2NW6A

Burkholderia cepacia lipase complexed with s-inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
320
structure length
320
Chain Sequence
b'ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
molecule tags Hydrolase/hydrolase inhibitor
publication title Combined X-ray diffraction and QM/MM study of the Burkholderia cepacia lipase-catalyzed secondary alcohol esterification
pubmed doi rcsb
total genus 131
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nw6A00
3A6ZA 4PSDA 2BUCA 4EZIA 1FFAA 2XUQA 3LIIA 3ZPXA 5ALPA 1RYYA 1W6RA 5AK6A 1CUWA 5IVHA 2B9VA 4FLMA 5DTJA 5K3EA 4A5SA 2JGJA 1CUIA 1JT2A 4XX1A 2QTBA 5LYYA 4DYHA 2WG2A 2CBGA 1ZICA 1TQHA 5AI4A 2VTVA 2G4LA 5ALFA 5JAHA 3H1BA 4UHEA 2J4CA 3W9UA 2OCGA 3E0XA 2WUGA 4RE5A 4KR0A 4CCYA 5I9IA 3BF8A 4EY8A 3PICA 4F0JA 4MYSA 2H7CA 3WMRA 4QDZA 4CG1A 5E4YA 5ISMA 5D3ZA 1XFDA 2C0PA 3C87A 3HEAA 1QOZA 4G9GA 4QE3A 4AZ3A 4X3CA 5A6VA 3QYJA 2X5XA 1OCEA 5BOVA 3IVMA 1QFMA 3Q8WA 1AZWA 2BGRA 3G0BA 3WJ1A 1CUUA 3B3QA 1QTIA 4E14A 5FDFA 1FJ2A 2X76A 4DLNA 3VVMA 2WFLB 3O4GA 4Y9SA 3FYUA 4WY5A 1HDEA 4BDSA 1KU6A 1MPXA 4X85A 1BCSA 3PUIA 4J7AA 1LZKA 2WKWA 1AQLA 4QWWA 2CEKA 4K2AA 1QIMA 3RK4A 4XIIA 4G9EA 2XQGA 4ZI5A 3VISA 1MU0A 3KDAA 4UBKA 1XQXA 4UBJA 4QLOA 4AQDA 2V96A 4BAGA 1LPBB 2ZYHA 2JEYA 4LXGA 4AX4A 2XLCA 2HA3A 2JEZA 2VEOA 1GXSA 5CMLA 5AKEA 1XROA 2V98A 4OYYA 5K3FA 1XRQA 2PL5A 2Y2VA 5HF9A 1CRLA 1WOMA 4B81A 2WJ6A 1M33A 2QR5A 4BVLA 4WFIA 2YXPX 5A62A 3F8SA 2GBCA 4AO8A 3OURA 1XLWA 4RPCA 1CUBA 3DDUA 4BE9A 3FAKA 3WZLA 1VZ3A 2AJ8A 2FJ0A 3E1GA 1YASA 5HKBA 2DQYA 1S8OA 1MX5A 2VQ6A 1R4ZA 2VF2A 1ODCA 2XMGA 3KSRA 4U2DA 1FFBA 4DNQA 5CTAA 4FMPA 4WDQA 4DNOA 4X6UA 5A71A 4ZV7A 1UOQA 1Y37A 2AJCA 4M0FA 1ZD5A 2GYVA 1EB8A 2OGZA 1CUSA 4BC0A 2BJHA 1Y7HA 3C6YA 1WB4A 2H1IA 1N5RA 2VJAA 4H7EA 5ALDA 4XWGA 4MEBA 1VOTA 3GA7A 1VZ2A 4H77A 4UHBA 1A88A 2XMBA 3IURA 3I1IA 1CVLA 1Q0ZA 3D5EA 4FBLA 2VJDA 1J2EA 3C8DA 3NUZA 4GW3A 3NGMA 3KWJA 1XZDA 4C4YA 3ESCA 1UK7A 2DQZA 5HK8A 3CCBA 1KU0A 5EFZA 5HK9A 4UBOA 1AX9A 2WLSA 4FKBA 3QVMA 2HIHA 2WIKA 4KAFA 4MWTA 4H7JA 3HSSA 4ETWA 4N8DA 3D3NA 1DWPA 5AI9A 3DL7A 3H2IA 1MTZA 4G5XA 3WK6A 3H18A 2HU7A 4KYVA 2RAUA 1UOOA 3UMJA 5JANA 2WUFA 1Q84A 2VJBA 5KWIA 4QNNA 4OSEA 2QMQA 2GYUA 1XLVA 4BTVA 1P0IA 5LZ8A 4W63A 1YA4A 3WK8A 4EHBA 1MT3A 4I3FA 3QPAA 2QXUA 4QEKA 4HVTA 3ICVA 2BKLA 3G0IA 4AN1A 1X2EA 5DNWA 4X7BA 4RE6A 3FVRA 2WJ3A 4BDTA 1YS1X 1L7RA 2WSLA 1FFEA 1JKMA 3WIOA 3I2GA 5EIEA 2I03A 2ECFA 4J0CA 4AXBA 2HU5A 3C5WP 4C88A 5FKJA 4EUSA 4FNMA 1BS9A 4K5QA 4OPMA 2UZ0A 3FWHA 2HRQA 1R50A 2XE4A 1W75A 1F0PA 1VXOA 1R1DA 2QJRA 1E8DA 4J0KA 5LZ4A 4DSZA 3H2KA 2HA4A 3C6ZA 3G7NA 3OC0A 1G4HA 2XUAA 1VJ5A 4GXNA 5ALYA 4J0IA 2I78A 3ZWQA 3I28A 2WTNA 3TJMA 1H2WA 2JF0A 1HPLA 2R11A 4MWSA 5AO9A 1RP1A 2CB9A 3M81A 4PV7A 3D0KA 4BRZA 3H17A 1DWQA 3IULA 4HZGA 2ZYSA 4C6HA 2G5TA 5AKYA 4HTAA 4TVKA 1R88A 4QA9A 5EHZA 1IUOA 2XB6A 4FFWA 2WQZA 2XQKA 3AUKA 2HDWA 5EIAA 1L7AA 1UXOA 4DMFA 1P0MA 1XQWA 2XMCA 4Y2UA 4LXHA 5KREA 1XRNA 5HZGA 4WFKA 4W1PA 3U1TA 2PSHA 5E4TA 4MYDA 2WIFA 4QZVA 4NVRA 4BC1A 4C4ZA 1USWA 2IIVA 1UWCA 5LZ5A 1JJFA 1LPOA 2QZPA 1LPNA 1DQZA 1BROA 3D7RA 4C89A 3FBWA 2VT7A 4Y2JA 4FBMA 2RIPA 5HKAA 3PFCA 5CH3A 4CIAA 3WYNA 4X6XA 1BU8A 3G0CA 2WIDA 5K3DA 1CQWA 3F9CA 2WG0A 1ORWA 3O4JA 4ZREA 1XRLA 4M0MA 1CFJA 3VXKA 4N8SA 2JGLA 2P8SA 5JARA 3G0DA 4DSAA 4YASA 4UFPA 2OQIA 2J4FA 4EY5A 5JYCA 2PX6A 2WM2A 1ZOIA 2WFZA 3BIXA 5ALXA 1J06A 3R40A 4UUQA 3FLAA 1B6GA 2FUKA 3BDIA 1U8EA 1ZGBA 1UK8A 1VLQA 2J3DA 2PUHA 5SYNA 4C4XA 2ZSIA 1EX9A 2OXEA 5I8PA 3WWCA 1XZIA 1BE0A 1MX1A 4OB8A 1HLGA 4FTWA 5K3BA 1WPRA 3STTA 1ZI6A 2XMRA 2ONCA 2XQJA 2BUBA 2OGSA 4B7ZA 3I6MA 1DWOA 4B80A 2JGKA 4UBIA 5DJ5A 3AILA 3R3WA 3H19A 2WHQA 5JIBA 5CT8A 5AOCA 2HL6A 2VA9A 1CUXA 3A2NA 4AMZA 2Z3ZA 4FFVA 3HYSA 4W1QA 4OCZA 2Z3WA 4M0EA 4KAAA 3C6XA 2XUIA 1BN6A 3L1HA 3O4IA 1EVQA 5HF5A 3VJKA 2BAGA 1DT5A 2G63A 3WKCA 3HABA 4NMWA 3LLCA 3CN7A 3BIWA 4MJ3A 5T4BA 1QFSA 3G0GA 1QIKA 2DFPA 1JJBA 2OLEA 2VAXA 4AN0A 3BE8A 3VJLA 1MAAA 4JH0A 3AFIA 1AUOA 5K3CA 3WA6A 5AM3A 1UKBA 1EDDA 1CEXA 5HQ3B 1J1IA 4HRXA 5EHNA 4N5HX 1BCRA 5AJHA 3OM8A 1O6GA 4X95A 1LPMA 3DYVA 1K63A 2JBWA 2V97A 1EDEA 3W2TA 4Q34A 1GKKA 3EBLA 1ACJA 1GT6A 5YASA 3E4DA 3PFBA 1QTRA 2WIJA 5C81A 4X92A 3A2MA 3C70A 4X91A 2PM8A 3DLTA 3R3ZA 1I6WA 4WFJA 2CUTA 4ZV9A 1U65A 4A23A 3QH4A 5BWCA 3S2ZA 4BP9A 5JZSA 1ZD2P 3FYUB 3H2HA 4Y2TA 1EDBA 1XZJA 5FV4A 3V1LA 5CT5A 5AKIA 4KJXA 3G9UA 3G9TA 4QLAA 5ALHA 3S8YA 3AZQA 4OB6A 2ACEA 5CT6A 3GROA 1UZAA 5IKXA 1XRPA 5ALKA 2EDAA 1JFRA 3FLBA 1F8UA 3HLKA 4BATA 1GPLA 1JU3A 3FLEA 3BJRA 1WPXA 2WJ4A 4ZRDA 3F96A 4DGQA 4FLFA 1TKRA 4QWMA 3ZLUA 5FRDA 3NWOA 5AI6A 1FFCA 1SCQA 3WWDA 4S0XA 5LLSA 1IUPA 4FLEA 1U4NA 2K2QB 3F97A 4X94A 1BN7A 5JAUA 1R9NA 3DQZA 3RARA 2YYSA 4XJVA 6YASA 2O7VA 1EA5A 4G8CA 4OD0A 2RGUA 5AKHA 3DCNA 1ODSA 2QJWA 5CT4A 4IO0A 1HQDA 1GKLA 4IQ4A 1TRHA 1XZMA 1QIEA 3W05A 2IX9A 1MO2A 1AGYA 1QO7A 2WUDA 4LYDA 5DYTA 2YASA 3GUUA 1VA5A 1XZBA 1LGYA 3ANTA 5ESRA 1J07A 4HXFB 1QE3A 3I6ZA 1DINA 1XZCA 1QLWA 3IIIA 4J0DA 4B82A 3ZI7A 1SCKA 1SC9A 2C5GA 3PF9A 1EH5A 4HS9A 5C8XA 4B6GA 3B12A 5JAOA 1QZ3A 4Q05A 3N2ZB 3B5EA 2XUGA 5DNUA 4U2BA 1AKNA 3ESBA 4PW0A 1LBTA 1T4MA 3IA2A 5A7GA 5HFAA 4C87A 1FFDA 3ILSA 4JYPA 1EB9A 5CBKA 3EIOA 2NW6A 5HF8A 2HU8A 4H7HA 4H7FA 4JYMA 4PQEA 5HFNA 1CUZA 3I2JA 4BCBA 4QDXA 2XI4A 2C58A 4Q82A 4UHCA 3WA7A 1VKHA 2OPHA 4BVJA 4EB0A 3D2CA 3G9XA 4IHAA 1CUHA 1DX6A 3FSGA 3ZLVA 4GECA 3C6BA 2FX5A 3ICWA 3DYIA 5AP9A 4HXEB 2DHDA 5JADA 3GBSA 2QOEA 4Q3KA 4NS4A 3QM1A 1AMNA 1H2YA 4J03A 1UFOA 5ALOA 3AJAA 3EF3A 5I7UA 4BYMA 4B0OA 1FSSA 2JGEA 4L72A 1JMYA 3WKBA 1Q83A 2JGFA 5AM0A 2OGTA 1UKAA 4Q1VA 4KE6A 5FUMA 1QONA 3U0VA 5AM4A 5D3KA 1HKHA 1ZJ5A 2G5PA 4LIPD 2AJLI 3ED1A 1UOPA 3D2BA 3AZOA 2HA0A 1W52X 4F60A 1W1IA 2DCMA 4G4JA 3QMMA 3EQ9A 1EINA 1GPNA 3PUHA 1XZHA 1CUYA 1WM1A 3SK0A 3G9ZA 5JZ9A 1H2ZA 5DNVA 1XQYA 5JD5A 1GGVA 3HACA 3NOXA 1A8QA 4N8EA 5CRIA 4AO6A 3KXPA 3K9BA 3UUFA 5CH8A 3HJUA 3EQ8A 4X97A 4KRXA 5CXXA 2VT6A 3A70A 3JW8A 5AOBA 1TAHA 4MEAA 3V1MA 5CXUA 3OTQA 4WDRA 1EK1A 4V2IA 5T4HA 1MJ5A 2ACKA 3BF7A 2QKYA 5D6OA 2HA6A 4OB7A 4X90A 2V9ZA 1CUFA 1XKTA 4DMHA 5CH5A 3FYUC 1MX9A 4NZZA 2QM0A 3WK5A 4GHWA 5LKRA 1LNSA 4CCYB 3DNMA 4PNZA 5LZ2A 4KEAA 2PPLA 2W22A 4KE7A 1GZ7A 3HZOA 4E11A 1C7JA 4LKOA 2GYWA 1YR2A 3T52A 4Y7DA 3D2AA 4ITVA 4CCWA 4OUKX 1Y7IA 1CQZA 3FNBA 1W76A 3VJMA 5AK5A 4CG2A 2DSNA 5E2IA 3SWWA 4H7KA 3PE6A 4P93A 2GBGA 4JUIA 5AKGA 4IH1A 3V1NA 2I3DA 1YSCA 3L1JA 1YAJA 4UBMA 3LP5A 4BCCA 2B61A 2WG1A 3F98A 4KACA 3AIOA 5AK3A 5ALZA 1XZAA 5JD6A 3K6KA 3R3YA 2E3JA 3QMWA 4K6GA 3DOHA 2C0QA 3WZMA 1THGA 4F21A 2VAVA 1EVEA 2XMZA 1F6WA 4LXIA 1CIJA 1N5MA 4G8BA 3QMVA 3G02A 1UK9A 4YX9A 4Y2YA 4G8DA 4GEGA 5C8VA 3VKFA 3K2IA 3ESDA 4EA6A 2WU4A 4YK7A 1XZEA 2VATA 5AKJA 3BXPA 4AB1A 3O9MA 2WFLA 5AHXA 2BUAA 2OG1A 3AIKA 4UBNA 5JATA 3X3HA 4ARBA 2OCKA 1C7IA 4B9AA 2OCIA 1K8QA 3WWPA 1R3DA 2XUPA 1XLUA 4AZ0A 2WUEA 1PFQA 1P0PA 1XZKA 4BVKA 5FOQA 3WKAA 3H1AA 1QGED 3LS2A 3P2MA 2D0DA 4P9NA 2PVSA 4UFOA 2Y1KA 1JI3A 2OAGA 4BE4A 3W04A 1DTEA 1E8MA 1ZI9A 5FXMA 1SOMA 4H7DA 5DWDA 3CN9A 3O95A 1X70A 2W6CX 4WCVA 4KRYA 1WHSA 2HHAA 2QUAA 2QUBA 5SYMA 3BDVA 5T4EA 1MAHA 1XZLA 5BV7A 1QO9A 4PO3X 4CG3A 3JYHA 2DHEA 1D07A 7YASA 3HXKA 1CUAA 2XMQA 3DKKA 1JU4A 4DNFA 1GQRA 3D4LA 3I2HA 5AICA 5EI5A 3WL8A 1A8SA 4OYLA 5T4FA 1VE6A 1IUNA 4FOLA 4L9AA 4EBBA 2ES4A 1LZLA 2C7BA 1IMJA 4GI1A 2DR0A 4GWLA 1LLFA 2PSEA 1F0NA 4H0CA 1WCYA 4B84A 4UPDA 2R8BA 1EXWA 2EDCA 1ETHA 1WB5A 1EHYA 5H3HA 2WFMA 1C4XA 3DJYA 2H9YA 1E66A 4QDUA 1H23A 1XZGA 1L7QA 3LIPA 5DLPA 1K4YA 1YS2X 3GFFA 1CUVA 5AI8A 5JD4A 3W9BA 1UKCA 3WQHA 2Q0XA 2Y6VA 2B4KA 3DEAA 2GBIA 5AM2A 2RONA 2QS9A 2VJCA 2O2HA 2QVBA 1ZJ4A 4J0HA 5FPPA 5ALGA 5LZ7A 3V9AA 1DQYA 3RLIA 2ZJFA 5CW2A 4ARAA 3WJ2A 4J0JA 3QBJA 5HCUA 4HXGA 1NU6A 5D7BA 5K3FB 5AKKA 4TGLA 4I4CA 1U2EA 3IUNA 1AC5A 3C43A 3RM3A 2XUOA 3WWEA 3FOBA 3O0DA 1DX4A 2HFKA 2WHRA 2AXEA 1ZD4A 5JAPA 4P92A 4RGYA 3H0CA 5EHQA 4BAZA 1VE7A 2VSQA 3T4UA 4KE9A 1HL7A 5ALIA 3DD5A 5LP1A 5ALSA 2QT9A 1KEZA 3N0TA 4OU4A 3I2KA 2PSDA 4AO7A 3OPMA 2PU5A 2ZYIA 4B9EA 4LYEA 3SX4A 1CUDA 1G66A 3WWOA 3CCCA 3IUMA 5ALQA 3MGAA 5K3AA 2OAEA 5ALUA 5IVKA 2ZJ7A 3KD2A 1A7UA 3SC2A 4TPKA 4BAUA 3BWXA 1CPYA 5AK4A 5HQ3A 3HRHA 3IBTA 3R0VA 3JWEA 2HRRA 3STYA 1LPSA 3EQ7A 1CUEA 4Y2QA 5CURA 5AOAA 3O9VA 1ISPA 3IUJA 4G1FA 4B0PA 5AKXA 5ALNA 3H2JA 1YB6A 4EY4A 4UHDA 4FDMA 4PF1A 1ZD3A 3GZJA 5EGNA 4ROTA 3OG9A 2YH2A 3FSGD 5ALWA 1BEEA 1ZIYA 1WHTA 2ZSHA 2HADA 5AI5A 1Q0RA 1K6EA 4X71A 2OCLA 3MUOA 2BFNA 2HA7A 1IZ7A 5AH0A 2DHCA 4UBLA 4W9RA 1HBJA 3QPCA 4CI9A 2WTMA 1JMKC 4K6KA 4B83A 1N1MA 4XVCA 1SCIA 3C45A 4H7IA 1BEZA 2O2GA 1GQSA 4G4GA 5ALLA 4H18A 2I3ZA 3STXA 2PSJA 3ESAA 5IVDA 4UHFA 4PSCA 1CUGA 4X00A 3M3DA 5FLKA 4FNGA 3FCXA 2XQIA 3PF8A 1IZ8A 1E5TA 3HC7A 5KWJA 5IVIA 1AURA 4I19A 2XMSA 3WK4A 3STUA 3L1IA 1EK2A 3MVEA 2QXTA 2RHWA 1YB7A 1VA4A 2QRUA 1CUJA 3F67A 4JNCA 2XUFA 1MNQA 5F4ZA 4MQLA 5A2GA 4LHEA 1QIJA 5JASA 4RNCA 1RWQA 4BB0A 2H7YA 3ANSA 1QIDA 2GZSA 5KBYA 3V48A 4X6YA 4BZWA 2H7XA 1A8UA 2XUJA 1NX9A 4UHHA 4BBZA 4Z49A 4Y2SA 4BTLA 4E15A 5AM1A 3G8YA 3V1KA 4QDOA 5EHXA 5JZBA 1E89A 3BL8A 2HFJA 3OOSA 2GZRA 3QZUA 2WIGA 1LPPA 4CFSA 3Q0TA 5EIHA 2XUHA 4Y2RA 3BJMA 1Z68A 4L3WA 1TCBA 4WY8A 4DMCA 3W06A 1XKLA 5ALEA 2CMFA 4G4IA 1T2NA 5AIAA 4AMYA 3H2GA 4HAIA 3WL6A 1CLEA 4J3JA 1XRRA 3C5VA 2HA2A 4KAJA 4MQMA 1G42A 1N8SA 3IUQA 4J0GA 4DM7A 2XLBA 5FP0A 3AIMA 3WK7A 2ZVDA 3STVA 3WI7A 4JEIA 1W4LA 1XQVA 2D5LA 2O2IA 1B41A 4P08A 4FWBA 5ALVA 3O4HA 5C8ZA 2WHPA 4H35A 5FPQA 1TIBA 1MNAA 2ZYRA 2CKMA 5C7YA 5AIBA 4D9JA 2Y2UA 2WU3A 3VDXA 5ALMA 1QIGA 3FYTA 3HI4A 1E3QA 3DOIA 3H04A 4YPVA 1P0QA 1ODTC 2CJPA 3UUEA 4Y2PA 5LIPA 2EEPA 3R3XA 4UFNA 2ROQA 1TCCA 1IVYA 2XMDA 1O6FA 3QPDA 5ALJA 1JJIA 1ORVA 2XDWA 4U2CA 4ZWNA 3RKSA 2O7RA 1YCDA 3DKRA 3I6YA 5AI0A 2ZJ6A 3M82A 2HM7A 1BRTA 4Q3LA 5J3JA 4N5IX 1GPKA 3VVLA 1X2BA 1LBSA 1YAHA 3WL7A 2IITA 2AJDA 3KOOA 2Z5GA 1ZI8A 2X8BA 2PU7A 2RHTA 2PSFA 5BWBA 4MXDA 3R3UA 5ALRA 3ZV7A 1VXRA 2C4HA 5IH7A 1NU8A 3QITA 2XUKA 1YA8A 5DYYA 3WYDA 1G5FA 3FCYA 2RI6A 2PBLA 2Z8XA 2LIPA 5K5EA 4KE8A 3ZLTA 4GBGA 3M83A 1LPAB 4W1SA 1PV1A 3TGLA 2WILA 3I2IA 3WL5A 2GBFA 3MUNA 5CT9A 1QJ4A 3GELA 4EY7A 5LKAA 2C5FA 4U2GA 4F5ZA 2FJPA 3DS8A 1THTA 5DTIA 4X93A 3WKDA 4BP8A 3TRDA 1OILA 3STWA 2Z8ZA 2JGMA 3AZPA 3DL4A 3I1YA 4GLBA 1DT3A 2XT0A 3WIBA 1CUCA 3I2FA 5E4JA 2J3QA 4C01A 4O08A 2PUJA 4E46A 4CIBA 1OXMA 1MN6A 4A16A 2Y6UA 1TCAA 4IH9A 4DNPA 4BZZA 2PKYX 3CXUA 4Y2VA 1UT6A 4PSUA 2BCEA 4BRSA 1K5PA 3WKEA 3AINA 2B20A 4ZGBA 4OU5A 1TK3A 5AKLA 2CZQA 5A7HA 4U2FA 1UK6A 1H22A 3PI6A 4QDTA 4B85A 4BCDA 2JIDA 4Q3OA 3PDCA 1H2XA 4IH4A 4INZA 4DMKA 3A2LA 3TEJA 2JGIA 3WK9A 4DIUA 5JALA 4Y2XA 1ZGCA 1E8NA 4GDMA 4ZXFA 2HA5A 3WLAA 3C8HA 3KWFA 1QIIA 4K6HA 3D59A 4FHZA 4EY6A 5DYWA 2XQFA 1EI9A 1ZIXA 3R3VA 3R41A 1XRMA 2BGNA 5AKZA 1R9MA 4U2EA 4WJLA 1SFRA 4HRYA 2WHPB 5ALTA 3FVTA 2AJBA 1WB6A 2ORYA 1DU4A 1CR6A 3IB3A 5LZ9A 1PJAA 1ACLA 3E3AA 4W1RA 1CV2A 2OQVA 4DTCA 4L0CA 5AM5A 3LCRA 1XZFA 3IDAA 1QIFA 5A7FA 3YASA 5HF6A 1QIHA 2XUDA
chains in the Genus database with same CATH superfamily
4YP0A 4TTVA 1VL1A 1C30A 3A6ZA 4M88A 5E1MA 3REFA 3LIIA 4YJGB 2QYSA 1UIMA 1XZQA 4Y6OA 5A0FA 4DLLA 4AUEA 2VBFA 1TLFA 1KZ4A 1RACA 2J0VA 1CUWA 2BFDA 1T43A 3JYPA 4FYYA 2J9FA 4FLMA 3NTXA 2FCAA 1W30A 4Y6QA 3VH4A 1MXHA 2QTZA 2JGJA 4IIEA 1JT2A 2G6TA 5CGQB 3TBFA 2A7XA 1QFXA 3QVJA 3N2KB 4O2LA 5LYYA 2FHSA 3I61A 5FEUA 2PCJA 4R5HA 1FPMA 2EP5A 2FW9A 1YR1A 1IXSB 1NJ6A 4YXFA 3UMGA 5KYKA 4BIMA 2WG2A 5I5GA 2CBGA 3MTJA 4XRGA 1ZICA 5FBQB 3EXHC 5LXTA 2GB4A 3EF0A 3CLTC 1DUVG 2HMAA 2VTVA 1E9BA 4JSTA 2G4LA 2HCJB 4II7A 3A36A 1BQEA 4AF7A 3SQXA 2IHJA 4JB8A 1T2FA 2QAIA 4TQAA 5BQXA 2AC7A 3LQFA 4C7OA 3VR6H 4NV3A 3QU7A 3K0AA 3DP9A 4MWGA 1CDEA 3QTLA 4QJBA 2FSHA 5F2KA 3X1ZA 2ZWOA 2OBXA 5TT0A 2QN2A 4O2RA 5ICFA 1T6XA 4KH0A 4MITA 2OCGA 3N7UA 4PXAA 3VSAA 4FOSA 1P0FA 4G1UC 4LMPA 2XCQA 3OTHA 4DR7B 4RK6A 4NS1A 4PPQA 4KR0A 4TKUA 4RMHA 4JODA 2QX9A 2HHCA 4G81A 5H83A 3UAGA 5IM4F 3BF8A 5DT9A 1FYXA 3L8FA 5AW5A 5I01A 4BO5A 1C7EA 3PQDA 2PJDA 1FS5A 4CKWB 5ITVA 1W0KD 5CJPA 3ZVLA 4F0JA 4RX1A 2A6PA 4TMVA 1OAOA 1PK9A 1AV7A 1G3IA 3G5AA 5DFAA 3T3NA 5TLSA 2YRFA 2CXSA 2VDPB 3PGLA 4CG1A 1DOZA 2BFCA 3CLUD 3E2IA 3LQ1A 4GEKA 1FNCA 3V7UA 4LWPA 5TVKA 3INGA 4J16A 1LV7A 2CLSA 3LBYA 4YP5A 4DLWA 4QE3A 1L5MA 3SZRA 3IXMA 4IHJA 1E2DA 1UJ2A 1XMVA 2AS0A 2XWJI 3IVMA 1LFDB 1OSNA 2FSFA 3M3HA 1AZWA 2BGRA 3Q8WA 3ED5A 3Q0IA 4ZCSA 4D81A 1LJUA 1R2QA 2PK3A 3H1FA 5KJCA 3QKIA 1V26A 2YXDA 4ZJYA 1NMSA 1QTIA 1SUDA 1WDTA 4CM8A 3GPDG 2X76A 3U3ZA 5KDOA 3HG7A 4XPIA 4R1SA 4GE0A 5DGIA 2G67A 3D3QA 3KYDA 3OCWA 2NUBA 3ESRA 3KOUA 4HUQB 4IUDS 1FX0A 2QQ5A 3GFBA 4I4LA 4PYKA 1NN0A 5GMOA 3IO5A 5C46F 2Q5EA 3LYUA 4JL6A 1PK7A 1HE1C 1MPXA 1Z18A 2IE8A 3GLHE 1UF9A 5HXAA 4X85A 3PXUA 5DCLA 4ZT3A 2QP3A 3OLVA 2JKZA 4W7HA 1CXZA 1X1CA 3PHCA 5I4BA 1IVNA 2PZEA 4K2AA 4Y2GA 3ZWWA 1FYWA 3UMBA 2JAHA 2JFGA 1LU9A 1TD1A 3NVMB 4NEQA 5AMXA 5AYVA 3GWGA 4DILA 3BOSA 1YGYA 1P75A 4GMHA 4AG3A 4DBVO 1H2BA 1R6TA 4PGMA 4CEJB 3A9TA 1E9RA 1JILA 3AV0B 4HB2A 2PL1A 2I80A 3ZGLA 5JXJA 1HE5A 4ZI5A 1MU0A 2AVDA 3KDAA 2BMAA 3JWGA 4ROSA 5GJVC 3SBOA 5IK2D 1CERA 5GQSA 1SVNA 4UBJA 3E7DA 1FQJA 3P8ZA 3QPUA 1Z36A 1G55A 1Z7WA 3L6CA 1Y8AA 3DZFA 1XELA 1D4FA 4P81A 2A9QA 3IH5A 4E08A 1ZFNA 3N70A 1J8QA 4EF6A 1Y4ZA 1OI4A 2VCHA 3AONB 4RK7A 2ZYHA 3IMKA 5FADA 5IBPA 4CZ2A 4LXGA 1E9FA 1APBA 2WVAA 3S7TA 4CTJA 2OXTA 5LU9A 2HA3A 1PVVA 2JEZA 4AJJA 1QWOA 4N3AA 4M0KA 1B0ZA 2I3GA 1LK7A 4IOMA 5T5QA 3THWB 3ZQJA 4LGVA 4Z8YA 4ZT5A 2VEOA 2QL9A 1G6OA 4CN8A 2UUOA 3CURA 5H80A 1G18A 4EHLA 1L1EA 1WDKA 3ML1A 1XROA 2FPIB 4EKGA 3PEUA 4YECA 4XGNA 5K3FA 1MQSA 1XJWA 3SFTA 1QH8A 1UMCB 1O1YA 3GUCA 1I24A 1N4DA 1YXMA 3TLCA 2FY8A 1GVNB 4ZOLA 2WOOA 4C03A 5ARBA 2W71A 1BXZA 3LUPA 3C7KA 4BVLA 2QTCA 1E2EA 3NP9A 4C2BA 3KQNA 4KNWA 5A62A 1KDVA 1R5JA 5TS2A 1JKXA 4KO4S 4V0LA 4CMEC 4BKMA 2GCOB 3HXMA 1WETA 5IN4A 4FOTA 1I6LA 3OURA 3VPCA 1RVDA 1XLWA 4LRQA 3DDUA 1TIPA 4E5NA 5I9TA 1YQQA 1ZPDA 3SZUA 4NDAA 4AKTA 3WLRA 4BE9A 1J8DA 3MD9A 3AU8A 1DEXA 2HY7A 3FAKA 5IUNC 2UXBB 2EW2A 3RVPA 1VB5A 5ICCA 3I0MA 5CGZA 2OKCA 1KYVA 3NHFA 2GF0A 1R9GA 4ID9A 4XM0A 5DNEA 3UK7A 3QBTA 4B46A 1KKUA 1KQNA 2ZAMA 2C78A 3D3WA 3D6TB 1BVHA 1FFBA 4DNQA 3NHJA 1CZOA 3V00A 1O0SA 4X9XA 1K7YA 1GQQA 5CTAA 4FMPA 3UJNA 3SS7X 4WDQA 1XTBA 5C5EA 2G1PA 1OXUA 3PP8A 4G4SO 4JEUA 1LW6E 1HT2E 2JIMA 1JDZA 4HO1X 4LFCB 1OLXA 3GVCA 3P1JA 5IYZB 1GAQA 3EZGA 4ZV7A 2RBGA 5BUZA 3ZWMA 2AJCA 1RPZA 4M0FA 1N77A 2O1SA 1NPYA 2ZP1A 3FWZA 4JQSA 4HNUA 4ZC8A 5JYEA 3DQPA 2P9TA 2ZSEA 3H5VA 4DXHA 4N39A 4DB4A 4L5YA 1IUKA 4TMYA 1XLTA 2RKBA 3FD8A 3EW9A 1KRWA 3LI2A 4IX1A 3OESA 2H1IA 2H2FA 1N5RA 3ANNA 3MFYA 1KR5A 1PEDA 3PUVA 4J91A 5FV7A 2JIQA 2HIAA 4NBLA 1XV5A 1PR4A 2AG8A 3IKLA 4H1WA 3KZKA 1MENA 3PRYA 4MEBA 1GYPA 4P98A 2VZ8A 3CLHA 4H77A 3OQJA 2J07A 4I99A 4GUDA 3NDJA 2IV7A 2XMBA 3IURA 4KLCA 4KMSA 2R97A 4JOSA 5EKDA 3NFYA 4FBLA 4JJ4A 2VJDA 3N8HA 1LRLA 5JECA 3E23A 3NUZA 1MW9X 3NGMA 2L17A 4GW3A 1FY2A 1BH6A 1RABA 3JARB 4QBTA 1LNZA 1RI4A 2BL4A 3FMIA 3K1ZA 3I9JA 3KWJA 3AB3A 5JCOC 5FOWA 1GPWB 4NZPA 2OFPA 3KU4A 3R7FA 1Y3CE 4B3SB 3TKAA 2WB4A 1IG0A 1R8SA 5HK8A 3CCBA 3IAS6 4X45A 1KU0A 1N0UA 3H4IA 1BOFA 4CT5A 5I7RA 2EW1A 3FTPA 3V4SA 4EHJA 1AX9A 1ZN7A 1IN7A 1ZRNA 5J9FA 1O7JA 2HSEA 1ORTA 3KHKA 4K9MA 3RRNA 5IFKA 1JIKA 1QR2A 4WKPA 2H18A 3UKJA 4KAFA 421PA 3NPAA 4ZV4A 2ZIUB 2PS1A 2HRCA 4FFPA 4ETWA 2YYZA 5E7JA 3D3NA 3H5OA 5GV7A 5J40A 5K2OA 3OM1A 5DK4A 4D41A 1B1AA 1MJNA 5AI9A 1C0PA 3PT5A 1M5RA 3U9SA 4NBWA 3HKDA 4IDGA 2V0CA 2HBQA 1V71A 1P1HA 3LY9A 4ZT6A 5FIUA 3T1NA 1KAHA 1MTZA 2X8AA 3P4UA 1CHDA 3SNHA 3CFYA 1G38A 1KQPA 1P7VA 4GI3A 3L4KA 3I04M 3ND7A 2F59A 1CZHA 3L8DA 3VM6A 2V4ZA 1FDOA 2QU7A 3GWZA 4MRRA 3QF4A 3SQOA 3IELA 2GK4A 3V6LA 1SPXA 2FMXA 2H52A 4DBLC 4DMGA 5CEFA 4LTNA 3W2EA 2B92A 5JH7B 4KG7A 4ND2A 5CX4A 1NONA 1KE2A 2NU6A 1FU4A 1WVMA 5FPKA 1CK4A 4HJRA 3ZH9B 4EMTA 2A1IA 5FI5A 2ID7A 4X84A 2YY7A 1XT6A 2GAFA 5EXDA 1EK6A 5LFAA 3HN7A 1MT3A 4BNGA 4I50F 4X3OA 1GTG1 4ZFNA 4JGGA 1JZQA 2XNDA 3ROTA 1G6HA 3QXCA 2YV5A 1ZHHA 5CLGA 3O1JC 3PEVA 5H02A 1WY7A 3DHEA 1K6IA 3LL7A 1XTVA 1BW9B 4G5RA 2HW8A 4AN1A 1X2EA 4WN9A 4RPLA 5F2EA 2J0SA 4X7BA 3V8VA 3OQ6A 5AFSA 3OJCA 4EAAA 1YFZA 1T3TA 3ECCA 5BSTA 4OLAA 1E58A 3ZXYA 1NSFA 3EG9A 1QK4A 3IHKA 4P22A 4QFBA 3DZBA 1YJXA 4QOJA 1B1CA 3H8VA 3DEYX 2WJ3A 4ZRMA 4ACAA 1IJKA 3BK7A 2PH5A 4AY4A 1JKMA 3SN6A 3I2GA 3JU3A 3RRXA 2BGKA 2PN1A 3VPBA 2ECFA 3HL4A 4J0CA 4WZ6A 2G04A 2BT4A 2JK1A 3QW4B 3DDZX 4Q7LA 2WJPA 1YJAA 4AWBA 2C92A 1QK5A 3L82B 3DGFC 4EUSA 1OBVA 3MAAC 3O8CA 5CAEB 1ML3A 4GNRA 3AR2A 5CVCA 2F1JA 3VBEA 1R4NB 1HNWB 2EZUA 3E84A 4OPMA 4MI3A 2VRCD 4WW0A 2FSSA 4UNQA 2B4YA 1LNQA 5JO9A 1P60A 4HFNA 4GP9A 1M10A 3OT1B 1K3TA 1R50A 4N41A 3C5CA 2ZB4A 4O2BF 1DC7A 2J6BA 2WU0A 1NVVQ 1RQGA 2Q4TA 3G13A 4RESA 1DKQA 5IC5A 2M32A 3UFBA 2Z08A 4XWKA 1L5FA 3FOAA 3GT0A 5K8CA 4BUCA 1VXOA 4H4DA 1YJ8A 4IAOA 3DDNA 1V8ZA 2XECA 3B1ZA 3EH2A 3S8MA 3OQHA 4QTXA 2N42A 2G1AA 4DSZA 3K9WA 3TRIA 1ZNYA 5JSYA 4B3GA 3G8BA 1X7DA 3C6ZA 3G7NA 4P38A 3G7UA 3OC0A 3IUYA 4U9UA 1QH1B 1QVZA 1VCIA 4UUMA 2XUAA 3A1FA 2EFJA 5D6NA 3SC6A 5DZSA 4PLWA 1HF3A 5ED0A 2QMHA 4DGSA 4EDHA 4DW8A 1R8XA 4CLRB 1VJ5A 8ATCA 3AKDA 3AMVA 1DG1G 1H3FA 1DAKA 4LJRA 3RS4A 1Z82A 2ZYAA 2O5VA 3WP0A 3GRVA 1AD2A 1I7QB 3HM9A 5DB4A 1RMQA 3OETA 4J0IA 1E2MA 5I7OA 5K0BA 3L7CA 2FQXA 1ZOLA 2J3JA 2J5BA 4QGBA 3UJ9A 4Q1EA 1I5EA 2WT8A 2CLIB 2ECPA 3F7MA 4TV8B 1TYDE 4QTZA 5COQA 5L3ZA 3ANXA 3DE1X 3UJPA 1F3LA 1EE9A 3LX5A 1RZVA 5AXAA 4DA6A 1HPLA 1VE3A 3H11A 4YP9A 1Y8RB 5BUCA 3EFOB 4JLUA 2JK0A 4MWSA 1H0HA 4QJIA 1JIJA 2E4UA 2NP7A 2IBMA 2VI5A 1V7QA 2PZBA 2CB9A 3AP3A 2G9QA 2NTJA 3H5IA 1BTOA 2WJVA 4M0DA 4PV7A 1M5TA 4RSMA 3DMTA 1FDRA 1P6QA 1PV2A 1KJ9A 5P8WA 4A1OA 1L5VA 1U3UA 1G2OA 1II8A 1E96A 4BRZA 2QB5A 3QGMA 2I9PA 3TG2A 3W3AD 1Y8RA 1PYGA 3H9GA 2RHGB 2F8TA 3B5IA 1X42A 2ZYSA 3EVFA 1KO4A 1WE2A 2ZQYA 3PNSA 4W5NA 5I45A 1FFXA 3VZDA 2N1BA 1G8FA 3DZGA 3FF4A 3PXBA 4E2FA 5F5LA 1TM4E 2P9QA 4QA9A 2O2DA 3ADPA 4FUQA 2IYXA 4MIKA 5EP2A 5EHZA 4PCLA 3A0UA 3JZIA 4PAGA 2XDQB 3C2QA 3EGIA 2A9RA 1P18A 1AKUA 3GEPA 1XXLA 2B1JA 3AUKA 4U6QA 3G79A 3RUFA 1PJTA 2ZDGA 4PX5A 1VYTA 4P7GA 5LOVF 1N1EA 4YMHA 1T5OA 3SKVA 5C31A 1FE8A 4BO2A 1L7AA 2XXJA 3GRPA 1UXOA 2FDCA 4DMFA 1RTTA 1KJWA 1Z6ZA 1P0MA 1Q1NA 1H2RS 1W88A 1XQWA 2JJQA 1USGA 3CRQA 4L4YA 2XCTB 2XMPA 4Q3EA 2W6MA 4LHYA 3IIEA 5E1BA 3C85A 3ORQA 4IO1A 4E30A 1Z6GA 1ZCFA 3QWFA 1CNFA 2ZANA 4KQ1A 4U3JA 3G59A 2DXIA 2HXGA 3CX4A 1UAGA 2VP3A 5IWCA 1S8AA 3OBIA 2WIFA 4E4RA 3EULA 4QFDA 4QZVA 4H3SA 4IX9A 3GP3A 4TTIA 3B8HA 4X64B 4A36A 2LV8A 4U7GA 3FMVA 4E94A 1Y9EA 2LPMA 1Q0LA 3I34X 2QUJA 3IR7A 5D1NA 2CHEA 2EKZA 3ZHOA 1C81A 3EPRA 2QR3A 5FBRB 1A9XA 4FI3F 5KMGA 4C89A 2W8ZA 2RI0A 2PR2A 1KH2A 3BM5A 4RJ2A 1V6AA 3WB2A 5BQ3A 1X1EA 2CFOA 1OHHD 1DXOA 1U6JA 2RIPA 4WBXC 4QBKA 2GWHA 3CY6A 3GGOA 4F85A 1UFRA 2REQA 3OIUA 3CW9A 3BCRA 5I7EA 1XEFA 2O0MA 3H9UA 2MR6A 2ZT5A 3DKPA 2F2TA 4J9VA 2JIOA 2ONYA 3KSAC 2W6NA 3ENVA 1QYRA 4ZYXA 4Y6SA 5I9NA 4ND6A 3T41A 1O97D 1KNQA 1SOAA 4ML3A 5EKUA 5HS4A 4BL5A 2CHVA 1BU5A 2WG0A 2P4SA 3FRIA 3KE8A 3A28A 3MAGA 4BWGA 4KQ6A 1T6YA 4CUZA 2C94A 5AVUA 1ZH6A 3LJKA 3OC6A 4FONA 4M0MA 4RVDA 4EDFA 2X42A 1A82A 1VBNA 3EHEA 4OLHA 3VXKA 5U9CA 3UBMA 4CEIA 3FAZA 1YF3A 2JGLA 1ZMTA 2P8SA 1Q77A 4KQEA 4ZCIA 2XAAA 5K0GA 2Z5VA 3IDOA 1VYUA 5K8JB 2A9FA 1Z0DA 1XHFA 1I6MA 3ZNNA 5HIAA 2IXAA 5JYCA 3L0ZA 2V8BA 2WM2A 1W5BA 4L4RA 3KEGA 4AIRA 3N0RA 1J06A 2I6FA 1IC6A 2IOQA 4C7VA 4US2R 4RDCA 4N7RA 3P4XA 2ADOA 2V74B 3L8HA 4WZZA 1D2HA 3VOAA 3ZHVA 4EEZA 3R8FA 2PIDA 2W2XA 4OSOA 3I6IA 1B6GA 3TR5A 1RLMA 3MWGA 5JXHA 5CA0F 3C7DB 4DUGD 3DE6X 3GYBA 4QLBA 2C2MA 3KQQA 1UK8A 4AY5A 2PUHA 5JAMA 5A4IS 1DJPA 3M4JA 1POXA 1ZGHA 2PPVA 1OI3A 2ZSIA 3PNBA 1RRFA 4LDNA 4PPNA 4MGHA 3L92A 4MYTA 4S2UA 2WF9A 5F1KA 2OCBA 1R8QA 5HCIA 5KNBD 1FRNA 1RBQA 5FO1A 3SSAA 2WE8A 2AOVA 4W7SA 2C84A 3Q3GE 4ZVPA 3LVFO 1QDEA 5K3BA 3RQIA 2QPTA 5K01A 2J5KA 2VDWB 3T7DA 4ALJA 2BUBA 4FZJA 1KTIA 4Z7JA 1F4PA 4MCJA 3ICPA 4I08A 2OO3A 1Y8QA 3SMVA 2YKGA 3WMWA 3M9LA 3CZQA 1HLDA 2DQSA 5C4IA 3U3OA 3LX4A 4TKVA 1ZU5A 4B80A 2DKFA 2JGKA 4UBIA 5DJ5A 3CRVA 3EZ2A 3TLZA 1T2VA 3L4EA 4IQFA 4IXTA 4BFTA 2V9PA 2RAPA 1X14A 4XUCA 5DDIP 4TM8A 4QG7A 3ITNA 2O9JA 3E7PA 2IOHA 2DVMA 2VK2A 3K0KA 1PT8A 3F46A 2PJUA 4F96A 3AHGA 2BHTA 5G4KB 4E7OA 4Q16A 5AHOA 3TF5A 3IS3A 2VA9A 3GD5A 2WJIA 2DUJA 4HQ0A 5DBOA 1DJNA 1Q11A 1T0UA 3DO6A 1T3ZA 1DBQA 3AM4A 1I36A 3II6X 3LPCA 4HDOB 5JC1A 1P8AA 1WIWA 2D62A 1E1QA 1NTOA 2QZ9A 3HUTA 3CM0A 3E35A 3BD7A 3C5HA 2OHJA 3ZU3A 2R6R1 3ETCA 3JQAD 4O3MA 3HP4A 4B7XA 3EXFB 4IVPA 2GZAA 1N6OA 2OXRA 4KAAA 2R00C 1BN6A 2JCXA 1V4VA 4C5BA 5KHLB 5ILGA 2Z4SA 1UXJA 2P69A 4QULA 3EDQA 2OY0A 3CVJA 1C8VB 4RK1A 3VJKA 4B4OA 2OAQ1 2F43B 3CG4A 2ZRMA 5JWOA 2GD1O 2VDKB 5REQB 4DZTA 1C8KA 4I5IA 1VECA 4NENA 4NZMA 1J0EA 1WMAA 3ZLBA 2WJZB 3RVLA 1OWNA 3HA5A 3GP5A 3CRMA 4EG3A 4KNYA 2D5AA 3EQ2A 3EYWA 3LLCA 2CLDX 4HGOA 3N6RA 3VAYA 3WLLA 3A6FA 3CN7A 1HDYA 4ZO9A 1IE3A 3BIWA 3L02A 3SYLA 4WOBA 5CCDA 3OTIA 3ZWVA 3ZWAA 4WASA 5KTKA 2VHQA 2AFVA 4OLJA 5AJYA 1QIKA 1SRRA 1T26A 1CE8A 5B6PA 2P3LA 2GCOA 1NBAA 1NI4A 1GTVA 1NKSA 4U39A 3TTWA 2OLEA 5F1PA 2VP5A 3ROMA 821PA 2F1KA 5FO0A 1XP5A 3VJLA 3ZX4A 5LD2C 1J0BA 1RU3A 1MAAA 1O94C 4JSYA 1MFPA 1R4NA 2R1TA 3B1WA 4ZPXA 5CVJA 4L5AA 1NUQA 3OTOB 4FVTA 2D06A 1XCOA 1KVUA 4NQRA 2A57A 1UKBA 3V34A 5G4KA 5AM3A 2X3UA 4M3NA 1EDDA 1K0UA 1Z8FA 2DUUA 1Y89A 2J09A 4FDAA 4GZ3A 2X0EA 1Q6YA 1RPTA 3FFXA 4H1VA 3RS0A 4RZIA 1EJBA 1V0JA 1M2VB 2X1HA 3NETA 4MLCA 5FNVA 3ZV5A 2W2VA 2HWUA 5CNKA 2W6ID 3BXZA 4BV9A 1OWMA 3OEHA 5B53A 1AHPA 1J7KA 4X95A 4KSYA 3E1SA 4K9RA 1YU9A 4NYJQ 1WCIB 3QFSA 3UA4A 4B73A 5BSRA 1QVWA 2YWXA 1K63A 3KFLA 4HDQB 1W6UA 4ZZ2A 3CSUA 3OBBA 1EDEA 2QIOA 3VVMA 3W2TA 4AJ9A 3EPJA 4G0WA 5DM1A 2D3TA 2NIPA 4Z3OA 5TV2A 5DIFA 5TMBA 1PW5A 4O33A 3UJBA 3A1SA 4RHXA 5JE8A 5SY6A 2WZQA 3KKOA 3NHUA 4KQHA 3PXGA 2FRDC 4OHXA 4DV0B 3COWA 2WIJA 2ZETA 3DE0X 1XNJA 3FZEA 1M8PA 1EQAA 4J8PA 1RPAA 3T6KA 3TZCA 3A2MA 3LXMA 4RZXA 4X91A 3KQVA 3R7WA 1OAOC 2PM8A 4BFXA 3KOYA 2ONKA 2GKOA 4WZAA 1BKSB 1PLJA 1T9HA 4MVYA 2KPOA 3LX6A 1ODJA 4LJLA 4WFJA 1TADA 1MPTA 1XN4A 2CUTA 3H99A 1VKNA 3WLKX 1CEYA 1EWYA 3KFXA 5DHQA 1TU4A 4Q9DA 4XIYA 2WB2A 4HAZA 5AJXA 4DV2B 1SBCA 5A9RA 5BWCA 1WLYA 2GA9A 1ULSA 3IP6A 4DIBA 5J4YA 1II0A 3BRSA 3PC4A 1AMUA 2OK8A 1ZD2P 5CDGA 4E1AA 2ONZA 3H2HA 4R81A 4Y2TA 2VIIA 4R16A 7ABPA 4A6DA 4PC3A 2GN0A 4BE7B 3NC1C 4PHHA 3LCMA 1UH5A 3F73A 3G9TA 1UDCA 4YC7A 4XDZA 2NV0A 1I3CA 2Q1SA 2QDKA 1V4BA 3ONNA 1NOJA 1QR6A 4P84A 4TS4A 2OO5C 1BX3A 1S1MA 2OFOA 4QDKA 4LJ5A 5HDQA 2V8OA 1SA0B 3H4MA 5BYJA 1XGKA 4UJ5A 4BU0A 5ALKA 3X43A 4HNSA 1XXHB 3X1MA 1F8UA 1ZHFA 4NENB 4YGXB 3EHDA 4A2PA 1QVAA 5B2EA 3GVXA 4UAGA 2NWQA 3HLKA 1U02A 1GAJA 4M55A 1H4SA 1JPJA 1GGFA 1Z4IA 1K98A 1KI6B 3E5NA 4FDUA 4JQCA 5A4JA 5AQ1A 4PC2A 1J8MF 3MJ4A 3B78A 1J8VA 3A9SA 1WKCA 2OHOA 3ZY6A 4CKWA 3ZCRA 4DGQA 2JA1A 1TKRA 7GPBA 3C39A 4S12A 4LK2A 3NM6B 4JJ6A 4GI7A 4MAFA 4ONEA 5E1DA 2BY4A 5HZKA 2H9AA 1TI7A 2F1OA 1ZKDA 4L75A 3MGKA 1GPJA 1FFCA 3R5HA 2REOA 4I5FA 1XU4A 1K3FA 1YMVA 4QPCA 2D7DA 1JZTA 2WYHA 4M1KA 4RC9A 4PE5B 4OATA 1E2BA 2IYUA 1K06A 2BD0A 1U3CA 3GJ8A 5CB0A 1Q57A 1W1UA 3DV0A 2PZJA 3F97A 2CSUA 1N9GB 4O1HA 4X20A 3H8SA 1KQFA 4BWFB 5JAUA 3VPFA 3KZXA 3T9EA 3D3KA 3ZJTA 1CD5A 2AFRA 2II6A 2ZTVA 1V9CA 4YROA 1G8MA 3AIIA 3OZSA 4WCFB 3Q4GA 2A4KA 2XNJA 5F5NA 5G4LA 3KXIA 3QU9A 1OXBB 3Q1KA 3RARA 2OG2A 2KW5A 2WYOA 3D5QA 4NSNA 2H65A 2P9YA 3EXIB 2PYIA 5KQSA 1T15A 3SLKA 1S2OA 2LGJA 1RI2A 3ZDQA 4G8CA 1EA5A 3PQ4A 1BVUA 1EXVA 2DWQA 3GJ7A 2I2DA 4OD0A 1D9ZA 5AKHA 4UNRA 3NIFB 3DCNA 2P9CA 3QU4A 2G70A 1ODSA 2QA5A 1MO4A 2QJWA 5CT4A 4IO0A 5H5JA 2OESA 4L3VA 4CKEA 1U9JA 4MS4A 4G67A 2RC6A 1K5DA 1U0RA 121PA 1KI6A 2FX2A 3FPHA 5A6SB 1TRHA 1I1QB 2RG7A 2SCUB 3A1EA 5LNK1 3NJ8A 5DXAA 3F2IA 5DI9A 2BRUC 3PPYA 3QLTA 1AGYA 3G2NA 3GFTA 1DGQA 3B1KA 4YT5A 1ECPA 1PKXA 2WUDA 3ZGYA 3ZLJA 3UWMA 1RYNA 5DYTA 3GEHA 4QODA 2FPMA 4P34A 2DT8A 5IT0A 1NLUA 3TQOA 4E09A 1V1MB 1VRVA 5ILQA 4YT4A 5DASA 5DYNA 5GJWC 2MYTA 2Q5JA 4YRDA 1DARA 3UNXA 5I51A 5JXGA 5LWQA 1H3NA 5ESRA 4A0HA 3ERCA 3LSYA 5ESDA 1Q2XA 1U7HA 3NBXX 3UKOA 1BXRB 3COJA 1Q21A 1YVDA 1KR2A 4L3OA 2ZBQA 3KKQA 4URYR 2KBFA 3SEFA 4AO8A 1OBOA 1Y3BE 1Q17A 1UODA 1XIVA 4BLVA 1S96A 1UDAA 3JZDA 1QLWA 5JYDA 4Z4EA 3D8TA 4B82A 3QFCA 3DCYA 2SKCA 2HGSA 2ERCA 2XJ4A 3UAWA 5AW6A 2QXYA 3DC2A 5LIRA 1KOLA 2C5GA 4MWEA 3U44B 4HS9A 5C8XA 1RCTE 1UBHS 2G3YA 3B12A 5GV8A 1QZ3A 1U31A 1DKMA 1E2JA 3R76A 3MCVA 3AY3A 3N8DA 4IIXA 4MUGA 1GITA 5K3SA 4FXPA 3RVOA 1GHTA 2YJGA 2BFMA 3ESBA 2BBOA 1E6KA 4EB8A 5CBPB 4CEHA 4UDXX 1P1RA 2DU8A 1HEUA 1LBTA 4Q1FA 5LMZA 1Z2PX 3B36A 4TLEA 1JTFA 5BMVF 2WMYA 2E87A 2ZJ4A 1XO1A 1USKA 4JU8A 4QJ3A 2FXVA 1CE8B 4IBOA 1UKZA 5I7AA 2GXAA 4FDVA 2GTPA 1AM4D 4WH0A 3A3KA 1RMTA 2CUZA 2GK7A 4LC0A 5KWVA 3ICQB 2BM0A 5KYUA 2YJ5A 1XDUA 4CF6A 4DRYA 1ZN9A 4LK3A 3FDZA 2PMWB 4MS3A 3U4CA 1C0LA 2YNMA 1UWVA 3TN7A 1TQDA 1U3WA 1YA6A 4P4NA 5HGJA 4RULA 4Z9AA 2G82A 3CTPA 4DM3A 4H7FA 3ZJYA 5AW9A 2QTFA 4PBRA 3BC1A 1SKYE 4PQEA 1BX1A 4ZYUA 3I62A 1QH8B 4HR7A 4QDXA 4DPMA 2ZTHA 3HTXA 3ROQA 1W73A 4I1UA 1X86B 2I2WA 2R86A 4FS8A 1Y1SA 4UOEA 3OQBA 1BVRA 1NAHA 1M2FA 1MVLA 1QG0A 3O8LA 4UULA 4XI9A 4YB8A 1SWVA 3BICA 1FLAA 1VKHA 5JNVA 3WA7A 3DHYA 1PL8A 4WKCA 4AWXA 2AOTB 3HV0A 3HUUA 3NXKA 3LHSA 4RKQA 5I7WA 1YVRA 3BTUA 2QX4A 2ENUA 2NO7A 4AX8A 5LJIA 1G6Q1 1N8KA 3D2CA 1LLDA 3BK1A 3CG0A 1CUHA 2CNKA 3EOAI 1P4HA 2JD1A 2KMLA 3F7NA 3FSGA 4OXKA 1LJ8A 1TB4A 1TGVA 3AGPA 2FX5A 3QKTA 4UTRA 4S04A 1PGQA 2J7KA 4DUYB 3GJ6A 3QWHA 4PYMA 1AQNA 2JGRA 1M2WA 5AP9A 3FYDA 3TH5A 3WLSA 3AM1A 5JADA 3DOUA 2FKNA 4JBNA 1V1RA 3LVQE 1LTQA 4XGIA 4HNVA 5KJ6A 2GESA 3TJZA 3MWJA 2G9RA 1U11A 2PXCA 4CFYA 5JISA 2ZBRA 4Q3KA 5HEKA 2W4IA 4K0KB 3GJRA 3A10A 4I9UA 3PGVA 3CLSD 3ZOZA 4HBGA 1K88A 4JBLA 2MINB 1DLJA 3KAKA 4RD2A 3GZNA 3RB8A 3OSZA 2R44A 1ZJZA 4F3YA 3PNVA 1LC3A 2C3OA 2C2OA 3E9CA 3LQ4A 5ALOA 4FILA 3EF3A 4ZVOA 4UTZA 5I7UA 2ZSKA 1KVQA 4D44A 4ENVA 4D9CA 2DQKA 3HSKA 1PWHA 4PG5A 5FTWA 1GGHA 2PGJA 1JMYA 1Z0SA 3GPBA 4G1VA 4BX0A 4BVGA 2OBLA 4A8PA 3K6SB 2XB4A 2VWPA 3ZHXA 4CM8B 5A5DA 3NONA 4BMOB 1HEYA 1FB5A 1N5IA 3GNSA 1P2FA 1RC8A 1IXYA 3CT4A 1M2GA 4PAWA 4ZDWA 4JOBA 1B8NA 4CW7A 5CYGA 1P5JA 3FGOA 3HJCA 3BTSA 1DAPA 4KQXA 4OOEA 1WY5A 1AN9A 4N9QA 1T1EA 4OGFA 3U0VA 5AM4A 2E1PA 5FUMA 1Z3IX 1HKHA 2G5PA 4LIPD 2IIBA 4PFKA 2DB3A 1WHSB 1DKUA 2NUPB 3FM9A 5FCDA 1VJ1A 3ED1A 4GG1A 4MVJE 1K9VF 5IKPA 4TYPA 2HA0A 4ZVQA 3LD9A 3AUAA 1F5SA 3DVAB 3GIDA 4F60A 1M8GA 4LPKA 5BSKA 1W1IA 3OPYI 1KMMA 3GDWA 5JAQA 3NIWA 1GCAA 2RHBA 1J56A 4YXWA 4YJ2B 4BU1A 1EINA 3PUHA 2YBEA 2C1EA 3JRWA 3UYLA 3VR6A 2FE1A 1TJPB 4PYNA 3EQ6A 4OUDB 5CPBA 4QYIA 3O3CA 5F12A 4P0PB 1XDWA 2I3AA 3RVNA 2UZ4A 3NMUF 5JZ9A 5A9TA 3TW6A 4Q1AA 2VDMB 1WTAA 3O4FA 4IOJA 4M8IA 2HMVA 4DG5A 5LP6B 4DXDA 2BGUA 1BDBA 4G0QA 3DOOA 1TW3A 2WM8A 3IDSA 1DTWA 3V33A 4E4YA 3EYAA 1FFYA 4C2TA 5KYYA 2HHLA 1QRUA 3AF6A 1Z2CA 3B1JA 5LOVB 1QE5A 3THXB 3T99A 4ZAGA 3K9BA 3KM0A 1HYBA 2HQRA 2J5RA 1R4AA 4BN0A 1WEKA 4X44A 3AEZA 1XMJA 4HSEA 3RKRA 2A88A 1B2RA 3HJUA 1T4DA 4KDFA 1KOFA 5BWMA 3QXHA 1NYTA 1FNNA 5ER9A 2J3EA 1QWSA 1L7EA 3H1EA 1RAIA 2FEWB 2QVZX 3QHQA 1OYOA 4BPRA 2FPKA 1DDIA 2WD9A 4BMZA 4DUGA 4JUFA 5CB4B 5F9FA 1E3LA 3F0TA 5THKA 1IHDA 3KQPA 3W7BA 5L3QA 1NW7A 1ZUWA 3ZHYA 3ZY2A 4B2YA 5DF1A 2NLOA 1Y63A 1NVAA 4XSVA 1SCDA 1MG5A 5EJ5A 1CB7A 4K6CA 3RPEA 4JLNA 1KIAA 1I2CA 2AIRA 2ZIXB 2QSZA 1DAGA 3PKZA 3K2QA 1EYZA 4N49A 4V2IA 3ZVMA 1QQBA 1HDRA 5T4HA 1HO3A 1ZM3A 4D0SA 3R0XA 3RFCA 2GEFA 4CIYA 2I1VB 2IEBA 3JD4A 2ZUFA 4OB7A 1L6IA 3O8QB 5LNK6 1Z5ZA 2WLTA 5DBEX 2VRBA 1NI4B 1RE0A 1FRVA 4FWTA 4JU9A 1I2BA 3ZHCA 3HO6A 3WK5A 1BJTA 4ZOQI 4E2YA 2PL3A 4ZJUA 4O4IF 1M8KA 4C0BA 3UJ3X 2PPLA 1A97A 1D1TA 1UADA 3Q5GA 2PWZA 5JOQA 1UKEA 1QAMA 1YQUA 4KE7A 4U7TB 4UU1A 3R6TA 4KI7A 1V8OA 1O6CA 4R1MA 5IAEA 1GZ7A 5IW8A 3ROZA 5EJ4A 1BGVA 3HZOA 4HF7A 5TS3A 4YJ3F 5EWMB 2AT1A 4I2VA 4PTLA 2A5FA 2C96A 5FWDA 3HDJA 1GL9B 2G40A 1PEYA 1EBFA 1GGKA 3Q98A 1ZNZA 4OIFA 2ZSJA 4YJDA 4GS5A 1X19A 3FX2A 3RT9A 1ZXBA 3DFFA 2FPGA 1O8BA 4KMOA 4OUKX 4CCWA 4EQ6A 3T4EA 1QAOA 1Y7IA 5FBZA 1CQZA 5ECWA 3FNBA 1W76A 1EFAA 3QE2A 4WOKA 5HG0A 2I6QA 4PPGA 3E4CA 4V1CI 4GC9A 5HE9A 4E21A 3PE6A 4KO3S 4F45A 1SU6A 4P93A 3RIMA 2ZT7A 4O4JB 3S40A 2RDMA 2QUZA 4YT2A 1D2CA 2CLFB 4JUIA 1PT9A 1U9CA 4IH1A 1JUDA 4NYMR 4YAUA 3NVDA 5IFLA 1YSCA 3PEYA 4ZHSA 2IYSA 4DV5B 3RSFA 2C9YA 4F2HA 1OFUA 1YNSA 1N3IA 3OZBA 3L1JA 3V4PB 3HYLA 2LKDA 1U7PA 1MZPA 1O95C 3LP5A 2JRLA 2VPWA 5AW1A 1OFGA 1W8IA 3OU2A 3E9NA 2MSKA 4MI1A 2B61A 3F98A 3HCWA 5CA1A 4Y8VA 4JHLA 2BEWB 2WSBA 1GDTA 1D2EA 5FA8A 2IU3A 4OQZA 1NF2A 3AIOA 4TLBA 2WSSD 5ALZA 3H9QA 2J0QA 1EX7A 4X63A 4AXXA 4MV0A 2UZAA 5KSPA 3L6DA 1V37A 5CFNA 5KOJB 1XZAA 2CXNA 1N8NA 3PUYA 2HCRA 3K6KA 3R3YA 4CKCA 1U6KA 3AR6A 3QELB 1K8RA 1YOVB 2OAP1 1JHVA 1CQPA 2Q4EA 3GJYA 4BNZA 3JQGB 1W49A 4RD3A 4KNVA 2IDZA 4XQ9A 2RHCA 3JYQA 3QEMA 3EASA 4FMCF 2R751 3NIDB 4F38A 3PQ5A 3ZVNA 3QVGB 3U49A 4UM7A 2OQRA 2R00A 1ID1A 1P62B 1F12A 2ZRQA 1U7TA 3QP9A 3QUAA 4R84A 4V0OA 5D51S 2H7VA 3K94A 2PLWA 2XTNA 1DBPA 4B6OA 3FOEC 4E1VA 1D5WA 1C4WA 1FMCA 1F6WA 1BJRE 4I50B 2X2PA 1QS0B 3HO8A 3CH6A 4URXR 1AQIA 3G2LA 1K8XB 1IOVA 4LNUA 1CU1A 2VYVD 3MQ4A 1JWBB 3PXXA 2B5OA 1WCV1 2VTKA 2YCLA 3A25A 3OT5A 5EZYB 4C78A 1GNPA 1MABB 4RV5A 1P2TA 2YHUA 5JH7F 3GLGB 2PMFA 2ZG6A 1J33A 1QC5B 3IUEA 3F6BX 2GT1A 1JQLB 1PBNA 4KQWA 1YR9A 3OZCA 1MB4A 1YQDA 2Y0DA 3LWNA 2WINI 5JJCA 2Q6TA 5HUHA 1ZGAA 2B3DA 3E7FA 2ZITA 5TJHA 1SUCA 4YX9A 2QN6A 2RGRA 4QHSA 4RKRA 2PE5A 4HEJA 3WNDA 4FYKA 2C59A 2C5LA 4CM5A 1ISSA 1Y33E 3PQEA 4MULA 1DBVO 4V02A 1U7DA 4F9TA 4F5DA 2HT1A 4QOSA 3IT1A 4JUDX 2H1LA 2WMOB 1CHNA 3KC2A 4GEGA 1R5OA 2DULA 3S81A 2PJZA 1WZ2A 3FRHA 3I39X 2ODQA 4IGFA 4WCFC 5A03A 3TUIC 4IHQA 4QQFA 3TR0A 3AOEC 4BLRA 4O3FA 5IPFA 4YK7A 1TYCA 1N0VC 3OQ1A 4JUAA 1AKQA 4KLRA 1RCUA 4IICA 4NONA 2OD7A 3DPUA 3UFXA 4EI7A 4DKXA 4RDHA 1X7WA 4FHCA 1LBQA 4JVSB 1SOWA 5FL7D 2BFBA 3SBEA 2BJVA 4CT4B 2J9GA 2WFLA 1ZOPA 4W8GA 5AHXA 1NRIA 4BY9E 4QNRA 2BUAA 5IBRA 2NYUA 4YRFA 5ICGA 3L0IB 4QVKA 3VU9B 1FW8A 4YP6A 3TNYA 2Z2XA 5C81A 3JQAB 2B4RO 1C7IA 4YQYA 3T7IA 4YS6A 2OCIA 3UCXA 1Y6JA 3JR7A 3KB2A 3W4KA 4OAPA 3ZUPA 2YINC 3UHJA 3HJAA 2FVXA 2KM1A 5COAA 2HNAA 1YOBA 2ZT6A 5GOTA 5THQA 3TE6A 1P7WA 4L5BA 1PJ2A 2XUPA 4AZVA 3DE2X 2WUEA 2DT5A 3KWLA 1P0PA 4G0XA 1LS6A 3TTUA 3IRUA 1CJMA 2IUYA 2R65A 3BIOA 2I1LA 3QEKA 1WMSA 2IHKA 2W48A 3IAS1 1B0AA 1V11A 2EZ4A 3H1AA 4PRZA 4Q5IA 1QGED 2XOKD 2HPZA 1IU9A 2XNKA 4UW9A 3RROA 3KJFA 1VGVA 2WA1A 1CJKC 4MVJD 4TSKA 4RCYA 2PVSA 3QE4A 1JI3A 1PR9A 1S3FA 3DTTA 3O0TA 4UAJA 5FPHA 3GQBA 3TQQA 1SM4A 1DTEA 1SG6A 2C2GA 2WMNB 3QRWA 1R37A 4LTMA 2BZSA 4E70A 4ETIA 2P6OA 5DWDA 2RBKA 3HY3A 1PTKA 3L8EA 4RVUA 4WHMA 5IYZF 3B9QA 1WPQA 3G8CA 4P86A 2PMDA 3K16A 5AR1A 3VNQA 3VYUB 5LD2B 2A35A 1N6KA 4UAUA 2VWGA 1XMXA 1SVIA 1SBNE 3PDJA 3PTZA 4A3SA 1J39A 3KHUA 4R3WA 4XPIB 1WHSA 2NUPA 3DAGA 4BX9A 1QO0A 4F97A 5EA2A 1NGSA 1BDHA 4DLBA 1HNZB 3DBLA 5BRAA 4KR7A 4NMXB 3P45A 4MINA 3F8TA 1MAHA 3M6MD 4QT4A 1S7GA 1IHOA 1WJGA 3FTNA 3HA7A 3D4OA 4Q37A 4C05A 5TQJA 2CLHB 3WQBA 1HYQA 4FQ5A 4DBLE 3F5DA 1B6TA 1R0LA 3K53A 1WXXA 2AD5A 5DX0A 1Z4JA 2ADMA 2ZKLA 1SIBE 1CUAA 3R0QA 3R0IA 4KIUA 4YACA 1G19A 1NATA 3H13A 3RT7A 3ER9A 3I2HA 1H94A 2C7VA 2P2DA 2H5IA 4B2LA 4OYLA 2FZEA 2ZRJA 4O2AF 4XFDA 5T4FA 5PGMA 3DEZA 4B6PA 1IUNA 5KYYB 3EZYA 4L9AA 2HSDA 3LCVB 4OL0A 1LZLA 1DUSA 1KO1A 4PS0A 2H3HA 1OPRA 2H1FA 2V3VA 2XTAA 3RC7A 1T5DX 1C9MA 4D42A 4N0MA 5E6UA 2HLDA 1DC8A 1P9OA 4IWYA 4LYFA 3FYHA 1NWCA 1T5LA 2FZCA 3PVZA 4GWLA 1JR3E 4Q3DA 3EPKA 2WPDD 4Z9XA 1F0NA 3A11A 1NQUA 2NVBA 2XUZA 4JWKA 4CDRA 1CS4C 2VTDA 3H6HA 2CVQA 1FFWA 2GLTA 4X60A 5EJEA 5K0FA 3JD3A 2QG4A 3VO8A 4EJSA 4YUZA 4UEJA 1EBBA 2ZWVA 4KITB 1PT6A 4UVIA 2EDCA 1TVKB 3G1TA 1ETHA 1C4KA 1AF4A 2WKQA 4GI2A 5H3HA 3ZX5A 1R74A 1TYBE 4EO4A 3RYCA 1AA9A 1TMYA 2QMZA 1NJ5A 3AEKA 4O0MA 4ZEOA 1ZK3A 3T3OA 1SH7A 2ASEA 2EJCA 3P32A 2JCVA 3U6KA 2OFWA 4QDUA 3OQOA 1XRJA 1UAAA 3LIPA 4RK0A 3TZLA 2J30A 2ZDHA 1K4YA 2H5EA 1E6UA 1KPGA 1ZIPA 5LP6C 3PDHA 5CA1F 2JGNA 4XEHA 4BBAA 2A1UB 5K05A 4QVIA 2K7ZA 5AI8A 2I54A 2NXNA 1Z8HA 2I7XA 3WDMA 4UOQA 1KK2A 3U17A 1FA9A 2A0KA 1M1ZA 3TFWA 1MW8X 4FB5A 3ZNQA 4YR9A 2B4KA 3WFZA 2GJSA 4DSUA 2XR1A 1M1YA 1A8PA 5HDBB 3S28A 4N48A 1J21A 4OA5A 4G8JA 2IOYA 2IUEA 2JBHA 4Y1RA 4G0OA 2N3ZA 2IPXA 2D5CA 4DC9A 2AZDA 4DCVA 1JJVA 2FF5A 1T5IA 4J0HA 4Q4HB 1QLJA 5KNBH 4ZD6A 2Y0CA 4NCHA 5FPPA 1IWOA 1LW7A 1QHHB 2IZ6A 1Z0UA 3OJXA 1CF9A 3LYLA 3RJ9A 2EV9A 3PC6A 4JBWA 2QMOA 1DQYA 3V8MA 4CE6A 2I4OA 3RRFA 2W2PA 2YZNA 3Q0EA 2QW8A 2F43A 3AEUA 2OHVA 3BIJA 5F76A 1XNRB 3DBRA 1E6EA 1YHNA 4FT2A 4HDMB 2Q6IA 4E5PA 3TS1A 5HWSA 2QY6A 1QGZA 1S6YA 3FTDA 2JAPA 1JEAA 2I29A 3LC7O 3DDHA 3GDGA 3P0EA 4GU5A 4N40A 5AXCA 1SCBA 5BN5A 5JW6A 1A72A 1C1DB 1PGJA 4IEEA 3U7FB 3PWZA 3TIVA 2D13A 3IEUA 4TGLA 3HLYA 2J6IA 3P9KA 4NOLA 5G1NA 2TSYB 3ZGOA 3QVTA 1U2EA 2E1RA 3FKSA 4Z9FA 3HUDA 5CA0A 4B6EA 1IOWA 2AQ8A 3D5TA 1AC5A 3C43A 1GZDA 4L8FA 5BQPA 3RUHA 1AK2A 4GL2A 4BKPA 2WJJA 4IR7A 5IP5A 1NW5A 4LXXA 1GN9A 2PZMA 2GKGA 3HYRA 4ZEWA 3WWEA 1NJFA 1BMDA 2R1TB 4RIIA 2RGCA 3IT2A 2HUPA 5DBHX 3ZWOA 4W5RA 1J5XA 3O0DA 2HFKA 5H59A 4MLPA 3SGLA 4AROA 4B40A 3AJ8A 4ZVUA 3T5PA 2C31A 4HX5A 5BN3A 2FDRA 4RGYA 1FBTA 2GN6A 4WZBB 2PR7A 4MB0A 4MROA 4Z8XA 3WWYA 2JC3A 3HHEA 2ZWAA 4LV6A 3T95A 4YCSA 5LMCA 3TL6A 3L5OA 2HR1A 4D9EA 1ZRSA 4G4SP 4PXSA 1PHRA 3T4UA 1ENOA 4D8XA 1PLKA 1C7ZA 2CFIA 1U0FA 1YIAA 1CQIB 2Q9AA 2YZ7A 3THYA 5ALSA 1G63A 4JJKA 1PZXA 2AE1A 1ILWA 3FR7A 3QKSB 3RFVA 1NW3A 4HDSA 4CLXA 1WX1A 5F23A 1YRWA 3R7DA 4DKJA 5A5VA 1RLIA 5C3UA 2PLNA 2PSDA 1EGHA 5E6SB 5D2CA 3TZBA 1CEQA 1GPAA 4NFHA 2X0IA 2HJWA 4KPUA 2JCSA 1FTYA 3B89A 5U4QA 2ZJ0A 2VSOA 1CUDA 1I1HA 1SBIA 2FEKA 2IEGA 2XADA 3PFIA 1GZ3A 1HG0A 3N2LA 1S5PA 4JL5A 4WJKB 3CCCA 4HPXB 4RYLA 3K0CC 2OWDA 3CJQA 4AMGA 2R6GA 1IHXA 2FFHA 3NBUA 5MN6A 5COBA 4PZLA 2EFYA 4Z7NB 2ZXUA 1UDRA 3GCDA 3KEOA 4GX2A 3DC7A 5IVKA 3W2GA 1ZOOA 4AI6A 1ZLYA 1WUJS 3ZIAD 1QGUA 3SC2A 2FUG6 3NHPA 2GSWA 5JXWA 3GGDA 2PRIA 1EZZA 1L8QA 4BO7A 1OT3A 3TAHA 1T13A 5AK4A 3IBTA 4LJAA 3P2JA 1OH6A 3R0VA 4K86A 2H63A 1N0HA 3S27A 1N2GA 4J6EA 4JJ7A 1VLHA 1W19A 2PTGA 2JZOA 4PICA 1CUEA 3W5IA 3EZ7A 4MUYA 1V3TA 1ULTA 2YJ4A 4QU5A 4Y2QA 5CURA 2AN4A 3K0HA 4Z0HO 1XEAA 2X8WA 5IT5A 5KCZA 2C07A 5IYZA 2VRCA 3UM9A 4AJ4A 2NNLD 4YRBA 1G9SA 1ZN2A 1R16A 1JEOA 2XDAA 1EEXB 4N5DA 4G1FA 4D92A 3EVCA 2OZLB 4GX0A 5AKXA 1NY6A 2AC4A 1MDFA 4YUXA 2ZM5A 1D6MA 3H2JA 1T0HB 1YB6A 4GWKA 2YRXA 3ILYA 5JSUA 1KY4A 5HRUA 4RM3A 3M5PA 2EYUA 2COUA 1RHKA 1RP7A 1KI2A 1O9GA 2ZAIA 4MB6A 3M4XA 4PF1A 4TROA 3TRHA 3U3MA 4MV7A 3TECE 4DZZA 3PQCA 1VYHA 4R6WA 1NKVA 1GNSA 3FKSD 3GZJA 4XWAA 3TIGA 1HC7A 4ROTA 2ZI7A 3NAQA 2Z30A 4J6FA 3OT4A 3RTDA 4D4IA 1WHTA 2EWMA 1U99A 1P74A 1ABFA 2JI8A 2HADA 2ZSHA 3IHTA 3KQOA 2VZ9A 3PD1A 4XX0A 4QO8A 4TUYA 2XT6A 3SZMA 5K7SA 4JVOA 5AI5A 3NYIA 1R10A 2OCLA 4D9GA 2BFNA 2P7HA 2HA7A 1IZ7A 4FDTA 2OFFA 1Q22A 4D4JA 4IDDA 1HE4A 3ONWA 1I0LA 1UPFA 2DHCA 2HOQA 5IM4A 4Z4HA 3A3NA 4DR3B 2IE0A 4OV6B 2PJRA 2CVOA 5IN5A 5LJLA 2A8YA 2LNDA 2QD1A 4N18A 4P8RA 1LXCA 5JROA 1NC1A 5L3SB 5HJ5A 5FUBA 4ZC1A 4PZ0A 2JVJA 2L2QA 4CI9A 1JAZA 3A4TA 1KY2A 1IY2A 3PUKA 1N1MA 2XCOA 1RYEA 1SCIA 3VC2A 3ND9A 4HB3A 4XVCA 5B36A 1TUIA 4A7PA 1QX4A 5BYKA 1ARZA 1AZSC 2AR9A 5DN9A 3N2YA 3NTUA 1EHIA 5C2JB 2P41A 3BCUA 4RKFA 4IV8A 3AI1A 4B76A 1GQSA 4G4GA 4GLFA 3BHIA 3B9RA 1XD9A 2PSJA 4FW9A 4INPA 3LUCA 4HZUB 4R8VA 1E1CB 3BAZA 4PSCA 1GPDG 2DKNA 2LZ0A 3FJ1A 4AIIA 1UJ4A 1CUGA 2VDWA 3ONVA 2QN1A 3KPJA 1N7HA 4Q48A 2IYZA 4MJ7A 3H2YA 1AKWA 2G71A 2ZIGA 1U0TA 4PZCA 1NXOA 1OXXK 3M0EA 3CZRA 1NMEA 3HBFA 1SQ0A 2RAVA 1JQJC 2Z56A 4FEGA 5HJ2A 3FCXA 3OZRA 1C1XB 2XQIA 3EUFA 1QGYA 3C8UA 4R51A 3K8QA 3Q8MA 3J7TA 2XMSA 5L95A 3STUA 4EVSA 1MT0A 1T0BA 3TBHA 2QXTA 1GQYA 1P2SA 1L5RA 1ZONA 4PSKA 4F2DA 1N7IA 4P54A 4GSLA 3WP1B 3M6UA 4CQMD 3IKJA 1B73A 2XZTA 2O52A 2QRUA 4LBZA 1UFKA 5GGXA 4C0XA 1FF9A 1M6VA 5ULLA 5J63A 3PTLA 1L8XA 3OCJA 1NP6A 3OJWA 1QYCA 1W88B 4LSGA 2BFWA 2XUFA 2BMFA 2R3SA 4G63A 1Z62A 1KEWA 4JV5B 1D4AA 2KS6A 1NE2A 1P77A 2IOFA 3EWSA 4HD8A 2HMSA 2HCTA 4IFEA 4E5YA 5LOVA 4FINA 5L7WA 4L2IB 1E4OA 2DWCA 4B09A 4KVFA 3KS9A 4DIEA 2ZCUA 4HAVA 3ZV6A 4UDNA 3P9ZA 1B6RA 2AL7A 1IQPA 4BB0A 2MYNA 1T8YA 1ST2A 1NA5A 2E4ZA 2BHNA 1RYBA 3BA1A 4Q4AA 1V3VA 3ANSA 1PF7E 1A4XA 1P5ZB 2YY5A 3ELWA 1LEHA 1JWAB 1L8LA 4MKGA 4MPDA 2W2OA 3NYRA 2P6UA 1EFCA 5TARA 3A6HA 4ZAYA 2FLWA 2Q2WA 4H3KB 1PQPA 1RJGA 2WSIA 3CR8A 5F77A 3V48A 2LRHA 4ZU6X 4EA8A 5KOHA 1SUEA 1I5OA 2WICA 1MQAA 2XUJA 2WF5A 3VZQA 4UHHA 1RM4A 4ABYA 1XJQA 1FRFS 1ZG3A 4Z49A 1P2UA 5AW4A 2BZ0A 5MFZA 4ITUA 3ICEA 2GZHA 1IOZA 3JQAA 1GNVA 2YXEA 5AM1A 1JF8A 2GQ0A 4KO2S 3PJRA 4JXZA 2GHTA 2MU1A 1SUBA 4ZZIA 1E1QD 1PW7A 2ZGVA 4ZYTA 5EHXA 1OW3B 4B7AA 4H2DA 4KKXB 4CFZA 4ZEMA 5EJ8A 4XJTA 1UKVY 3GLIB 3KEFA 5I3CA 1E2LA 2GZRA 3E3NA 4DWOA 3X1YA 2FAXA 2IBTA 3ETDA 1FMFA 2JB9A 2FB9A 2RB5A 3QZUA 3ZK9A 3V8NA 1KK0A 1FDWA 3QFTA 1F7UA 1IN1A 2ZR8A 5JWHA 1UMBA 1YO6A 2WWWA 4ILKA 2X3YA 4JBGA 2Z98A 1JI0A 1JTEA 1A5BB 1R15A 2HU2A 4I4TF 3QUSA 2H59A 2WC1A 3IMCA 1C8LA 4U9IS 4Y2RA 5DTRA 1UJBA 2WYIA 1ND5A 2WAAA 2XYRA 4L27A 4FYIA 3Q9NA 1GZVA 5E38A 4HT3B 4DDTA 1NUHA 1N3YA 1F06A 2YX1A 1VHLA 2O0KA 2NSHA 1E3EA 3RW9A 5K8LA 2AUTA 4S1VA 1K5HA 4DTIA 2QVCA 3HXOA 5KKCA 1J6UA 2RH9B 4INJA 1XVIA 2A78A 3H6KA 2JI7A 1M8FA 3QA3E 4OXNA 4XCXA 4YRQA 4QSMA 4ZAXA 4DS3A 5BT8A 1OB5A 4J3JA 4WK0B 3RYIA 5GAJA 2V45A 2ZIVB 3C5VA 3K9LA 4PCVA 2ZS9A 2HA2A 4JR0A 4XCVA 3AJEA 3NHMA 4KAJA 4MQMA 2ZR9A 3REGA 3S29A 4BTEA 3LBIA 4J0GA 1ESCA 2QPLA 2CD9A 1OTHA 1IEVA 1PBTA 2UAGA 3A26A 2GVDC 3MTEA 3JR3A 4WADA 3WK7A 3RBXA 3STVA 5HTKA 3SJBA 5CFRA 2VF5X 1GADO 2QVLA 4Q15A 1AOXA 3WRVA 3KELA 2ANCA 5F7XA 1WBBA 1JPNA 1MO5A 4NJEA 1E7QA 5ALVA 3O4HA 3KJXA 1DRUA 2YQ4A 4GH5A 4DY6A 2WHPA 1JAIA 1TZMA 2RG1A 3AF1A 4HQKA 2QD2A 2OL4A 2Z1MA 3M6IA 2CKMA 4RF2A 3RSOA 3F6RA 3NI2A 2EAUA 2QD4A 4N0QA 5AVJA 2EKQA 4DDMA 1DRKA 1E4VA 3AETA 1SEVA 2Y2UA 1DMRA 4IIJA 1AH2A 2VJQA 5LQKA 1E1YA 2I55A 5JPIA 3VDRA 3IHWA 4QKQA 3RUCA 3KHSA 2C9MA 2OO7A 3JQFC 4W5JA 1E3QA 2JLSA 4UCFA 3PQ2A 1NR5A 2UZIR 4KQIA 4UARA 5DEIA 1YC5A 4B3BA 5JJIA 3ZXXA 4Q7KA 3U2QA 1MFZA 3H04A 2EQBA 1JA1A 1SZCA 1P0QA 1ODTC 2P75A 2XNCA 2XOEA 3MTAA 1WMDA 4GVPA 4GYKA 2CJPA 3MPOA 2FQQA 4BKQA 1NBEA 4Y2PA 5LIPA 1ZD8A 3A6KA 3B5JA 4OVKA 2GZMA 3GLUA 4UFNA 1LDBA 2K2WA 4QQKA 4TN5A 3U7RA 1IVYA 1JLLA 1O6FA 3KQLA 2VBIA 4C0WA 5ALJA 2BGLA 1ULHA 4M36A 4KGDA 5A3QA 2W6QA 4OKNA 2I2AA 2QLMA 4MK4A 3VV2A 4MW5A 2PANA 1RRPA 3VNRA 5IXJA 4HEA1 4L28A 3GARA 2O7RA 4K9LA 3VSEA 4PANA 2WVJA 3VOSA 2QJTA 3ONDA 3E5MA 3MT0A 2J7PD 3T9BA 4O2AA 3EXG2 1Z17A 2BEUB 4GR4A 1C50A 1VGRA 1DO2A 2QDXA 3V5NA 1CIVA 4D4GA 5C8YB 2GX6A 1U8UA 3BKXA 3BT7A 1UZUA 4ARSA 1GPKA 3VVLA 1NHWA 1KHTA 1LBSA 2YMPA 2IITA 3BTVA 1KI3A 4FD3A 1ZM2A 2DECA 4MVJI 3KXKA 1OU0A 3OFVA 1ZI8A 3EXEB 5BWBA 5LU8A 1X80B 3A14A 3N0XA 2C4KA 4KC0A 4PO9A 2ZUCA 1UP4A 1NW4A 5IH7A 3VC1A 2XZDA 1VKJA 5IKOA 1XWFA 2GEDA 3QITA 1W59A 2MWMA 4A6PA 4UTPA 2R2GA 4ZMSA 4Y3UA 2FW6A 3DBLB 4U5QA 1Z0ZA 4ZA2A 3Q6MA 1IY8A 2VWQA 3CWCA 4NBNA 1ZNXA 3QV2A 4XVQA 1MZVA 3WS7A 3JZAA 3NXSA 4JC8A 1RYMA 2WHEA 4PWZA 2VHVA 1U9IC 5DV9A 2GNPA 4O5AA 1GGJA 3QJGA 2HRBA 5ETJA 5T6MA 5CITA 1T8WA 5IAOA 3U56A 4MHTA 5K5EA 4ZAVA 4DA8A 4JGBA 2JIRA 5KNDH 4GBGA 1E99A 1Z63A 4MTLA 3FNFA 4R2IA 4EEXA 3NHKA 5FWYA 3R6WA 3GLGA 4O02B 1LPAB 3KQSA 4V03A 2W11A 4JSRA 2QN9A 1NP3A 3KT0A 3TOVA 4W1SA 4RVGA 2R1ZA 4OGGA 2JLBA 4JYZA 3QUCA 4YLGA 3UC5A 2B37A 1L6RA 3KHTA 3NZEA 5EPUA 4LDRA 5CYPA 2EIHA 2GFQA 2QLNA 1XMPA 3LP6A 4HP8A 3RUPA 1WW3A 3RS5A 3R75A 2CUNA 3B6KA 1RBYA 4L5JA 4W5WA 4KXYA 3LUFA 1LVHA 3BEOA 3MUNA 4P4LA 4JJGA 3PGA1 1TF5A 3GELA 3ZWXA 3SM3A 4EI8A 1W85B 3VDNB 4ZDIA 5LKAA 1QX3A 1C0KA 1V8PA 2PT5A 3HWRA 1MRZA 4F5ZA 1L7VC 5IAKA 1HT1E 4NATA 2FJPA 4AU1A 1NN5A 1I0IA 3DFKA 3WHPA 4EEKA 2W42A 5E1OA 4ER3A 1QKJA 1AS0A 1SUIA 3OA2A 1X39A 4DLUA 4BFVA 5DTIA 3U4AA 1L9KA 3C5EA 3WKDA 3MGBA 1S9HA 2BTQB 4I50A 3P20A 1SOUA 1A96A 1W25A 3STWA 2QNIA 3PXEA 1IBCA 1RKVA 1AZTA 1PT7A 3EWAA 5BN5B 3NEJA 4ZI3A 5JAIA 4WKBA 3Q3IA 1BDMA 3CSDA 1DT3A 1P4SA 4C0SA 1BA2A 4HGYA 2B1IA 4F93B 1W4BA 2Q1XA 2VXBA 2EZ8A 2H06A 3PA6A 4OGKA 5JRZA 3IERA 2FA9A 3SHFA 3I73A 4KQJA 4WBNB 3NBQA 4O08A 2IHNA 2PUJA 3QELA 3PR3A 1SG0A 2F9FA 4E46A 3CTMA 5JR3A 2R4UA 2Q45A 1NV8A 5AESA 3L8YA 4Q19A 3KPYA 4MUMA 4AG5A 5HIMA 3O94A 4A16A 1FYFA 3NHLA 4ZQCB 1TCAA 3TLAA 1ISFA 2XSZA 4R1QA 2PKYX 3UHOA 2F3SA 1MORA 2JLZA 1XCPA 1YDGA 4KUEA 4MKHA 1VTKA 3CW2A 1SVSA 1DAHA 3AFOA 2R48A 3FXAA 3OU6A 1SQ6A 5TR9A 1HRDA 1NVVR 3O47A 3PX2A 3Q2KA 3RRMA 2PXAA 1JQKA 4C21A 2ATIA 3I9V1 2BCEA 1K5PA 3HVUA 3RGWS 4XWOA 3VQTA 1K7XB 1YZUA 3BB3A 3AINA 3PVSA 2O2SA 5CXSA 4B5LA 4OU5A 2YFKA 1XTZA 2P30A 4KSBA 3I58A 4OA8A 4CJXA 3PFFA 5AKLA