVA 4R53A 1ELSA 1C92A 3EWYA 1U1JA 4PC8A 4IMCA 1M7OA 3RF9A 3SY1A 1S5NA 2ZXBA 3UNTA 2G41A 1LOLA 4P7RA 3KRSA 4DWSD 1A5MC 4DNHA 2GSHA 1FFQA 3HFTA 3WIJA 4ADUA 5KZ6A 3H2OA 1S38A 3IVUA 3GG0A 2FZNA 4B5WA 4JTUA 1MW2A 5AHMA 5ABEA 4MWAD 3G6LA 4IQEA 3B8WA 1UMYA 3EB4A 3BLEA 3BLIA 4K7YA 5H8PA 5GNXA 5JIPA 3L2IA 3KZSA 2ZZ3A 3BCFA 3GNNA 4LEQA 4MJZA 1DXIA 3NG3A 2EBNA 4JCMA 4IJRA 3VA8A 3OTRA 2C1IA 3DUGA 4NJGA 4N6FA 4GVHA 4ZMGA 4XZ9A 3AALA 4KCVA 5FOOA 1J12A 4DHGA 5AC8A 4RE0A 1KCXA 4IIBA 4Z2LA 1XICA 3WLQA 1R3QA 3GSMA 4XB3A 1BVZA 1V6TA 3QYQA 3EDFA 4ZE4A 3WLMA 3H2CA 3SCOA 1R2RA 4AC1X 4MHBA 3K2GA 1MEHA 1XYLA 5CPTA 2XFWA 1A4MA 3VIJA 1PZ3A 1LBMA 3CZ8A 4GUIA 4ML9A 3WQ6A 4AWEA 4EOUA 2DSWA 4J3WA 5FI8A 2C7FA 2PLKA 3DH7A 1REQB 1CDGA 3CHCA 3CMJA 2PTZA 3GZ3A 3QXBA 3CLMA 4UFIA 3O8AA 1ZBVA 4Z2IA 3GR4A 3K1GA 3KVKA 4OWGA 1M7JA 3OJGA 2VOTA 3DFTA 3IJLA 1DORA 3LERA 2H8ZA 4FOJA 1FKWA 3B9AA 1FA2A 1X6LA 3TK7A 4MNJA 1TUXA 1QW8A 1WXYA 1G67A 1F8MA 1XLAA 4WHBA 1J0YA 4IIEA 5GJNA 4UTIA 1UWTA 1XCXA 1IGSA 3BCJA 3W37A 3L7RA 4AZ6A 1JPIA 1FWFC 2QPUA 4PUUA 3C2FA 4C6QA 4WY0F 4HA3A 3IRSA 1TWSA 3Q45A 5EL1A 2X1RA 4GYPC 5BCAA 2R14A 4GI8A 4TMBA 4TTUA 2EAWA 4RLIA 3RR1A 2DT2A 4DZAA 2E6DA 4NAEA 3EOEA 3FEQA 5T26A 2BODX 1E3XA 1EO5A 1GHRA 2I5GA 3O6CA 5EB8A 4DNMA 5TF0A 3WQCA 2GGGA 4V1YA 1HKVA 1VBGA 4LUTB 2PDMA 3WQVA 3VNLA 3CH9A 1TA3A 4IMEA 5I78A 3AS3A 3OQ8A 4LV9A 3SFWA 2OZ8A 3G1RA 3IPWA 2Z28A 2Z27A 2DZBA 5CGQA 2B81A 4S23A 3BH4A 5ABGA 5K3VA 5D2TA 2OB3A 1VHCA 1PKNA 2A21A 4IWWA 1E1CB 1JYNA 2DUZA 1VHNA 5FJJA 2C15A 2XH2A 4XD5A 3U2EA 1RXOB 1OK4A 2A4AA 4B5XA 4MUPA 1RCOB 1OYBA 3IGXA 1T96A 3G3MA 5DMMA 3WMBA 4GVIA 6ENLA 3PVFA 2J47A 1GOIA 4AEOA 4C6FA 3H55A 2NV9A 5A94A 1EP1A 4S1FA 4UWMA 3CQJA 1GKQA 1L6GA 1Z3NA 3QRHA 1L8PA 2EPOA 2P3ZA 2V63A 3VK5A 3PK7A 4GQRA 4L61A 2ZRVA 1IT8A 1H3GA 3MJYA 2QIWA 2WNWA 5CGMA 4XAYA 5EPDA 3RITA 1ISXA 3WJZA 3ITVA 4LS0A 4KETA 1EXBA 3CZEA 1GONA 2HDJA 1HW6A 3Q37A 3SZ8A 2EXOA 5AZ0A 3V5FA 1WKYA 4L1WA 3LUTA 1IEVA 3EMCA 3BAYA 3QLLA 5H8MA 2EJ1A 2TSYA 1VCGA 5DFAA 1QR7A 1PO9A 4IPNB 1TZ9A 2ZUWA 2BSLA 3PBWA 1Q65A 3RUBL 5D04C 4QS5A 1GKPA 4ACYA 4TVDA 3ZVIA 4Q4QA 4O18A 1OFEA 3W7QA 3T0BA 3E38A 3U5UA 3KCOA 4U4MA 2PBGA 2J88A 4M3PA 2OKTA 3WMSA 4AB4A 5A2BA 1JZ4A 4CQBA 4EWND 3CTTA 4M6VA 2CLEA 3W29A 5AYBA 3UD6A 3LHZA 4ICNA 1UR1A 3IACA 3R25A 3S6OA 1CXIA 4FEZA 1FP9A 5PTDA 1K3UA 3NSMA 2CETA 1WZLA 5FEZA 5FCZA 2VGBA 1BKSA 1BYAA 3TC6A 3GVGA 5HJXA 2E0PA 3UPWA 3LTPA 5ABFA 2PU0A 4MWAA 1W91A 5GQBA 3ZWSA 3GHTA 4EF8A 3W23A 1KCZA 3INPA 3H54A 1AQFA 5HANA 3G1DA 1ZALA 3LXAA 1K7FA 2PI6A 1IZCA 3N1AA 3RRXA 3LU2A 4CQ8A 1I60A 3C2OA 3OEXA 2WKLA 1QO5A 3UCDA 4B2DA 4Q8WA 4L80A 1LRQA 3GC2A 5FKYA 3NZRA 1V02E 3HGRA 4QE5A 1NFPA 1U83A 3KCJA 3ZMRA 2G4FA 2VC5A 1FWJC 5IHSA 3PJWA 2FJUB 5DT7A 3DKLA 1WKFA 3L68A 1ZBWA 3FN9A 4UQEA 1EPVA 2A79A 1FXPA 2CHOA 4W5UA 2JF6A 1HXJA 3MKVA 3HZ3A 3OGRA 1SFLA 4R27A 1QWKA 2POZA 3HPFA 1CLKA 3UA4A 3DFSA 3UCCA 3V36A 3SO7A 1EPXA 3LDVA 1YXCA 3WQDA 3R5EA 2XN1A 3ARWA 1E6XM 4WSHA 4GRSA 4AVOA 4U28A 2F2KA 4DBDA 4DJFA 4XD3A 1V79A 4X63A 3A24A 1OG6A 1W1B1 3QMSA 2PWDA 1LUCB 2VX5A 2I14A 3S0CA 3LPPA 2QAPA 1SFSA 3MA8A 1EUNA 3MPGA 1VF8A 1XBYA 2OG9A 4JQ3A 1KA9F 4REQB 5EY5A 5BXPA 3WH7A 3VOHA 2QF7A 4XZHA 4XIMA 2HRWA 2XIJA 3AYSA 2W67A 3MUCA 1XD0A 3HJZA 3OQEA 2AGKA 2NVCA 4JEQA 1GQIA 3IIOA 5DT5A 5DBTA 3CGTA 1GVIA 4OQVA 4ZB2A 1W9XA 5D38A 3CAWA 4HBKA 1SR9A 2POTA 3ARZA 4LPCA 1PDYA 4HK6A 2RDWA 5AHNA 1O7AA 2W6RA 1BKHA 3TROA 4HSHA 3K1DA 5D32A 1W3IA 1FWSA 2AQOA 4F9DA 4FALA 2RJHA 3GVWA 1MMFA 2C1GA 2PWGA 3I10A 1FTXA 2R8WA 3FEMA 3GVQA 5FL1A 2DUAA 1QI4A 5G5IA 1MXSA 1W1YA 4C65A 1US0A 1VIZA 4O50A 2QUNA 3HN3A 2NX3A 3WDPP 2Z1VA 3I7QA 1GZ1A 1M6JA 3H8AA 1UD8A 5AHLA 3E49A 3R6IA 4O10A 4R7OA 4C6OA 5D2XA 5CBJA 2Z7KA 5FEXA 4MLJA 3RFAA 3TQKA 3HFYA 2NV2A 4DJED 1R0MA 3PS7A 2JE8A 4PMDA 2E9MA 1W17A 3P61A 1HJUA 1LROA 2GK1A 3TLQA 3UZWA 2CKRA 3S9IA 4M80A 3HGOA 4K36A 3OB8A 3WK1A 1CYGA 3VZXA 4I6KA 3EWDA 3DI1A 1PE1A 1B9ZA 3E2RA 7REQB 1LP6A 4Q8TA 4DQWA 7TAAA 3ABRA 3KCLA 2W5FA 3IGUA 1OFDA 1WXJA 3PZNA 5CZ0A 3GQYA 1GYLA 4C6NA 5FACA 3W7PA 4O54A 2QGYA 3O0FA 1KFJA 3SCPA 2PDJA 3VGHA 5E09A 3R4IA 2DVXA 2ANUA 3S4TA 2FFIA 3S47A 1MRAA 4J1OA 1U5JA 4UMCA 1TTPA 3W01A 4V2XA 2YA2A 3GBEA 1ZP3A 4I9AA 3A4WA 5DF0A 5JVLA 4MG4A 3MMTA 1TJ0A 5H1WA 3C0QA 2YSWA 1YADA 2NT0A 4BWLC 3UG4A 2D1ZA 4ZO9A 5FF3A 3AXMA 3NO5A 3PUDA 4IPJA 4JL1A 3F4DA 1TPUA 1JFXA 4MADA 3AHTA 3NM1A 3B8TA 1NFGA 2G97A 2I7GA 1XLEA 1KQYA 4FIRA 4OT7A 5I02A 2RDTA 3OBEA 1I45A 4C6PA 3G6MA 3VKJA 1QU4A 3AMDA 2DP3A 3OW1A 4XQ6A 4HJWA 4N9DA 4ORIA 2FZBA 1VR6A 1GZJA 1XF0A 2FJKA 3APYA 2GJRA 2A3HA 2YW4A 4XAFA 4JAWA 1VYPX 1ZZMA 3AHVA 3IANA 3LGDA 1WV2A 2OEMA 2OLHA 4FR1A 4HOXA 3IARA 4L9XA 1YYAA 3PC0A 3U0HA 2YLLA 4E8DA 3JRKA 2CLKA 3GNPA 1B57A 4LNCA 2E28A 2XU2A 5C7HA 1Q2SA 3CPRA 3CHDA 4J40A 3H53A 4ORMA 2VFHA 3EWZA 4MNKA 4KEMA 3ZSSA 3BGAA 4QNWA 2A7NA 3LNMA 2JQXA 3AIWA 4HZMA 4W8BA 4QG9A 2E67A 1T6MA 3SRKA 3SN1A 4C91A 3VMOA 3L66A 2SFPA 1UBPC 5HOSA 4PCNA 2EPNA 2IQ0A 3UXIA 4JNMA 4GLEA 2YBVA 1KWGA 4P2VA 3VC5A 2YZ5A 4WY0A 1Q6LA 4W9TA 4NYUA 1V6XA 1QAPA 3V18A 3OVQA 1MO0A 3WK2A 3QGVA 3MP4A 3PTMA 4F2UA 1P0KA 5B80A 4CGTA 4M7SA 2Z25A 3AQUA 4W89A 1AQHA 4Y90A 4F8XA 3TFCA 1DQUA 1R6WA 1OFQA 3EKGA 1J18A 3WJWA 3P0XA 1EQPA 4OV9A 2YL5A 1GHSA 3T07A 4GC3A 1RY8A 2J13A 2ATSA 1VAHA 2BB0A 3AZTA 1SZRA 2O7QA 2WAGA 4Q8QA 1UASA 4DYEA 1MEIA 2OELA 2PGFA 2VZUA 1CT5A 4I9JA 3OA5A 4C60A 1E0XA 1TJPA 4RK8A 4FLSA 1BLIA 1JFHA 3UWUA 4OBRA 5CJMA 3N6QA 4CNNA 3TV8A 3S5YA 4IIHA 4JNZA 4Q8NA 1UD2A 4FA3A 3TTEA 1I0BA 3N11A 3ONBA 3KLLA 1TMHA 1VKFA 4X0VA 3S2LA 2X0HA 4LC8A 1XL9A 1P4CA 1YE6A 3W1LA 3V16A 1IEIA 1ZJAA 3ZXWA 1VD6A 4KRUA 4GUHA 1WDSA 1QNQA 2VDHA 1UP2A 4RJEA 3LMZA 4AF0B 1E3ZA 1BG9A 2I57A 4JIHA 4XTIA 3EA2A 3CBWA 2PDWA 4FSAA 2E1WA 7CGTA 3FJLA 1JPMA 4NT0A 1CXEA 5A6TC 2QMJA 2W3ZA 4REQA 2G3MA 4KCUA 4XK2A 3QF0A 1RJRA 3AMGA 3W07A 1SJCA 4HHPA 1XLFA 3A64A 5HUOA 3K5XA 4D2JA 1LUCA 1V6VA 3U7BA 2QJGA 4PTDA 3NOEA 2E9BA 1QMLA 2Z2AA 4OOUA 1DJNA 4O13A 5LA1A 1X1OA 2GJXB 4QLLA 5EYWA 4DBSA 3SRHA 4DWSA 3CASA 1ESWA 3B06A 3D47A 3AHZA 4HYRA 4JTQA 5K2ZA 4ZB0A 1L8NA 2PC8A 4ZTYA 1TE6A 4YHEA 1AMYA 2VGFA 5I2UA 1DJWA 3K8MA 2VI0A 1GWJA 4GUGA 2EPHA 3GY1A 2C91A 3A47A 2NWSA 4D6CA 1E9LA 2BBFA 3LCHA 1EH9A 3TW9A 3TEVA 3DEQA 1AVAA 1J5SA 2H8XA 1RUSA 1FH7A 3WLHA 2B7PA 4MB3A 3RXZA 5D9OA 3ARSA 4Q8PA 2XH0A 4O1DA 3DU0A 2QNEA 4RL3A 5A2AA 4ATWA 4AYGA 4JQ2A 3SIMA 2QDDA 3BOXA 4OU1A 2VJXA 2I9EA 3I6RA 2X0SA 4RNHA 3UWYA 4A35A 2IKHA 1QPNA 3S2CA 1QOQA 2VYOA 3REQA 3KBJA 1JPHA 3BMXA 4C5ZA 3MUIA 2WZMA 2Y8KA 1TWZA 4IUOA 3FY1A 4O8RA 1V0KA 3WQGA 1JDAA 1QPKA 1U1UA 1OX5A 1AW5A 4FP1A 3TUUA 2VR5A 4CCCA 1T8XA 3R13A 2ZA3A 3DFPA 2OKOA 1CB2A 3W7IA 3JZUA 3TE9A 3EOLA 5M5DA 4WOZA 2CU0A 2RAGA 3H24A 1UKSA 1UROA 1B3YA 1FWHC 5IRPA 3L4ZA 1O68A 5LHFA 4KCTA 3N4EA 4C1LA 4ZXLA 3KOFA 1KD0A 2Z1XA 1Q6CA 4UTLA 1TWIA 4TQTA 2F7FA 3CUGA 4XZBA 3GR7A 5AZ1A 3M7WA 4IXHA 3B8VA 1L6YA 1EYWA 3ABSA 1B9BA 1EZ2A 3QGKC 4QITA 3TLLA 5TIMA 1JPDX 2WSKA 1VJSA 1M04A 4KEZA 1O12A 3VIFA 3G1VA 3UY8A 3TX9A 1JDCA 1A5SA 1HZYA 4S3GA 4L6HA 1R3SA 1UBSA 3QSRA 4YMZA 4DN1A 3GHRA 5KZEA 2XFFA 3EKLA 1GORA 1TZ7A 3C2VA 4UTMA 4HHMA 2CW6A 2VEFA 1V7YA 5FA5A 1CW2A 2IPWA 2FDMA 1WO2A 3T8QA 4US6A 4H8VA 1IR2A 5G4HC 1JZ6A 1BRLB 3L23A 3FKRA 2WHKA 3W6LA 1XFBA 1Q6FA 4O15A 1EJ7L 3FOKA 3ZLGA 1MFUA 3TNOA 4CU6A 4FNQA 4L4PA 4H9YA 4X0NA 4Z08A 5HQLA 4HNTA 1UIPA 1P0EA 2BHYA 3C8NA 4D8AA 4JTJA 3GDMA 5EBUA 5D37A 1SZGA 2V69A 4GVGA 2VFGA 3ZIZA 1KM5A 3QFEA 4AD1A 5I77A 1M68A 1NJJA 4LFYA 1F76A 4PB5A 4GX8A 4XKMA 1Y5WA 4YTTA 4E8GA 1ZENA 4YYFA 5BNKA 1R5YA 5I3KA 2OODA 3GAKA 1LZOA 4KRTA 2F6XA 3L9CA 1DIEA 2GZXA 3MP5A 3TOYA 3ZVHA 1R3WA 3VI2A 2P0OA 2FH8A 3T1GA 3JR2A 1V4YA 3IUHA 1UWAA 4DX3A 6REQA 1OG0A 4WVXA 3VC6A 4TV5A 1MQPA 3D46A 1KTNA 2O56A 2ZE3A 4OUEA 4B5UA 4DJDA 1FHVA 3KBWA 4H9XA 2I9UA 1V6YA 1UWQA 3U5YA 3E1F1 2YZRA 2ON3A 4XAGA 5K4ZA 3ISIX 2V67A 2WW5A 1EB3A 4AQLA 8A3HA 2PRMA 3TTOA 2CLMA 4M0XA 3NFUA 2ZWYA 3DFHA 2OTDA 4HPXA 4U5IA 1FHDA 1DVJA 1XLDA 1J6OA 4KT2A 3EB3A 3JS3A 1U30A 2ISDA 4J4KA 1EIBA 4LY8A 3P93A 1YDVA 2BVTA 4D6DA 3GVRA 4JN7A 2YA0A 3UJ2A 4GYPA 5LNVA 1QWGA 1PCWA 3A9IA 4LRTA 2ODOA 3VNJA 2OEKA 4Z1YA 1K9EA 2WSYA 4A29A 3M4HA 4HMNA 1KWKA 4ACZA 3MI3A 3MZNA 4UOQA 3T0DA 4A8LA 4UTTA 2GWGA 5J5RA 3ID7A 4CU7A 3IIZA 1OFAA 3G3DA 4OOZA 1NOUA 1TCDA 2YDQA 1TFVA 3MW7A 4MVAA 1XS2A 4IG2B 1TELA 3TYCA 1Q3NA 2ZTKA 2J7GA 3GLCA 3F7JA 3CV7A 1ZAIA 3KVLA 1A4LA 2GJNA 4LV4A 2ACRA 1Q6EA 4QM1A 2VR4A 1UPPA 3W7HA 3CAQA 4AY8A 2WMIB 3RMJA 2WBGA 1Q6QA 3LPOA 4EF9A 5BW6A 3LRMA 1OFOA 1ZAHA 3UJSA 1W5OA 2D3LA 4NZ5A 3VKKA 2J8TA 3PBVA 3W1RA 3GUGA 4JDBA 4BQ4A 3EWCA 6REQB 3QV6A 2ZA2A 3VZZA 3NGFA 3AC0A 3P7YA 4GBUA 5ABTA 2Y7DA 3A5VA 3HG2A 3TIMA 2Z1BA 4QAIA 4XZLX 2OZ3A 1TX0A 5J8LA 2FZ9A 4JTSA 4MDPA 2HCVA 4H2CA 3RK8A 1RBAA 4JHZA 4W5ZA 4KMQA 3TC3A 3VOFA 1VEOA 3TFXA 4AWUA 4IQLA 3U4AA 1EWDA 2WSRA 3GTFA 4QX4A 1EP2A 5DXXA 4LT9A 1VBUA 1VFSA 4BCEA 4TIMA 3V0TA 1QI2A 1TVLA 3V3WA 1FWNA 3UXLA 4EPKA 2Y62A 2QGHA 3B40A 4QCFA 2Y63A 2C19A 1CXKA 4LS2A 4O53A 4D6JA 2Y5SA 3PZQA 4BQ3A 3SRDA 4PN2A 4JICA 4CD5A 2ZDSA 3T08A 1RSCA 3EXSA 5LGXA 1BRLA 1B3WA 3CLWA 4GY7A 4DELA 5FJRA 1L2QA 1PIGA 2OGYA 1JRBA 3AYTA 4WDTA 5D30A 1QBAA 3WSUA 3VD7A 2DEPA 5L6UA 2EG8A 4MNMA 4AC7C 1KBIA 3ZQ9A 5LIKX 3PFRA 3EWBX 3SCWA 5C55A 5T9CE 4IFKA 3KP0A 4DUOA 1ISYA 1LTDA 2YCKX 2J9YA 4HN8A 4TTGA 3JU2A 2VZOA 2V2DA 1TRDA 5C5YA 3WBAA 5I3IA 1JCLA 3WZ0E 5SWUA 3IJDA 1V5XA 1XC6A 1F3XA 3C0JA 1WZAA 2HSAA 2NQJA 4NZ1A 3QMRA 2GGJA 4K68A 5EA9A 3W2JA 3PBUA 4MAVA 3R8RA 3DFQA 3S5ZA 4PMUA 1UOZA 3MMUA 5B7YA 1WOAA 3FVMA 4C1NA 3AICA 4B9YA 4J7RA 2PP1A 1IYXA 1NAL1 5DX7A 3EX4A 3UGRA 3VD3A 2Y88A 1X8FA 5HQEA 3DHUA 3LI0A 2G8ZA 3KW3A 3N2TA 5DCEA 2QUTA 3PUOA 2ZUTA 4ZO8A 2CLIA 4ADSA 1EX1A 2Y61A 3GU2A 3UYIA 2H3BA 5F2GA 2ZXQA 4W87A 1W1A1 3V1HA 3EGJA 1TV7A 1B3XA 1DJZA 3W76A 3A23A 2WM1A 3ATYA 3RLUA 3BSHA 1R30A 3SAZA 2HISA 3TYBA 4J3VA 4PBEA 3EOOA 4HU4A 1WDPA 1RP8A 4I5XA 2B7NA 1KGWA 1UQZA 1OF8A 4IH3A 1DHPA 4L56A 3BANA 1EGZA 1P7TA 4M29A 4N02A 5AY7A 3AXKA 1BD0A 3A3WA 3F5JA 1ZJHA 1LOQA 4TX9A 3TYAA 2ZZ4A 1KXTA 4JKMA 1RCQA 1AK5A 3GXDA 3CEUA 1EEPA 4RUBA 1XPYA 3LSCA 1BPLB 3BW3A 4E5TA 1FHUA 1Q8JA 4ERAA 3QC3A 4UC5A 3KUMA 3FJ6A 2GVJA 4UR9A 5AN7A 1M01A 2QDHA 4FLRA 1GYNA 2B7QA 2PWFA 2VZTA 4MMWA 4GISA 5A8NA 2AKZA 3BW4A 3L4VA 4G56A 4WDUA 2FZDA 1O60A 3TU9A 1TJ1A 5GNZA 3LI1A 1AA1B 3BLKA 3R94A 2ADAA 1AQMA 3IRDA 3ZJKA 4JIIX 4GXWA 4UZUA 3LPFA 4INFA 2VZVA 4DLFA 3W82A 4NHVA 1JNEA 2ZQ0A 5TD4A 4IX2A 4FB7A 2E6YA 4WJ8A 3GNRA 2B31A 2GVGA 3OHMB 3T78A 1DXEA 3VGBA 2GLKA 4HNVA 3HTWA 5CCZA 4HB7A 1P0NA 1CTNA 1LQ0A 4H6KA 4MKVA 3P8JA 4B91A 2ZIDA 2JFEX 3VIHA 2DIEA 3WLSA 1PS9A 4WDWA 1HG3A 1O5KA 3NR0A 2HJPA 1UIOA 1UR2A 4GIRA 3W26A 1PAMA 5B7ZA 4Q3MA 2PTYA 1Q8AA 1YE4A 3EWUA 3NQEA 2J78A 3B9DA 1YMYA 3HG3A 1VLWA 4F0SA 2J9ZA 4X9YA 3RPTA 3PAJA 2VQUA 3SCUA 1XQKA 1M41A 1PTAA 3MYPA 1E6ZA 4S2BA 2DZTA 1X1NA 2ZUNA 1RR2A 3AXHA 3ITYA 4AX7A 4EVZA 1AFSA 1RD5A 1FWGC 4S38A 2FTWA 3MHFA 2VFFA 1XHGA 1S3HA 1LWJA 1E5NA 3UEQA 3UXKA 4LAMA 5ECVA 3TJ4A 3UFYA 1IGWA 4AHOA 1UG6A 3QZEA 1EDQA 1B4KA 3VXGA 1KRBC 3V5CA 5CPMA 2CLOA 3W84A 2YA1A 2WNNA 3JZEA 3B9OA 5K9DA 3R43A 3TSBA 2JKPA 2JALA 1KTCA 1OX4A 2XSAA 4A6GA 2VL4A 2FYMA 4ZO6A 2PD9A 4DAIA 3NQ6A 4UQ9A 4QSHA 2DU2A 2NXIA 1PZ2A 3B0VC 1MVYA 3OG3A 1YTKA 4J28A 2E6AA 3U3HA 3N34A 4GFIA 1H0GA 1LLOA 1H5VA 3SY5A 4V27A 2HE8A 1LG2A 1EYEA 3IVSA 4LUJA 3CTLA 5G2IA 4JQ1A 1SSGA 4Y7EA 3IK4A 2G3NA 3OIHA 1UKPA 2D3NA 1K9TA 3E74A 1H11A 1O1ZA 2HWGA 1UD3A 4TOQA 2Z2BA 4XSLA 3HGJA 4NSBA 3W87A 3V7PA 4I8YA 2DUXA 1JXKA 1S2WA 1B1YA 4O8AA 1XSIA 2J75A 4J35A 2J66A 1Q7ZA 3MVIA 4AWSA 2Z1WA 1KC7A 3D3AA 2F8QA 1E0TA 1RZMA 4FNUA 4AD5A 3CUXA 3UG8A 1OEPA 4BZYA 1PHQA 4A21A 3WD0A 3WH9A 4PYSA 1THFD 1RD6A 1GW1A 3SM0A 1M5WA 3AUOA 4X3ZA 2IKGA 3B4YA 4TV6A 1HJQA 4JFUA 3QPYA 1J8VA 2JKAA 4AFYA 1US2A 5D8ZA 4XO7A 3WK0A 3UWVA 3S6TA 2C8NA 3M44A 1KBBA 3VX0A 3WF0A 3K8KA 1EO7A 4GZIA 5MKGB 1FCBA 4UTUA 2Y5EA 1XQLA 4JFTA 3VE9A 1XRTA 3ES8A 2C3ZA 1UZHA 3TZFA 1SW7A 2J6XA 4Z1DA 3NQMA 4RR4A 5KZMA 4AAJA 4QQUA 3VNKA 2CERA 3FSTA 4XUGA 3ARXA 1UUQA 4ZL1A 5LA0A 4HQVA 2WXDM 1EJTC 2DORA 1C7TA 2AL2B 3WD1A 1J0HA 2XPKA 2J7EA 5CJ5A 4ZOCA 3NQ7A 4LUYA 3L5AA 2ZX6A 1LWHA 4WZHA 1LG1A 4HTYA 3MSRA 2YYTA 3WL1A 1I2PA 3G24A 1ENUA 1V3JA 3LLXA 3QGAC 2P8CA 3AO0A 2GPTA 2NQ5A 2R1KA 4Q7BA 1ZCCA 2DVTA 2CIPA 3PANA 3I4KA 2DH3A 1SPQA 1Q7QA 2DV0A 3L65A 2FZ8A 4E8CA 1E55A 2V9DA 4X22A 3C5QA 3CAVA 4BI5A 3PJXA 1QBBA 1KFLA 4IMDA 1EZWA 2P1FA 3SW6A 1DIKA 3CUIA 4FNRA 3SECA 2WANA 2ICSA 1MW3A 3BJTA 4GUJA 1TIMA 2GK1B 3P3BA 2FGZA 1RP9A 5DMNA 3VDAA 3WF2A 1PIFA 2WM0A 2INZA 3PZ9A 4N9CA 5DELA 3S83A 3L4TA 5C71A 3PZUA 1DJHA 3CWNA 2PDFA 2QUVA 5BRPA 5CBIA 4J27A 3W7NA 2XTKA 1PB0A 3UW6A 2NXHA 2ACQA 4MIMA 4IHCA 3RX2A 4CVUA 3LGGA 4B15A 4MDOA 1E1CA 1B5TA 3WNOA 4IP7A 3SQMA 2MANA 4RPPA 1E51A 4UIOA 4JEJA 3BOLA 4F40A 4ZTXA 1U1HA 2PDLA 4J3UA 4LF1A 1BF6A 1SMDA 5H91A 4I6VA 1DJYA 4MM1A 2A2IA 4DJDD 3I7RA 3W6MA 2WMFA 1HL9A 1YW1A 3D0CA 4ZOAA 2H6RA 4BK9A 1MUCA 3IJ6A 1NELA 2HROA 2XVKA 5D03A 1TA3B 2PDQA 2NVAA 2BXYA 1LLZA 3DYMA 4GI4A 4C6JA 3WNMA 1TR1A 3WKZA 3V5OA 3AOFA 1GJPA 3TW6A 2FVKA 4FOUA 5HPOA 3M43A 1JXJA 1GQKA 1TJ2A 3E0VA 3E2SA 3ZR4A 1C8YA 1V3MA 4UNIA 5A8QA 3MUZ1 4HT3A 1AW1A 3G8EA 3G1YA 2IKJA 2P53A 1AL8A 3A4XA 3LCFA 1F4AA 5LSMA 4M82A 1V6WA 4PMQA 3CAKA 4C1KA 1P48A 3WQ4A 2Q09A 2BHZA 2D2JA 3O2LA 1K1DA 5AB3A 1HQTA 1QATA 3RPDA 3BAIA 3VCRA 1AUSL 4UFHA 3QBUA 1CIUA 1A5AA 2FKPA 3IJ8A 5F2MA 3UVIA 9XIAA 2QCHA 3NURA 4F9JA 3PZGA 3EOUA 4B3ZA 1R86A 4WEVX 2A3EA 3M47A 5DEZA 1NWUA 3DG6A 1JDEA 1FWCC 4ZQRA 3BARA 4YVPA 5LIUX 3UU0A 3CH0A 1ZHAA 3UZXA 1SJBA 2I56A 4EP8C 2ACSA 4NI8A 4O57A 1DIDA 4CVWA 4GZ7A 5CC3A 3TMQA 1W1TA 3W9ZA 3USZA 4LCRA 4YIWA 3ATZA 2TAAA 4KFPA 1XCWA 4FXJA 4WJEA 1CENA 4GI9A 3HG4A 3H23A 5REQB 1EDGA 4MJ4A 5F1UA 1NM9A 5BXTA 1PIIA 4GWEA 4Q8VA 1IXPA 1GOKA 3BK0A 4ASTA 4UBPC 4XBSA 2XINA 2ZZ5A 3T7VA 1X96A 4Z42C 3BAXA 4N9EA 2EJAA 5EU9A 2O7SA 3FA4A 2AKMA 1GOQA 2J62A 2VOMA 3OVPA 4P8UA 3BICA 3NGJA 4QJ3B 4GVFA 3M0VA 4DLMA 3NSNA 4UTWA 2G50A 3RHGA 2OWCA 4EACA 1J01A 4B3KA 2Y4SA 4ZCWA 3W7KA 5I07A 1OC5A 3VMNA 1MDLA 4ZOEA 1RPKA 1DWIM 3TSMA 4Y8EA 2GUBA 3ZLFA 3IAPA 3W1NA 2E77A 4AZIA 2PSNA 3TA6A 1M65A 3M16A 1GVOA 4PSPA 2XSBA 3LCXA 5CXPA 5AOUA 3B0YA 2OQHA 1JNDA 4US5D 2R82A 3LTSA 1UUMA 1XI3A 1KGUA 3WUEA 5E9AA 3UY7A 1BYBA 3CK5A 2WSQA 4R9OA 3BAKA 4N4PA 1OCQA 4U2YA 2G0WA 3FS2A 3SUUA 1R8LA 2PDIA 1EIXA 2ZRWA 4R88A 3QLDA 3T05A 3VZYA 1KM6A 5GJPA 4KWOA 2FB2A 3SIZA 3PTDA 1OCJA 1TTJA 3LV6A 3VNMA 2CBJA 2WHLA 3W00A 4RNFA 1XFCA 4GQQA 2OCZA 2PDCA 2PUZA 3I65A 2NQLA 3VIKA 1TO3A 1SO3A 2QIIA 5TQLA 3ZO9A 3H2MA 3RM8A 3RG6A 4F79A 1KQZA 1TWWA 1T0OA 1ODZA 4GE8A 1A0CA 1XYCA 1OGSA 3TWAA 2C79A 1E4NA 1OVDA 3MHGA 2REQB 4JHMA 4HHLA 4BEUA 4KEVA 4KWWA 5KZDA 3L0GA 4LVFA 4UXDA 3M0KA 3V0SA 3IVTA 2X41A 1BQCA 3CYJA 4QSFA 2HVOA 1W8GA 3NL3A 3SB0A 4S3FA 4NILA 3NYZA 3N12A 1XDLA 1ITCA 5IBXA 4TO8A 4D1IA 1W9UA 1K4HA 3P5ZA 3KOYA 1BQGA 1ZS2A 1DJIA 3U2OA 5I3FA 3QZ6A 5FSEC 3NVTA 1J11A 5A6BD 2AAMA 2ABAA 4GH3A 4BEQA 2WC3A 2QV5A 3FHQA 3M0ZA 3BMVA 2HEJA 4GNKB 4KESA 3GE7A 3S1VA 3GDTA 2P10A 1N7KA 3PB0A 3SGUA 3WENA 4KWUA 4PL1A 4E6MA 3U4FA 1W9BM 2CLFA 5E6ZA 3EDDA 3C2EA 3GHSA 5KEZA 3EMZA 4GIAA 4XBKA 4L4MA 3CUFA 2FPVA 4YCOA 3O9NA 3QR0A 4IMFA 1JCTA 5KTLA 2OEJA 1X7IA 5AYXA 4PCFA 4AY7A 2BZNA 3WH6A 1H7OA 3U2CA 4Y9MA 4MKNA 1FKXA 4HZ7A 4GI6A 3TTYA 3LB0A 3COTA 1QPRA 3VOJA 1W3JA 2XFYA 3I3BA 1KTBA 1GPWA 1XWYA 2OU4A 4GKTA 3PPGA 5FJOA 1A5OC 1G7VA 2ZUUA 3II1A 2DQXA 4RKAA 4MLRA 4V33A 3W73A 1REQA 2B7OA 4HNNA 1RLDA 4PFHA 2E25A 4HOWA 1E6SM 2IUZA 4S3AA 3TDFA 2OT0A 3NIYA 3LCLA 1K8XA 1ADSA 1YXDA 1TPEA 1PYMA 2BVWA 4HNOA 4YU1A 3UWWA 5BWAA 3MUXA 1IWPA 3QKEA 1SYTA 4BR1A 4YTSA 6XIMA 2IPGA 2E40A 4UR8A 3GXPA 1C8XA 4IFOA 2VXNA 4ZENA 4CEUC 5K7JA 1WDRA 3ITOA 1M03A 6TAAA 2YBTA 1OABA 4HPHA 1QPOA 4N4QA 4X2PA 1XRFA 1F05A 5GPRA 3TJIA 1OCBA 5HATA 3TWBA 2WBKA 2E8YA 1UD5A 2IKIA 1F5ZA 3DGRA 3NQFA 3TVAA 1PBGA 3FFSA 2F84A 4PMZA 3P62A 1H7RA 1FHLA 1XD1A 4NASA 3KZPA 1SU5A 3GFZA 2DZPA 2PDHA 1V3HA 2X1SA 3RLGA 1Q6RA 4AZGA 1X6UA 4ZVJA 2QLYA 2NQZA 4AD0A 1GEQA 1PX4A 1FRBA 3VKCA 5BOEA 3CL6A 1RBOB 3R58A 4PBGA 3A13A 2FFCA 4R9XA 5EKYA 3SN4A 1H7WA 3R10A 2ZX5A 4YCPA 3TCSA 3NNTA 3MY9A 4M6QA 3DHFA 4GJ1A 5D05A 1CGXA 1XLJA 4DBEA 1N8WA 2J8GA 2NZLA 3KBSA 4HIBA 4KERA 2Z2UA 3NPWA 3ONCA 3ABOA 3M0HA 5AC7A 3HV8A 3CUJA 4NZJA 4EXAA 1XIJA 3MT1A 1GVEA 4N42A 1XIGA 3W25A 3UP8A 3S1GA 4LNYA 4LYRA 2GVEA 5I06A 4O19A 4US5A 3O0KA 1VBRA 3WY1A 3GH5A 3DDMA 4UTHA 2OSWA 3URBA 3QFWA 1R87A 4W7WA 5JIWA 4NVTA 1Q6GA 2VHLA 1DWGM 1QJWA 3A9BA 4JPGA 3QMTA 4M24A 4UFLA 3I7SA 4NNBA 1PX8A 1QUMA 3VM7A 4FIQA 4NX0A 3OZPA 1NTHA 5C2CA 1D3HA 3AYRA 2ZOXA 5LNWA 4UNKA 2C0HA 4YVXA 5A6JA 3M07A 1TB3A 2QCDA 4XVDA 5D9PA 3OODA 2X2YA 2Y7EA 3KOXA 3GDLA 4M7TA 1A5BA 4HMEA 4RDY<