2NW6A

Burkholderia cepacia lipase complexed with s-inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined X-ray diffraction and QM/MM study of the Burkholderia cepacia lipase-catalyzed secondary alcohol esterification
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Lipase
total genus 131
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nw6A00
2WTNA 3FOBA 2WJ3A 3AZQA 3G0IA 2H9YA 2JGMA 4W1QA 4UHFA 3VVLA 1JI3A 5JARA 2HADA 2BFNA 1YS1X 2H1IA 3H1BA 4UBMA 4NZZA 3AZOA 4H7FA 3DQZA 4YASA 2XUIA 4DNPA 4QWWA 4H7EA 5JAHA 3LLCA 4X3CA 1QTRA 5DYTA 1YCDA 5HQ3B 5FLKA 4KYVA 3QMMA 4UHBA 1R4ZA 3ICVA 5HKBA 5DYWA 1B41A 1P0QA 2GYUA 3WA6A 1CR6A 1UKCA 2HRQA 4G8CA 4FBMA 4X6XA 3WL6A 2JGJA 1ORWA 2B61A 3I6YA 5LKRA 4Q05A 4WDQA 3STTA 3STWA 1LGYA 1WHSA 2XUPA 2PBLA 1XRMA 1D07A 3GFFA 3TJMA 1GQRA 5HFAA 5AKEA 1JU4A 3FYUB 3R40A 4QNNA 1XZLA 4X93A 5E2IA 5JAUA 4UFPA 4DLNA 1CVLA 1CLEA 1AKNA 1XZKA 1CUIA 3BDVA 4H7KA 4QDOA 1FFAA 2XMSA 2JEZA 3I2IA 2XMQA 2DCMA 3F67A 5JATA 4C6HA 4B80A 3Q8WA 4Y2YA 3WWEA 4X71A 1MAHA 5DYYA 5I9IA 4EBBA 4PV7A 1WCYA 5K3AA 2XUOA 4OUKX 1WPXA 1CUAA 1JJIA 1N1MA 1LBSA 3G9UA 1XZFA 4IH4A 3ZLTA 1E5TA 4H7IA 1GQSA 1IZ8A 2LIPA 3TRDA 2WU4A 3B5EA 2CZQA 4FWBA 2VTVA 4ROTA 5H3HA 1XRRA 2XUJA 1UK8A 3QM1A 4UHHA 3VVMA 1THGA 5ALOA 1FJ2A 2PSHA 2WM2A 2YXPX 5DTJA 2HU5A 2HU7A 1PV1A 1XKTA 4Y2PA 3VJLA 4BP8A 1JFRA 2VJCA 1QIMA 4B82A 3LP5A 5JAPA 5ALJA 2I78A 1ZD2P 1GKLA 1CUXA 4ITVA 2VA9A 5ALDA 1LLFA 3D4LA 4UUQA 3G0BA 2PX6A 4Z49A 3D59A 3F9CA 1MAAA 1EB9A 2WLSA 2OG1A 3GA7A 4QLOA 5AKXA 5KWIA 2GBCA 3D2BA 3V48A 5CURA 3VJKA 4XIIA 3B3QA 2ZSIA 5ALIA 2GYVA 3I6ZA 3I6MA 2VT7A 1JMKC 1QIKA 3LIIA 5ISMA 1J1IA 4TPKA 1EB8A 3A70A 2VJBA 2WIDA 1JJBA 2Z8ZA 2C5FA 4EY8A 2PPLA 4UBIA 1CUDA 1GPKA 4Y9SA 4F21A 4IO0A 4G4JA 4E46A 5C81A 2VAVA 5D6OA 1U65A 3DJYA 5CH3A 2C7BA 2CBGA 2G63A 1Z68A 3CN9A 3A6ZA 4WFKA 4KR0A 4I19A 4J0KA 1DU4A 4X92A 1NX9A 5SYNA 5HF6A 3HEAA 2XMBA 3OG9A 3O4HA 5FDFA 3FLBA 4J0GA 2WIJA 4D9JA 1R3DA 4J0CA 3E3AA 3FCYA 3ICWA 4G8BA 3WL7A 3H17A 2CJPA 1XZBA 3D2AA 4MEAA 5ALEA 4X91A 1CUSA 5IVKA 4AN1A 2V97A 2V9ZA 4DMFA 4BC0A 4GLBA 1G66A 2UZ0A 3L1HA 1IUOA 5JADA 4FLFA 2GBGA 4BDSA 3PUHA 2ECFA 2WUDA 4OB6A 1USWA 4AO7A 2ZYIA 5EHNA 1VZ3A 1P0IA 1WPRA 3I28A 4KAAA 1UOOA 3HI4A 4AO6A 2OGZA 1UOPA 4UBNA 3WLAA 2O7VA 2Z8XA 4K6GA 1VXRA 5LZ4A 2WIKA 1J06A 4Q1VA 4P92A 5ALYA 3OM8A 4H0CA 1Y7HA 1W75A 2OAEA 2FJPA 3ESCA 4L0CA 4BVLA 3PF9A 4X90A 3TGLA 4G8DA 3WYNA 3AIKA 3DOIA 1G42A 1AGYA 2QM0A 4CG2A 1CUZA 1X70A 1YB6A 4P9NA 3G0CA 2J3DA 2WJ6A 1QZ3A 5AO9A 4LHEA 4FMPA 1BEZA 1Q84A 2BUBA 1CUVA 5JZBA 1AZWA 5IVDA 1QOZA 2O2HA 3SX4A 2PU7A 1VA4A 5EHQA 1Y37A 3OURA 4AMYA 4GECA 4X7BA 5BWCA 2B4KA 4ZV7A 2WQZA 4U2GA 4ZV9A 5A71A 1DX4A 2ES4A 3BL8A 1MO2A 1R1DA 2ZJ6A 1GZ7A 3RK4A 2G5TA 3OC0A 4HTAA 1ZGBA 1XRQA 4BTVA 1JMYA 3WMRA 1C7IA 1MN6A 1QTIA 4JYPA 2WTMA 3C45A 3I1IA 3DD5A 3C87A 3G9XA 3GBSA 3KD2A 3UUEA 3WK8A 3OOSA 3AIOA 4A5SA 4K6HA 1P0MA 3BIWA 5AHXA 3KWFA 3E4DA 5E4JA 4BATA 5E4TA 4TGLA 3H0CA 3K9BA 2QKYA 1ZOIA 2C0QA 4NMWA 2P8SA 3NWOA 1XZJA 4XJVA 5AM0A 5ALXA 1SCKA 2R8BA 1U8EA 2HL6A 1EXWA 1HL7A 3WWDA 4PNZA 5AH0A 2VEOA 3LCRA 3W2TA 5CBKA 1E3QA 1ZD5A 3V9AA 1J07A 5JALA 2WJ4A 1G4HA 1L7QA 4FNMA 3LIPA 2WUGA 4OD0A 4K5QA 2JGFA 5AI8A 3IULA 4N8DA 6YASA 2CUTA 4KEAA 5SYMA 3M82A 2V96A 1P0PA 2HIHA 4X6UA 3BDIA 2Y2UA 1ZD3A 4BZZA 4E15A 5LIPA 3DL4A 4HXGA 3BJRA 5FP0A 4ZXFA 3AUKA 2GYWA 1ZJ5A 2OCGA 1VKHA 2DHDA 2OCIA 3S8YA 3ANTA 2V98A 2PVSA 1O6GA 4KE8A 1I6WA 2NW6A 4AZ3A 3G02A 4IHAA 2HHAA 3SWWA 4B81A 5CW2A 3ED1A 3QBJA 4X94A 2YH2A 3GELA 2QS9A 3EIOA 4HAIA 1MX9A 4P08A 1BEEA 3STYA 1YA8A 1ZI9A 4ZWNA 5CXUA 1VJ5A 4I3FA 4BVJA 1ZI6A 3A2MA 1Q83A 4DTCA 2B9VA 5HZGA 1BCRA 5D3ZA 3VDXA 2VJDA 2QJRA 5BV7A 1CIJA 4FOLA 2XQJA 4CCYA 1CUEA 3GZJA 4RE5A 2XQGA 4V2IA 5ALTA 1UFOA 3KWJA 3U1TA 1W4LA 1WOMA 1UWCA 4JNCA 5I7UA 3EF3A 5DNWA 4CCYB 4FTWA 3IUMA 3WIBA 2DSNA 3FLEA 3QZUA 4KACA 3KDAA 1MJ5A 4Q34A 1TKRA 1W6RA 1LPBB 2O7RA 1EVQA 3C6XA 3QMWA 3I1YA 4EY5A 1RP1A 4YX9A 3O9MA 2I3DA 2OAGA 3WKDA 1CQWA 2QMQA 3D3NA 3IUNA 1DQZA 1IMJA 4M0FA 5AKIA 5CT8A 1E66A 3O95A 2YASA 2VQ6A 3FYUA 4G1FA 1U2EA 3H1AA 1A8SA 1DWPA 4Y2SA 4QWMA 1DINA 4C4YA 2WFMA 1C4XA 3W9BA 3D7RA 3FYTA 2OGTA 4GWLA 5AIBA 4MYDA 4N8EA 3I2FA 4E14A 5HK9A 1L7AA 5IVHA 5AI6A 1XROA 4B0OA 2I3ZA 3PUIA 3BF7A 3PICA 2QXTA 3H18A 4BTLA 4Y2RA 5A7FA 4G9EA 1OCEA 3U0VA 5AKKA 4AZ0A 1VZ2A 4FDMA 3DLTA 1QO9A 5T4HA 4A23A 3FCXA 4CIAA 1BN7A 2C58A 5BWBA 5HKAA 3DEAA 4DMCA 5CMLA 3BXPA 3EQ9A 1QONA 4OB8A 4AX4A 1JU3A 3NUZA 4IQ4A 4Y2UA 1ORVA 3AIMA 4LIPD 2Y6VA 1EDDA 2WFZA 5LZ5A 1ETHA 2WG2A 1XZCA 1TQHA 4N5HX 4F60A 2ACKA 3EBLA 1G5FA 1LZLA 2XQIA 5JIBA 3G8YA 4UPDA 2QVBA 1XRLA 3DYVA 3STVA 2FUKA 4NVRA 5CXXA 2WKWA 1AC5A 5CT5A 1M33A 4KRYA 5EIHA 1EDEA 3C5VA 2GZRA 5ALKA 3RARA 3ZLVA 4HZGA 3ZPXA 2BUAA 2VT6A 3UUFA 4NS4A 4W1PA 1ZJ4A 4OB7A 4CIBA 1YR2A 5D3KA 3IUQA 3X3HA 1QFMA 5JD5A 1B6GA 4B0PA 3T52A 3IA2A 3CCBA 3G9TA 1DWQA 4X00A 3STXA 3AFIA 1ODCA 1SOMA 4Q82A 3TEJA 3A2LA 1VE6A 1GKKA 2BCEA 4UFNA 3ESAA 1SCQA 4M0EA 5T4EA 2JGEA 2XMDA 1BU8A 2PSDA 4EUSA 3W06A 5AOBA 2G4LA 5FPPA 2GBFA 2JIDA 2WHPB 3WYDA 2AJBA 4Y7DA 1EVEA 5KREA 1XQYA 4QDZA 4DM7A 1CPYA 2WHQA 3DDUA 2PM8A 5AKLA 1FFEA 3V1MA 4WFIA 4Y2QA 3C43A 4FNGA 3O4IA 3ILSA 2DQYA 3M81A 2WILA 4LXIA 1N5RA 3WWPA 5A6VA 5C8VA 1R9NA 4DMKA 2XE4A 3FYUC 4DGQA 4B84A 1WB6A 4OSEA 5K3FB 1LPOA 5A2GA 1MNQA 4BC1A 2XDWA 5IKXA 1T2NA 5D7BA 5AK6A 2XLBA 4GHWA 3IVMA 4KRXA 2WIFA 4BB0A 4KE6A 4UBJA 5HFNA 4H7DA 2XUAA 4BRZA 1LPNA 3HLKA 3UMJA 5JZ9A 4X97A 1EH5A 2XMGA 4M0MA 4H18A 5ALUA 4JH0A 3I2KA 4PQEA 3H19A 4QZVA 2AJLI 4WFJA 3VKFA 4GI1A 5AK5A 4HRYA 1MNAA 5EFZA 4B9EA 1XLUA 1AURA 1LPMA 5AI5A 1UK6A 5CT9A 4J0DA 4OYLA 5ALSA 1YB7A 1CUHA 1LBTA 3IIIA 4KE7A 3WK4A 1C7JA 1K8QA 2D5LA 5C8XA 3HRHA 1QIEA 1GXSA 2XUHA 5AI0A 1HBJA 4U2FA 1TIBA 2QUBA 5AK3A 3HABA 3HACA 4QA9A 1XKLA 2BGNA 1CFJA 3FSGD 2R11A 5BOVA 4PSUA 1UKBA 5JYCA 1YSCA 2XB6A 4UHEA 4MJ3A 1N8SA 5ALRA 4B7ZA 3QVMA 4GDMA 3I2HA 1SFRA 1QE3A 3Q0TA 4WDRA 3R3WA 2B20A 1W1IA 3O0DA 1QIJA 3D2CA 2QRUA 4QDTA 5CH8A 3SC2A 1CUUA 3W9UA 4GW3A 4AMZA 5AI4A 4E11A 1DQYA 5ALVA 4L9AA 3G0GA 1FFDA 3PFBA 4J0HA 1DT5A 4MWSA 2PUJA 5I8PA 1VE7A 3DKRA 4Y2VA 3WIOA 4C88A 1AUOA 4LXHA 3M3DA 3F96A 2XUQA 4I4CA 1R50A 3ZI7A 4L72A 4JYMA 5ALGA 4U2BA 5LP1A 3D5EA 4YPVA 1LPAB 1CUFA 5AM1A 3NOXA 4K6KA 3G9ZA 1EA5A 3F8SA 3R3VA 1MX5A 2CEKA 4MXDA 3ESDA 4DNQA 3RKSA 2AJ8A 3H2HA 1K63A 4EY7A 2I03A 1YAHA 3IB3A 1XZDA 1K4YA 3QPDA 3FWHA 4RNCA 2PUHA 2Z5GA 5AOCA 1CUYA 2HA0A 4G5XA 5IVIA 3W04A 3WA7A 4ZI5A 3R3UA 2IITA 5A7GA 4B85A 1J2EA 3AZPA 5HF9A 2K2QB 3H2GA 3VISA 2ZYRA 2J4CA 4PSDA 3IUJA 2ZVDA 1OXMA 4XX1A 5K3EA 1ZI8A 3AINA 4AXBA 3B12A 1BE0A 4X95A 2H7YA 3G0DA 2OLEA 1UK9A 1QIDA 1YA4A 1DT3A 1LPSA 4DSZA 4EHBA 2XUDA 4H35A 1UXOA 3S2ZA 5AJHA 3WJ1A 5FKJA 5ALHA 2XUFA 4MQLA 3K2IA 2QUAA 5A62A 3FLAA 2H7CA 1HLGA 3ZWQA 5JZSA 2HRRA 2E3JA 2GZSA 3JWEA 4X85A 2WUEA 4BVKA 1XRPA 5LZ2A 3F98A 3HXKA 5AI9A 3R3ZA 3V1NA 4WY5A 4FKBA 1ACLA 1ODTC 1UK7A 1XRNA 1QLWA 5ALQA 5DTIA 4U2EA 2OGSA 5DNVA 4AB1A 4UBOA 4BBZA 4MWTA 5CT6A 2JBWA 2C0PA 2C4HA 3WK9A 3FNBA 4J3JA 2RIPA 2OPHA 5FPQA 3CN7A 1XQVA 3QH4A 5AKZA 1XLVA 2PKYX 2QZPA 5HK8A 5ESRA 3F97A 2X8BA 5LLSA 1H2XA 4UFOA 3QPAA 4ZREA 2WG0A 1FFCA 1KU0A 3JYHA 4N5IX 3C6YA 3L1IA 4LYEA 3L1JA 1BCSA 2OCLA 1MPXA 5AM4A 2IX9A 2DHEA 2FJ0A 5EHZA 3QMVA 1E89A 1S8OA 5ALZA 4FBLA 5K3DA 2HA2A 3WL8A 5CH5A 2Z3WA 1R88A 1IVYA 1MU0A 2ZYHA 3WK5A 2XUKA 1PJAA 3WWOA 3WK6A 1XZHA 2QTBA 4B83A 2ZJFA 1R9MA 1CV2A 1EINA 2JGIA 5F4ZA 5K5EA 3EQ7A 3C8HA 5FRDA 4ZGBA 5KBYA 3MVEA 1VA5A 1CUJA 1GPLA 3PDCA 2FX5A 5FXMA 3P2MA 5K3CA 1HQDA 1O6FA 1WB5A 2HA3A 2XMZA 4Q3OA 1XZIA 3KOOA 4MEBA 3FVTA 3E0XA 4BE4A 1UZAA 1H2YA 3KXPA 4W1SA 4Y2XA 2XT0A 2CKMA 1F6WA 2Y6UA 5AP9A 1N5MA 1WB4A 3DKKA 2HA4A 3R41A 4XVCA 4TVKA 5CRIA 3G7NA 4WY8A 2H7XA 2RAUA 1EI9A 1RYYA 1BN6A 5LYYA 1QIIA 3H2JA 5DNUA 2VATA 3IDAA 2PL5A 4U2CA 4CG3A 2RHTA 3CXUA 1ZICA 4EB0A 5FUMA 2OQIA 1ACJA 3BF8A 2AJCA 4IH1A 5ALLA 4KE9A 4J7AA 2WHPA 1CQZA 1CEXA 3DYIA 1EK1A 3OPMA 3C70A 3DL7A 3N0TA 4GXNA 2WHRA 4X6YA 2VF2A 1TCCA 1WM1A 3D0KA 3O4GA 4UBKA 4BE9A 1HDEA 4DIUA 2YYSA 4BRSA 4KAJA 2EDAA 1GT6A 1X2EA 5AKJA 3YASA 2ORYA 4AO8A 4W1RA 1TAHA 5J3JA 5T4BA 4ARAA 1FFBA 2ROQA 4C4XA 7YASA 1K5PA 5LZ8A 3OTQA 5DLPA 4G4IA 1H23A 3C6ZA 4B6GA 3HZOA 1YS2X 4LXGA 5JASA 4UHDA 4CFSA 2RGUA 2Y1KA 3R0VA 1UT6A 4UHCA 4FFVA 4Y2JA 1QIHA 5K3FA 4BDTA 1THTA 2HA5A 4IH9A 2VAXA 2BJHA 5EGNA 1EX9A 2BUCA 2PU5A 4UBLA 4B9AA 2HA6A 2QJWA 2ZSHA 4WCVA 2QR5A 1ZIYA 3DNMA 3MUOA 3WI7A 3BIXA 1X2BA 2C5GA 1QJ4A 1A8UA 4AN0A 5C7YA 2CMFA 5EI5A 3SK0A 2ONCA 5ALWA 2WG1A 5CTAA 1QIGA 4LKOA 4GBGA 3FVRA 3IBTA 4GEGA 3VJMA 4JEIA 1ODSA 1QO7A 3DOHA 2O2GA 3ZLUA 3V1KA 1H2ZA 2GBIA 1SCIA 2XQFA 2QT9A 5FOQA 3O4JA 2DQZA 1Q0RA 1E8DA 1QFSA 2PSJA 1VXOA 1FSSA 2WUFA 4FFWA 3MUNA 1XZMA 4JUIA 3WZMA 3O9VA 2PSFA 3WJ2A 2EEPA 3QYJA 4DSAA 1DWOA 4INZA 4J0JA 2RONA 3ZV7A 3H2IA 1PFQA 2XQKA 4QDUA 1BRTA 1F0NA 3DCNA 2DFPA 3H04A 1MT3A 5K3BA 3NGMA 3R3XA 4C87A 5FV4A 1AMNA 1E8MA 4W9RA 3W05A 3FBWA 5DJ5A 3FAKA 2O2IA 3QPCA 4OU5A 2G5PA 1AX9A 4QLAA 5C8ZA 1TK3A 2X5XA 2JEYA 4N8SA 2XLCA 4HRXA 4O08A 5JAOA 5EIEA 1ZIXA 1F8UA 4OCZA 3E1GA 1A7UA 3ANSA 4J03A 3BWXA 3MGAA 4HVTA 3BE8A 4CCWA 1TRHA 4ZRDA 4PF1A 2QOEA 2XMRA 1GPNA 1EK2A 5LZ7A 4PW0A 2DHCA 1DX6A 2AXEA 3I2GA 4EY6A 5E4YA 2WIGA 4EZIA 5EHXA 3RM3A 5JANA 1QGED 5ALPA 3WKEA 5AK4A 5EIAA 1H2WA 2OCKA 3AILA 4C89A 2ZYSA 5AICA 2HA7A 5KWJA 2HFJA 3PE6A 1ISPA 1WHTA 5ALFA 2IIVA 1XZEA 4W63A 2JF0A 3WL5A 3JW8A 4P93A 1MX1A 4HS9A 1CUBA 3PFCA 4BCCA 3GUUA 1CRLA 3N2ZB 1TCAA 4BP9A 3GROA 3WKAA 2DR0A 3ESBA 1LZKA 2QXUA 4XWGA 1XLWA 1DTEA 5LKAA 2VJAA 1NU6A 1XQXA 2BGRA 2VSQA 4Q3KA 1TCBA 5AKHA 3T4UA 5JD4A 3WK7A 4F5ZA 5DWDA 4J0IA 4DNOA 4U2DA 3IURA 1Y7IA 3LS2A 2D0DA 4CI9A 2AJDA 2RHWA 2HFKA 3HC7A 4BAUA 1K6EA 2W6CX 4FHZA 4QE3A 4RGYA 1IUNA 4PSCA 3STUA 1NU8A 2WSLA 4A16A 3KSRA 1RWQA 3WKBA 3HSSA 4G4GA 1JKMA 4BCBA 1ZGCA 5YASA 1BROA 5HCUA 2XMCA 4CG1A 1L7RA 1GGVA 1JT2A 3M83A 1QIFA 2J4FA 1LNSA 4H77A 4QEKA 3RLIA 4EY4A 1W52X 1YASA 1U4NA 3C5WP 5AM2A 1EDBA 2ZJ7A 4ETWA 2WFLA 4BYMA 1IUPA 1CUWA 2OQVA 1HKHA 4OU4A 5T4FA 1Q0ZA 5ALNA 1F0PA 2HU8A 1KEZA 2J3QA 4BZWA 4DNFA 4KAFA 3CCCA 3R3YA 3DS8A 4K2AA 1UOQA 4KJXA 1W76A 1XQWA 4Q3LA 3VXKA 3A2NA 5A7HA 1E8NA 1XZGA 3QITA 4BCDA 3H2KA 2EDCA 5HQ3A 4RE6A 2ACEA 5HF5A 1CUCA 4G9GA 4FLMA 2RI6A 4C4ZA 5AKYA 2XI4A 1XFDA 1CUGA 4RPCA 1AQLA 4MYSA 1JJFA 3FSGA 4FLEA 2BKLA 3WZLA 4PO3X 3PI6A 2HM7A 4ARBA 1T4MA 1BS9A 3PF8A 3WWCA 5AKGA 2Z3ZA 3HYSA 4BAGA 4EA6A 4S0XA 3WQHA 5HF8A 1ZD4A 4L3WA 3C8DA 4C01A 5AM5A 4OPMA 2Y2VA 1A8QA 3AJAA 3K6KA 4AQDA 4HXEB 4LYDA 1EHYA 3V1LA 5JD6A 1VLQA 2WFLB 5IH7A 2BAGA 4OYYA 1VOTA 3WKCA 3BJMA 4HXFB 2W22A 1H22A 3EQ8A 2JGLA 2XUGA 1HPLA 4F0JA 1XZAA 1MTZA 4H7JA 5CT4A 2JGKA 5LZ9A 4H7HA 1SC9A 2OXEA 2CB9A 3I2JA 5AIAA 5ALMA 1OILA 4QDXA 4DYHA 1YAJA 3HJUA 4WJLA 1IZ7A 2X76A 3C6BA 4YK7A 1LPPA 4Y2TA 4DMHA 2Q0XA 2HDWA 2WU3A 2PSEA 1UKAA 4BAZA 5AM3A 1KU6A 1A88A 5AOAA 4MQMA
chains in the Genus database with same CATH superfamily
5JWHA 4RKQA 3MHTA 3RVJA 1E4EA 2R00A 3BJZA 3HKEA 2F8TA 2QP4A 1CQPA 4MMXB 2JJ1D 3MWDB 3AZQA 4ENUA 3BB1A 3KV3O 1FB5A 3DWEX 4DMUB 4A26A 2B8EA 4C06A 5LYJF 3DEFA 5C5EA 2IDKA 5K0TA 1ZSNA 3A8TA 1EBUA 3DV2A 4IYRA 4BNVA 1JLHA 2X3UA 2FZKA 1E96A 4RC9A 2QK4A 2CHUA 1LV8A 3CT4A 3OEHA 2OR3A 5KHOC 1QUFA 3UK1A 4ZC8A 2HADA 1XWFA 2BFNA 4WZAA 1ZGAA 2ZIUB 3H1BA 3LZDA 3R3JA 1V8BA 4UBMA 5K3SA 2XCRB 3KTAA 4S3MA 1G18A 5GV7A 4C14A 2FFAA 3HSKA 3KQPA 3AR2A 4H7FA 3SEFA 2JDIA 3LPDA 1LX6A 1NJ8A 2P62A 4OGLA 1IRXA 4HRAA 4BVGA 5C37A 2OD7A 4H7EA 1KIAA 4TL8A 1RYHA 4KXQA 3LLCA 2QZ4A 3KELA 1NN0A 1QTRA 4DXHA 4KRGA 1H2AS 1YB5A 1RE1A 2ZEJA 1F2TB 2B4RO 3M6FA 1R8SA 1C9JA 3LXUX 1JR3E 2E4VA 2H07A 3EG5A 4G85A 4QREA 1RJEA 1G3RA 3LT0A 3PNQA 4KSBA 1KIMA 4D6YA 5B55A 2KQUA 9LDTA 1A5AB 1WV0A 1R4ZA 1V5IA 2O2EA 2ZT8A 3LWDA 4PYJA 2RGDA 1G6Q1 1G64A 5HKBA 2Q5OA 1JDUA 1QGZA 1YZQA 1L6IA 5IDQA 4FPXA 1I4DD 5A4IS 2PZEA 1P4SA 4X1KA 1A9RA 3ASYA 3DTVB 3FUXA 1Z29A 1B41A 3N0WA 5BRAA 5C53B 1DXHA 3DMYA 5IYZB 1IZZA 2QZJA 3NGLA 4OHXA 1WDLA 4UCWA 1H42A 3AG5A 3QVKA 4CG0A 1N1EA 4O4HF 3EPKA 3K4PA 4G8CA 2A8YA 3ADOA 4LPSA 4X6XA 3I0ZA 1CVRA 3TRJA 5LM3A 3O8CA 4LQDA 3U3XA 3WLRA 4BV8A 1UPTA 3STHA 2I91A 1GDTA 1CY1A 4C0LA 1QYVA 4HSEA 4ZJUA 4DDVA 3STTA 3R1IA 1RXIA 1WHSA 5FPYA 1T3GA 1T24A 1XCGB 2JGAA 3WGMA 1R0BA 3E48A 2NUTA 2C3UA 2GUWA 4AMUA 4KDFA 4OX9Y 4QUEA 3AWDA 2PXCA 2V0NA 4UCFA 3ONFA 3R74A 1JHQA 3KR2A 3GFFA 2H18A 4HI0E 4BKUA 2GCGA 4R1MA 5JTTA 4C4AA 4ENPA 3CEHA 1SXPA 2GSWA 3ANNA 1GQRA 3OJFA 2FEWB 3ZVLA 5AKEA 1I6KA 1EBBA 1ZHHA 3BIFA 3QEAZ 4UATA 3FDIA 3A58B 4A6EA 2Y1OA 4YVFA 3K9HA 1XZLA 2WVGA 1I33A 2CL0X 2PA3A 1NW6A 4FIDA 1VKZA 1ZCBA 2VK2A 1CVLA 2A5GA 2F43B 4DE5A 1QKKA 4KMMA 1GL3A 4MRRA 5JUWA 1Z7BA 1XZKA 2MR6A 3OO0A 2IEYA 3HCFA 1GSAA 2H63A 1GN8A 2PUFA 2IY9A 1M6VB 3HV0A 2ZVQX 2XMSA 1B8VA 2JEZA 4N03A 4RK7A 1WSAA 5FQNA 2DCMA 3T0FA 2QD1A 2E4YA 4IEEA 2PHZA 1IWBB 3SC6A 3AI2A 2I4OA 5ILQA 4F3NA 1ZH4A 3NXSA 2WBLC 2NV2B 2FPSA 1YIAA 3MG9A 3Q8WA 2G67A 1QAMA 1FW6A 2PIAA 1XMSA 2XY4A 5I9IA 1OWNA 1JH8A 5K3AA 3IAEA 4REOA 5KYTA 1LS1A 1WPXA 1CUAA 3GFTA 2EWMA 3A6FA 4JLSA 1PEAA 5GM1A 1I2AA 2VPIA 1XZFA 1RPZA 2NZUG 4RVSA 1I4EB 1EQ2A 2DEUA 3RAEC 3BFKA 1W93A 3DULA 1GQSA 4FJ0A 1DLJA 4IAOA 4IIJB 4K88A 4QQFA 4WAUA 4YQEA 1MIOA 2J87A 5SY9A 2WU4A 2R65A 1ZEMA 1AB6A 3U7QA 2AN1A 2BLNA 2X58A 4LF8B 2XUJA 1VGVA 3QE4A 1EE1A 3FNQA 5EZ6B 4I7EA 2J3MA 4OQXA 4JI7B 1R0SA 3SDSA 2HDHA 1FTYA 1DXYA 2PAAA 2X42A 4OK3A 4B2PA 1THGA 1D6NA 1FJ2A 2D8AA 2J6HA 1U94A 3A4NA 5IARA 1SZPA 1TECE 3P9RA 2JLUA 2BFBA 1W4RA 2FW0A 2WWWA 5L7TA 1L3BA 2VCEA 4MRSA 4WLNA 5D8DA 1PV1A 1W2WB 1AO0A 1M7BA 2Q4RA 4BP8A 4ALKA 1QU2A 1GRRA 5DSTA 2FB9A 3C4VA 3IJEB 4MI1A 2FOLA 2O2XA 5DNDA 5AVVA 1T9DA 5EHGA 2VJCA 4FW8A 1Y4DE 1QIMA 1B14A 4B82A 1OR8A 3L3BA 3RAFC 2JAPA 3HY4A 3OAAD 3GZNB 4GX5A 3EDCA 3KEFA 4K28A 4MP8A 4XI9A 3R8XA 1DKPA 1LF5A 3LP5A 4DCNA 3I61A 1GTMA 2B1GA 1G8JA 1ZD2P 3BEDA 3LSYA 1NN1A 3P52A 4JGBA 2QMYA 2JLVA 1GO2A 2DE0X 1F3OA 3D6NB 4FE3A 4IPTA 4WT7A 5JO0A 2NIPA 4L0QA 3UB2A 1N6KA 4Y30A 2VA9A 3CLSD 4GOOD 5C7OO 1GGKA 2Z04A 1ZKDA 5E3JA 1KQGA 3GRAA 4P3KA 4HMOA 3IMGA 3MT0A 4W9NA 2J6CA 4EEKA 4AWBA 4HVLA 4GQBA 2Q6KA 1P2FA 4EG6A 1S89A 2VKTA 2GASA 1GILA 1UBCA 1KH3A 1T5BA 3GA7A 4C07A 1M73E 3NZEA 1UXGA 1C0KA 2GBCA 2PJDA 2VBCA 3D2BA 1CDOA 3TW4A 1H1DA 3QG1A 4GM4A 3K35A 4NJMB 4G41A 2AHRA 2ZDHA 3RC1A 2VYNA 1Q1ZA 2CE2X 2QSZA 1XA0A 1FSFA 2I62A 4WCDA 5BNZA 2A0WA 1MEOA 2O23A 4BLVA 3B3QA 3IOBA 1BXRA 2H2AA 2PLRA 3LM8A 4RHUA 4HYQA 4X60A 4DG8A 4YAKA 1FVHA 1G8FA 3EPPA 3WRYA 3KLNA 3WXMA 3PFHA 1VRWA 2WB4A 3F4KA 4CDRA 4FEEA 1KJYA 5A6SA 3QYPA 1XWIA 2JGNA 2IF2A 1QIKA 4CPDA 3LV8A 1TUEA 5JV5A 3EXHB 3KHSA 4WLUA 4ZQHA 5J4LA 1OROA 1EP9A 2KI5A 2BGGA 4TOIA 4ZO6A 4X66B 5DHPA 1FTNA 4DC9A 4FFNA 2UU9B 1ZIDA 4OGKA 5CYFA 2YUTA 3RVSA 1WLYA 4OQDA 3V8RA 1JJBA 2QTZA 2WAYA 4RADA 5E1BA 3C5HA 1G59A 1UXKA 2PDAA 3T9CA 5AUPB 1VLMA 1T2VA 4GX2A 1JS1X 3IQHX 1Z35A 1Y9DA 2W2KA 1OH5A 1H8HA 1YMUA 1SOAA 1EJ2A 2P9ZA 2QTRA 1TUIA 4JJ7A 1TM3E 2FFRA 2QD4A 4QU0A 2XB2A 4AYWA 3O1IC 1U65A 1ZAKA 1S5PA 4HKTA 4BQOA 3U60B 5A0VA 2OFXA 5CH3A 5H0IA 5DWQA 4MGHA 4AJHA 2G63A 1D8TA 2WF5A 3RK0A 3L8CA 1DARA 3NKLA 2QG9A 4E5PA 5HVNA 3K4QA 5COBA 3VSCA 3WLEA 1RLJA 3QVWA 2PUEA 1YV9A 5ERXA 1VIDA 2G70A 2VNKA 1QG0A 4A73A 4KR0A 1T5HX 2ZAIA 4EB6A 3K70D 3HBLA 4L0DA 4MULA 2XA2A 4LYAA 5HF6A 2Y1CA 1NSTA 3A06A 5HG0A 4ZEOA 1DBQA 4BMOB 4CKXA 1PTJA 4H27A 1I3LA 4KO4S 2XXJA 2BFMA 4XSHA 4ZCSA 4IDQA 5JC1A 5LIRA 4J0CA 3E3AA 3KJGA 4OO3A 2GHIA 5D7NA 3RUEA 1A2BA 4G8BA 2ZJ0A 3G89A 4QT0A 3T3DA 3WL7A 5J2UB 4TV8F 3CRQA 1RHKA 1T4GA 2I76A 1RWNA 2CXQA 1DO2A 4C03A 2ZVJA 1N2ZA 5KINB 5FR1A 3JVIA 3SS8A 2AVDA 1KVQA 5AJZA 3LUFA 1OKKD 2V97A 3KXLA 4ZQFA 1I7DA 1G66A 1PJCA 4TXNA 3ZDZB 4RA9B 1PYDA 2NUBA 3PVSA 2X7HA 2EP7A 4P22A 4WZAE 1AXRA 1Z83A 5EWJB 4HNTA 2W5UA 2BRUA 2HJRA 4DNOA 3FPJA 4NY1A 3ZTTA 4MW6A 2WSSA 1JYEA 1A9XB 4IJ6A 1EFRA 1PS0A 4MMZB 3G79A 4YRPA 3GFBA 1TF2A 3D3KA 3T99A 1VCMA 3VAYA 2XB8A 2X9QA 2XTJA 2ZQYA 5SY6A 2ZYIA 1ZOOA 4HEQA 3OFND 5EHNA 4DQ0A 5KPDA 5HTKA 4LY9A 1QO0A 4NKRA 4A91A 3LQ2A 4ASUD 3U0BA 1HE8B 2AZDA 2R4UA 2OGZA 2C4NA 4AO6A 1E4YA 4ZJZA 2O0HA 1DE0A 2OBYA 4BGUA 1OZHA 2PIDA 1SXJC 2QUZA 3VGPA 2VYQA 4K6GA 2F1JA 3NH9A 3PDJA 3OTIA 2PT6A 4HNUA 1W46A 2RB5A 2BEVB 4BEWA 4LY0A 3C4JA 1NUQA 1NT2A 8ABPA 4TXLA 4RTRA 4ZOLF 4HJXA 4ED9A 3HBNA 4QYMA 3DAYA 3KWMA 3LQQA 4MLZA 1NM5A 4FDVA 4PO9A 2JI9A 4X62B 1W2HA 7REQB 1OXSC 3U3OA 3ZBPA 2FJPA 1G7RA 1OXKB 1BDIA 1P5ZB 5DCLA 1H6CA 1EYZA 1RRGA 2ZRDA 4GRIA 2ZSDA 4H3VA 4OQMA 1GSHA 4BVLA 1QFYA 3K9WA 3JARB 1QSGA 4LOLA 3PXXA 3FMIA 5AXCA 1OGYA 4G8DA 4I14A 5CFOA 5KOIA 2FMIA 1KSHA 4GR9A 5F1KA 2HYDA 3WYNA 1SCDA 1ZN2A 2OEPA 2VXYA 3OZFA 1VMEA 4JLAA 5KYXA 2AYXA 1KDPA 3MA0A 4L5JA 4PNEA 4ZTUB 1AGYA 1CRWG 2HMTA 3GRCA 4GGOA 2PJRA 2Q49A 5FEMA 1K2VN 1YB6A 4H1TA 1TTPB 2FN9A 4P9NA 4CE6A 1L9XA 1D2EA 3G0CA 1PGQA 3KVOA 4TTAA 2DFVA 4P7BA 1QZ3A 3U31A 3LLVA 3IEMA 2YVAA 1VE1A 2V65A 2RGAA 1XT6A 2OQRA 3LBAA 3NTVA 3O8NA 4FMPA 4I9FA 4RYLA 1NNSA 4M0CA 4V2UA 5EKUA 5E0OA 1I0IA 1P4GA 3NVDA 3B5IA 1CUVA 3RU9A 4OH7A 4DV0B 5JZBA 3KM0A 3PDIA 1J2JA 4F38A 1PR5A 3MJFA 4R9RA 1IY8A 1I4OA 5DLQC 4G1MB 3OCJA 1BS2A 4KUEA 3W5CA 2CW5A 2JD1A 3LVBA 1UBNA 1DKOA 3DL2A 4PFQA 5EHQA 3WDMA 1WMFA 2C9CA 2ZU0C 4YDQA 2ZJ8A 1SMKA 2B0CA 3UENA 3LL4A 1ESNA 1N5JA 3A6LA 4YONB 1O08A 2W8BA 1KMMA 4KPYA 3ZH2A 2B4KA 3FZEA 5HS4A 1P2GA 2LCQA 1YCFA 2WQZA 3NOQA 3G5TA 4TLAA 1A4XA 1U2QA 4CLRB 3Q8KA 1DIAA 2PD3A 2IODA 3IT0A 2HK9A 2GGSA 4IW3B 3RADC 3NVAA 1LFAA 4XARA 1C14A 2I55A 3KPYA 4Y2GA 4D8TA 2UUOA 2QAGB 3AFNA 1X7ZA 1R1DA 4N6GA 2XHZA 1Z9BA 1XVAA 1JMVA 1IE3A 1ZGGA 2E87A 4R2JA 3OE1A 4WGFA 4IJWA 2AE2A 3WNCA 3ZK8A 8MHTA 1L5RA 4AP6A 4BP3A 3WMRA 1D6JA 4N7MA 1XMOB 1ETUA 3SGLA 4V1CB 1JEQA 5P8WA 1C7IA 1YS4A 3R75A 3WYBA 2AUNA 2Q5EA 2ZIWB 3MXTA 3W5SA 3ZK9A 2WTMA 2HAEA 1GFIA 2QBYA 1IY0A 4NE9A 1VHQA 3P19A 2JLWA 3TUIC 3RBZA 5JHHB 4CI0B 4I4TF 2UZ4A 3KD2A 4RABA 1YK1A 4PFSA 3OQIB 1L5FA 3OOSA 4RZSA 2WJZB 2ZP1A 4DQVA 1QR2A 2Q0HA 3MGGA 2YKGA 4B3MB 2H16A 3PU6A 5E4TA 4C6RA 4E3WA 5BT8A 1NQUA 3H0CA 2PMBA 3PJDA 2W71A 1R2QA 3QU9A 1FJHA 5LDGA 2F64A 1SVMA 2HMYB 1XMIA 1JE1A 2IOHA 3MT8A 3QGMA 1V71A 4PZPA 2PKWA 4XJVA 3RRZA 2W2OA 2WJAA 4A8PA 3B6ZA 3ZDBA 4LSWA 3KHKA 4UAGA 4K26A 4UULA 1U8EA 1ZM4A 2HLDA 2HL6A 2OV4A 5SZHB 1U7DA 1GVHA 2HSZA 3UYKA 1HL7A 3PC6A 1AUXA 2PRZA 2H5IA 4PNZA 4RLFA 3WQQA 5KHAA 1B8OA 1OAOA 3G5UA 1SKBA 1ZOLA 1N6HA 4OJTA 2OCBA 1GLNA 3P26A 4NBLA 4WTOA 4CQNA 3OE4A 5CBKA 1E3QA 1T5OA 5C1IA 2EX0A 4ZI2A 2MTBA 4F4UA 4Y9TA 1QB7A 1WPQA 2ZSKA 4QDKA 4D8WA 3KLOA 3AHCA 1T34A 2BGLA 3HA5A 4YWJA 4B3JA 2W6MA 3FYSA 3HB4X 1EFCA 1JZTA 3K1TA 3L4BC 3PCTA 1L7QA 2Q3CA 3ZTWA 4Q4CA 2WUGA 4XFKA 3GLFE 3SDZA 2DFNA 2IYTA 3OKAA 2VHVA 3U17A 1DIBA 4RPHA 4XASA 5HJ7A 3S99A 2NZVG 4EYEA 4GSKA 1FMCA 2R60A 2QM3A 3TM5A 2JJ8A 3IULA 1Z33A 4OHUA 1T2UA 2FKNA 3W2EA 3QLEA 3KPJA 3EWSA 4FILA 1AF7A 3GJ8A 2XYVA 3VH1A 3S5JA 2V96A 3ED5A 3KJQA 2BMAA 5SZJA 5LXTF 3N2GB 3PLNA 2FA9A 2NXJA 2EBHX 3LA8A 5TF4A 5BUZA 1E5QA 2OT3B 2D0IA 3B36A 1ZD3A 5U9CA 2DOKA 4E15A 3DL4A 3NB0A 3HB7A 5BSMA 1G3UA 3GCDA 4ZXFA 4QYWA 2JA1A 2OFPA 2B7LA 4A8TA 2BE7A 4QG7A 4YJ3F 4GOJA 4CMJA 3SZOA 1Z0SA 2A0FA 3DKPA 2OCGA 3BPSA 1E64A 3GLSA 2AZTA 3RJMA 4GLFA 3MAGA 3NIBA 5BSWA 1ZNZA 4TKZA 5IJZA 1LU9A 1B3BA 1RMQA 4UDOA 4WEOA 1NDUA 1AHHA 1PR6A 3ANTA 3EBOA 4HNHA 3A9WA 4PYIA 4FBGA 1AO3A 4D42A 4ZXPA 3Q7IA 4B76A 2Q2WA 3UG6A 5I9LA 4R0VA 3VSEA 2QTLA 3LKVA 3BFVA 4FOOA 4M1KA 4C3UA 4BFVA 1V47A 4C05A 2HNKA 2FOIA 4PO8A 4L5AA 4OHFA 1TUBB 1B8UA 1ULZA 4GVXA 2BEWB 4YDHB 3AHFA 2JZNA 1IPEA 1B76A 1JQJC 1Y8QB 2C8LA 4J9UE 4LHWA 3EXAA 4LJYA 4UM5A 1RHMA 8AT1A 2EFJA 3H9GA 4D4JA 3WLSA 1X8JA 1AN0A 5K1ZA 3Q87B 3TSCA 1HEUA 1LLDA 1AA6A 2MSKA 1Q0HA 2FUEA 2MT9A 1X7GA 2Q6IA 2YH2A 3HUDA 2QGZA 1F1BA 3CNLA 3O0TA 4J1QA 4OXYA 4W82A 4EGCB 3EVFA 4LSMA 5GZ1A 2FK7A 1WF3A 3VAAA 1IXZA 3MT7A 1BEEA 1L5WA 1IY2A 1W25A 2JIBA 2RARA 1YA8A 4KJZA 4Q9AA 1T35A 4Y6RA 5DBOA 4DWJA 1MT0A 2RKOA 1DBSA 4A5OA 2QQGA 3P9SA 4I3FA 4BVJA 1I7LA 1L2TA 1I3MA 2G0AA 3AX6A 3ZQ4A 3U4MA 2A3NA 1V4NA 3DLBA 4ZYLA 3A2MA 3VPBA 1E0AA 4I5DA 3ZUGA 1QQAA 2HTEA 1NQTA 1NMEA 4JBWA 5EE0A 2BI8A 2RGNC 1RC8A 3KV1A 5B2FA 4DJ5X 1FL9A 4PLYA 1UEJA 4A0SA 3LUKA 2QJRA 1X7YB 3NTRA 3LHDA 4UEWA 4LJSA 3ECAA 5CLHA 1DQSA 3G6KA 4ZRNA 2FXVA 3DVSX 2IUYA 4D9IA 4WUTA 1FW8A 5K6AC 4J6EA 1FMTA 4OAQA 1WMSA 1BA2A 3LNTA 4RE5A 4LS3A 2XQGA 4F4DA 3N0VA 5KVQA 5ALTA 1WXGA 3JASA 2HHCA 2YWHA 3QLUA 4JBYA 3MMSA 3DBOB 2C1XA 3GAZA 3R7BA 4I0WB 5FOXA 4H6PA 1SG9A 4IINA 2AC7A 3CW8X 5HP4A 1CR0A 1KAQA 2BFEB 3I4FA 3GLKA 4BO8A 4QASA 3RO7A 1XAHA 3TGPA 5DNWA 2W2KB 3FCOA 3IVXA 1I30A 3ANLA 1Y9JA 2QRLA 2CGEA 2JAQA 4LJAA 2WUWE 3I92A 3DEIA 5EFOA 1MJGA 3TCNA 3WIBA 3E5HA 1YQDA 4F3YA 4ZAVA 4ZMRA 1Q7GA 4EABA 1WXIA 3QZUA 4KACA 3AJ9A 1ENOA 2CWDA 4AQ7A 3KDAA 4JXKA 1MJ5A 4B4WA 4NCAA 5KWIA 4JJ6A 1LPBB 1XX6A 3C6XA 1N7HA 1WOYA 1BWPA 3KCQA 3TL3A 3VR3A 2C2KA 4EY5A 1NW4A 3WOHA 2O3TA 2G06A 4GOMD 4MRMB 1E2UA 3FR8A 4OA8A 3RSGA 5A4AA 1FJXA 2OAGA 4XJSA 3WKDA 1ESDA 1SG0A 1UBRS 4AMVA 2QVGA 3IJ5A 4OK6A 5KSWB 1J1UA 3TZEA 3IUNA 1DQZA 4AXXA 4QVGA 1HDGO 2GKOA 1IMJA 1T5IA 3B7WA 4G0WA 1BFDA 1TM2A 2GZDA 2BWJA 1XA3A 5AKIA 1AV6A 3MPOA 1X19A 1Y8QA 3VQTA 4MOWA 4NMMA 1PP4A 4KGZA 1S1MA 3O95A 1B26A 3ZCXA 3HXTA 2YASA 3VDMA 4AL4A 4DCCA 3ZLJA 3Q3GE 3FYUA 4MJLA 3IAUA 2O5RA 5TQVA 2NVBA 3V8QA 5KVAA 3H1AA 2ZIFA 1A8SA 4LDZA 4ZVRA 4QWMA 4L6AA 1QYXA 3KJHA 3WZ2A 3ETLA 4YR7A 1KO7A 5IDXA 1SVUA 2VPYA 2C57A 3OJLA 4C3VA 2OGTA 4JEUA 1A96A 4OFXA 4EFMA 1N3LA 3K5WA 4MYDA 1YNSA 3EK2A 1SVWA 3LUPA 5ANRB 3O90A 2JLSA 3TECE 1U8AA 3I2FA 3CTMA 4UZSA 2MOKA 4RM2A 1L7AA 3BG5A 1JXMA 1KZ4A 3KP1A 3GV0A 5A3SA 1SM4A 3GZNA 1AH2A 4BLUA 1KHHA 5LPNA 3BF7A 3QK7A 3OA0A 1I9CA 2YWFA 1OGIA 1G20E 4MVJA 1CZLA 1HOTA 1QH9A 2JCYA 3IDQA 3OSUA 4MDYA 4BO7A 3PC3A 2NUAA 3DFKA 1O6CA 3A1EA 4Y2RA 3A6EA 1ITZA 1GFSA 1NOJA 5MGBA 2DXIA 4IHJB 4LNUA 1N33B 1GCGA 4V38A 4PFJA 1GL7A 2ZTMA 4FDMA 2R84A 3B1ZA 4XWKA 1CU1A 1G9TA 2UYYA 4ZYVA 1KPIA 3JYPA 1NMYA 5T4HA 4H4DA 2BEWA 3JQ8A 3FCXA 5F3DA 3SBEA 4ABTA 3V9PA 4CIAA 5K0CA 1E1NA 1L7DA 1X7XA 1HORA 2C5EA 3H7AA 3MTAA 1NJGA 1XA4A 2I6TA 2XHEA 3HCAA 5CB0A 4DMCA 3AEUB 1R12A 2I99A 3QENA 4G36A 4YP5A 3FFXA 3BXPA 3UK0A 1JILA 1GU7A 2BZ0A 3HKBA 2GLTA 3PPWA 3UV7A 3Q10A 3AO0B 2RCNA 3QKRB 2XIQA 2VHWA 4F91B 3HXOA 1JU3A 1N0VC 4IQ4A 1D2AA 1V6CA 2WKRA 3PLRA 2PH3A 3F2IA 3B8HA 2Y6VA 1M2EA 3EN0A 3H1TA 3RB8A 2HCTA 2P9FA 5AT1A 4GE0A 3TLGA 3VYUB 1GTJ1 2IV7A 1EDDA 1F2VA 2VPPA 1FBNA 2WMDA 3RDPA 1K7SN 1DJLA 2VIIA 3TNFA 4CW7A 2JFVA 2N46A 4ID3A 4MWGA 2EFCB 4UZFA 4DM4A 1NLFA 2X3YA 3QRWA 3NVMB 5LZ5A 3RU2A 2WG2A 3I0MA 4N5HX 4Z4GA 1ZUHA 2I6FA 4LQLA 4DSOA 1DQPA 4F60A 4OHWA 1MPTA 3L6CA 1LZLA 4KI7A 3HCOA 2XQIA 4NG5A 1JIKA 1H8EA 2R62A 4FE4A 1IIBA 1XRLA 3BMQA 3PNOA 3STVA 4IIDA 4AUKA 4YCSA 1GL6A 1PJ8A 3ENKA 4ZYZA 3R0QA 5ENZA 1ULUA 4NVRA 3Q7TA 5JI2E 2B8NA 5IM4F 3OLVA 2HLPA 5COQA 1YHYA 3BUSA 4HGQA 1OXVA 5CT5A 3C3XA 2R6CA 4GMFA 4KRYA 4PC1A 2QN2A 1TNDA 1ZRNA 3MD0A 2C07A 1S2GA 1Z5UA 5FUXA 2L0XA 2HLNA 3BORA 1URPA 4NNOA 4OHZA 1U3FA 2P1DA 4ND6A 3AR7A 1NVMB 2COEA 1Q20A 2KWIA 2YY7A 4GXRA 4IIVA 1DXQA 1ZD9A 4RZUA 4Y6QA 3EZLA 4N5LA 1NBWB 4M8NE 5K8TA 1LSJA 1DV2A 4WNAA 1KAEA 3NX4A 4WADA 3T1QA 2OK8A 2ZXUA 4U0JA 3GN2A 4NS4A 3KKZA 3TTYA 1QH1B 4KN8A 1ZJ4A 4H1WA 4Z3OA 4B6SA 2IOFA 3O93A 4TMZA 1BWQA 2A92A 2QTFA 4S24A 1PS8A 4HDAA 4KWIA 1JFSA 3ECCA 1O97C 3ENZA 2WY2D 3X3HA 1G1AA 5LB2A 3V1TC 4F96A 4ZGWA 1KY2A 2O6LA 2D5CA 3QUTA 1K68A 3W3AD 1XNJA 4B0PA 2FP4B 3EYAA 1GCUA 1NVXQ 4ZAZA 3T52A 4EDFA 2OFWA 1RLIA 3KKEA 1E1CA 4YNBA 3STXA 4DLYA 2BL4A 1W88A 4NONA 3LRXA 3FLMA 3R0IA 3MFQA 3W90A 3DPUA 1YRHA 5GJVC 4I9HA 4FB5A 2HHLA 1TTQB 2OGUA 3GJ4A 3OQIA 1VE6A 2QW0X 1GKKA 2BCEA 3DZIA 4CJXA 2BI7A 1JALA 1UPUA 5FB3A 2XD4A 5HRCA 3MM4A 2Q46A 3MTQA 1AK9A 2Q21A 3CLUD 3OFJA 4A6PA 3QEBZ 4DUGA 4RY8A 4M0EA 1D9XA 3SIWA 3IKTA 3NHJA 1VE9A 3BZWA 1IUKA 4HQOA 4Q7QA 2DLDA 3D64A 2QNIA 1Z22A 3SXUA 1U0OC 4ZDJA 1F7VA 2A88A 1ZITA 1JFFB 5CNIA 4BNLA 4QTUB 3LKZA 3OC6A 1KOLA 2ZITA 3M0EA 3S1AB 2G4LA 1DG3A 4D3ZA 4LHSA 4RDHA 2GK4A 5LMZA 2BC9A 2CF6A 3A3KA 4MCJA 4P0TA 5JO9A 4Z2AA 1HE1C 4AWXA 1KVSA 1WAMA 5DPMA 2SICE 2R8XA 3SBOA 4FUQA 2Z3VA 1OWMA 1FVFA 4LTDA 4QUDA 1TW2A 1ZU5A 4TXMA 3I45A 2DPMA 1LI7A 4H59A 1AZLA 3WYDA 3ZNOA 3W8DA 4PHHA 4MUYA 1O9GA 4QDZA 3JD3A 2ATEA 4UXHA 5BR7A 1FQOA 3TSYA 1CPYA 1OFUX 3C3KA 4QHTA 4DM7A 4BN4A 4JI6B 1TJPB 5DRYA 4MVCA 4HSGA 4ZV4A 1LSUA 1GLVA 5AKLA 2D74A 2AW3A 3H6KA 3C3YA 3C43A 1F2UB 5CYOA 1ORIA 4LXTA 3B6EA 4OKIA 1ISFA 4DYDA 3OPQA 3WGZA 3QY9A 5BMOA 3ILSA 1SULA 1VKOA 2R1ZA 5DN9A 1PUXA 1S01A 3SQNA 3OOYA 3O26A 1E62A 3ZY3A 3IOCA 1RJFA 1I3KA 4IF6A 1J24A 2ZI4A 4LJKA 3TM4A 2P9GA 2G36A 3B52X 1KQ3A 3PVZA 4QGAA 2A5YB 3WWPA 5AVZA 1H65A 3HCBA 5IKPA 1O4VA 4B8ZA 2CXUA 4Z4IA 5C8VA 1QF6A 1P60A 4DIBA 3K5PA 4DMKA 4LBZA 2ZYTX 3KT8A 4D3YA 1QWOA 4O1MA 3IO3A 4UMEA 5KNDH 3EXG1 4EF5A 2J33A 4V0LA 3TMKA 2HT6A 4JYCA 4KXFB 1E0JA 1U3UA 4HPXB 4EPXA 4ZK2A 4OSEA 3WLHA 5DX1A 1N77A 3KALA 1U7UA 2HWYA 2R6JA 1PWEA 3NHZA 3QLVA 5IN5A 5E3HA 3A28A 1M8JA 1QK5A 1P72A 4KWEA 1K5HA 2E21A 3ZWMA 2CMKA 1QZZA 1X1QA 2ZUEA 2J6BA 7MDHA 2RHJA 5IKXA 1ZONA 1QQTA 5JDIC 1EGVB 1F14A 1KMIY 1ZVKA 3HNRA 5I9MA 3ROMA 3M33A 3UH0A 3WLIA 3MCUA 3LI2A 2QXYA 2X0EA 4FZ3A 3OZSA 3GDFA 1Z4LA 2QV7A 3UXMA 3B6IA 3IVMA 2PCJA 5J1TB 1RRMA 4EFDA 3RYCB 4BB0A 4KE6A 2C2HA 3L7JA 1MW9X 1FRFS 1U3DA 4KKXB 2IE8A 4GPTA 4REQB 2WYUA 4RENA 4UBJA 5HFNA 1CNEA 3L4JA 2GAJA 4H7DA 1KZ1A 5J2UA 1JFFA 1RYMA 2A0KA 2QN6A 3PK0A 4BN5A 2I4MA 1OBCA 4GYYA 4X8LA 1SO8A 3NRCA 1AKEA 2HPVA 5K6AA 4KQFA 3HFRA 3E7WA 4J7CA 3U37A 4R0NA 3BXGA 4P3OA 3H7IA 4WCFB 1HSZA 4WK6A 1W0JA 3DO5A 4EEZA 4G84A 3W6UA 3TTTA 5ALUA 1V8PA 1SCAA 1PYOA 4WNCA 4HH4A 4B8WA 1WETA 4FHCA 3GPIA 4UNIA 1U1EA 2NSLA 3E03A 4J29A 3JR3A 2I65A 2YQ4A 2IBSA 2RKWA 1VCOA 1RT9A 3VR6H 4EFKA 3KJEA 2GJ4A 1Q7RA 1MNAA 3H4IA 3HCDA 3L1VA 4HRYA 5JG7A 5KHLB 3JPWA 2XH8A 4RLHA 5I7SA 3ORYA 1LX7A 2WE7A 4HYYA 1SURA 4IG4A 3ZX5A 3D54D 5D00A 2QTAA 3D8UA 3K1ZA 4M0LA 4B9EA 4C22A 4EB8A 4G56A 4XDZA 1UMBB 3GCGA 2J31A 4ZDWA 5CT9A 4N4AA 1GZ5A 1YDFA 4DLTA 2D7CA 3B7PA 4OYLA 5ALSA 1YB7A 1KK0A 4DIMA 5AW8A 1CUHA 3FWYA 3GIWA 4QBHA 4X64B 5IBRA 3DBHB 3NTLA 2PLWA 3GFRA 4MTLA 3N0RA 4ZVLA 4MUFA 5U1PA 1C7JA 1K8QA 4PYRA 1JT9A 2NZYA 4OHRA 3FPGA 4ZOCA 1RPAA 3NAGA 2EP5A 5C8XA 2NGRA 1L8XA 2IUEA 6AT1A 3HL4A 3NOOA 1YE3A 3D6AA 4L95C 2YIDA 3E4CA 1R0ZA 1M66A 4OVKA 3UQZA 3N6XA 2FPOA 1CSEE 1JR3D 3V7YA 4CM1A 1UBSB 1FNMA 4WBSA 2IIQA 2QUBA 1L5HA 4ZCRA 4EG3A 2GOYA 4WIAA 3GQBB 4R6XA 4P2BA 2D2IA 5EE9A 5JCJA 1H5QA 2BGNA 5BMVF 4IIFA 4EEXA 4EQ6A 3GA0A 4L08A 1PQYA 2R11A 2LZ0A 3KKQA 3M6XA 1EESA 1Q6ZA 2YOGA 3CEJA 1JKJB 3PQCA 4MRPA 1CB0A 3LE8A 4Q37A 5AMXA 4B8YA 4MWBA 1M6EX 1JTEA 4PSUA 4RTLA 2CYCA 1QTQA 4BNIA 1UEXC 2HIMA 3B9BA 4IYJA 2P4EA 4MJ3A 1N8SA 1UPBA 4NZOA 3WADA 1FQKA 2CFSA 3OTOB 3FHCB 2CE7A 3MJRA 1WB9A 4B7ZA 1Z37A 5BO5A 3QNUA 1E2QA 1OYWA 3W77A 4OI0A 1Z0KA 5KCMA 5T3YA 2C5AA 1SVOA 1SBYA 3H9QA 3NBQA 6LDHA 1LI5A 4G0VA 3IEIA 2IZZA 1HO3A 4LG1A 4TROA 1SU6A 3NV7A 4FYHA 5EE1A 3B82A 2QF7A 2QJFA 3U7FB 7GPBA 3R3WA 3N8DA 4BFUA 1Q19A 1REQB 2B20A 4ZAGA 2Q2QA 3Q7QA 5TGDA 4FKZA 4EF6A 3OFSA 2D59A 5A6SB 3K70B 3PX7A 3SC2A 1CUUA 4XJXA 3NM5A 2NACA 1K3TA 1BTOA 1KXJA 1UUFA 3CJQA 3CZMA 3DLAA 3PTZA 5AI4A 2F1KA 1UBUS 4M8LA 5E4FA 3ZQJA 6REQB 5KB3A 5KWVA 2FRXA 5L3SA 1QF9A 2ZBPA 4L9AA 3HBFA 4HMQA 1H9BA 3BB3A 2ZUFA 3LDUA 2IEGA 4UXIA 1NV8A 2C9BA 3PR3A 4F6LA 4YRZA 1QWSA 3QELB 4WPGA 2ISQA 3L8ZA 4C7BA 4DJAA 3EGIA 4DMGA 1MJGM 1UBMS 1TL7C 1KFBB 2PH5A 1AUOA 4MX8A 4M1MA 4QTZA 5FUBA 5LQSA 2C4UA 3VR0A 2NUAB 1I10A 2F3TA 1VSBA 2J46A 3F96A 3HN2A 4MKZA 1NVVR 2ERXA 2K87A 1FYEA 5DV9A 2ZXFA 3F9IA 2IOYA 4H60A 3LD9A 2HF9A 3K6SB 1QAQA 1YFJA 1NR1A 4PYQA 1JXQA 3ZI7A 1O54A 4Q9LA 4L72A 3CEPB 1VFNA 5ALGA 5LP1A 1EIWA 4U6SA 4LMBA 1D6SA 1OXUA 2C8JA 2VTEA 1PV4A 3PC2A 3P97A 1K6MA 5JSHA 3KB8A 1I1HA 2GHRA 4IJKA 1LPAB 2ZSUA 4YPVA 1A76A 1J90A 4HYEA 4EG7A 4F97A 5AM1A 3QXJA 3MTEA 4Q16A 3DQQA 3EIFA 3R3VA 3SNHA 3FHOA 5FNVB 3VSDA 1EJ6A 4ER3A 3DKVA 3WIEA 2NVOA 1NPTO 3UBTA 4RHYA 4WJZA 3CVJA 4JLJA 2AJ8A 3V8VA 2CVFA 3RWMB 2E49A 1E9EA 3JAWB 2ON6A 4MIYA 5FPTA 5J59A 4C08A 1FDWA 1R4AA 2GZAA 3JQAA 4QTTB 1XZDA 2IYZA 4PIPA 4Z9BA 3W6ZA 4ROSA 2A33A 4JZKA 5G41A 4C6SA 1IBLB 5D87A 1J2TA 3PWSA 1T8TA 1JG6A 1NC3A 3OECA 3FWHA 4RNCA 3SJBA 4QICA 2PUHA 4O4LA 1RLOA 2DTDA 1SXJE 2B99A 3ID6C 3WSWA 3DBIA 1Z45A 4CM4B 3OCZA 1R6TA 5FI3A 2H59A 1QR6A 2E1PA 4GZLA 4RJJA 3E9RA 1I6LA 2X23A 2ZE8A 1CUYA 4CDMA 2M32A 2XADA 1W36B 5HMLA 5IVIA 2YXNA 1JLMA 5FTWA 3S4YA 3HB9A 5AVWA 3RRYA 2M2IA 3AZPA 1PBNA 3FX2A 4FQ5A 1IJFA 3N75A 2DG2A 1FUUA 4TRRA 1BYUA 5E1OA 2ZI7A 3IAM6 3O83A 4F6RA 3GBVA 3N2IA 5HF9A 2WJGA 4HDKA 1ADYA 1NJFA 1WWKA 2OKCA 4S2EA 3MERA 5DDIP 1OUMA 2ZYRA 3GG2A 1ZJJA 1XXHA 2AEMA 2ZBQA 3MC1A 3E8MA 3IUJA 1KQPA 2ZVDA 1TU3A 1T1GA 3GEIA 3EUWA 1IN5A 4LC1A 4XX1A 2EJUA 3PEWA 1B23P 3L6RA 1ZI8A 4CCAA 1SC3A 1ZINA 2NX2A 1O0BA 3AINA 2BTOA 3EDYA 4IHQA 2CEAA 4MZDA 3B12A 1BE0A 4QYTA 4KQ6A 4X95A 4LGCA 2IS6A 3K71B 3M9XA 4M46A 4RJ2A 5FA8A 5HRAA 2HUPA 4M86A 1WDTA 4NMLA 5D3MA 3MB5A 5GAJA 3URMA 3W2GA 2JHCA 4NJMA 1YQ9A 5IJAA 5BYJA 1G5RA 2FR8C 3PXEA 3TEMA 4EIWA 4RTJA 1W6UA 4N7RA 3MLEA 2FSVC 3V8MA 4E2WA 1O8BA 5F64A 4UUNA 2K2WA 5HFJA 1T43A 3MCVA 1DI0A 1WXFA 3S5UA 3T3IA 1WCWA 4GPZA 3W7VA 1S8FA 4DSZA 2O20A 4D57A 2J0EA 4ZA2A 4Y6GB 2IPMA 1CZOA 5HEKA 4BNKA 1ADJA 1EVLA 2D5IA 3GJ0A 5HIMA 3RYHB 1NHGA 3SD7A 3JALB 1RADA 4DW8A 3S2ZA 1IG3A 3WIVA 5AVUA 3GCXA 1NNUA 4XA8A 4LCBA 5B30A 1Q22A 4G07A 1FP6A 1ECPA 5JC8A 3BXHA 1P6QA 1SEVA 3KB1A 3KZNA 2P78A 5FKJA 3WJ1A 4TRJA 4HQ0A 2NQTA 5ALHA 3TKYA 1Q16A 5JS6A 3JALA 1G8YA 1MH1A 4BKRA 3K5HA 1QH8A 4TV9F 1YOVB 2QUAA 3K2IA 5FHQA 2H1RA 3FLAA 3TXAA 4ANFA 3NH6A 1T29A 1P4AA 9GPBA 3VHXA 5HKKD 3LT4A 5C31A 3PNBA 1VB5A 4CZ2A 2ATXA 3VNRA 1W5SA 5KOYA 3UK7A 3T7JA 4IGEA 3R7LA 2HRRA 2PX5A 5D86A 5DP1A 5ERYA 2GZSA 4RZXA 3M5WA 2UUBB 1KVTA 1A27A 1NFFA 3V2HA 3V46A 1EP2B 1WE2A 1AXEA 1J22A 2P67A 2RGYA 4N0QA 2XAUA 3SM9A 4ZI7F 3RRNA 3RRBA 3F98A 3HKCA 4R2KA 4JV5B 3W5DA 3GAFA 1NQ5A 3LHIA 2AOUA 3DVLA 4J9VA 4DV5B 2FMTA 3AL0C 1JAZA 3R3ZA 4URXR 3V1NA 4AY6A 4PPYA 1KBQA 2DFDA 2AG6A 1GKIA 3PP8A 3RIGA 5H81A 4QFBA 1JLKA 3K70C 4HNQA 3L7NA 1U8YA 1RD4A 2AI1A 1EFVB 1EFUA 3HB5X 3FWKA 4TMTA 2BD0A 5C8YA 4D4GA 4HT3B 3PVCA 5DTIA 4INAA 4BE7B 1E2IA 2OGSA 3C8ZA 5FA5A 4B3IA 5CB8A 1JRLA 1S4MA 1TPZA 2SCUB 4IJUA 2V7PA 5SICE 3ZE8A 4UBOA 3RYHA 1JDNA 1VKJA 1NN5A 2QWXA 5KCZA 1X13A 2L17A 1SBHA 4WXRA 1ZR2A 3V2UA 4IFIA 1F06A 3GT3A 2C4HA 4U7TB 3FNBA 3VVLA 1A04A 2QN3A 5H70A 5FPQA 2PEZA 5KYWB 5KVVA 3CZCA 1E59A 1NTRA 4REMA 1DAIA 3W4KA 3DE1X 1S8NA 4KFCA 1P1CA 2B34A 5FWXA 1NX6A 1KO8A 5KTMA 2Q3DA 5BQOA 1PT5A 5HK8A 4NS1A 2BF7A 2X8BA 1TF7A 3F97A 4LYJA 2O1SA 4YYZA 1FVOA 1ML4A 2ZRAA 4PX2A 5CPBA 2W90A 4G0NA 3SJCA 2P2YA 3BBLA 1HYBA 1K97A 4UFOA 3ZDEA 3EZXA 2GCPA 4U9UA 3E9MA 4IVNA 2O2SA 3QTTA 3TJZA 1ODKA 3OKCA 4LCJA 1RJDA 1FFCA 4H2DA 5HKOA 2PD4A 2QN1A 1RKVA 4JBGA 1FUEA 2YICA 4PYLA 5M04A 2P4SA 1Y4AE 1OIXA 3MF4A 1T6BY 1JEEA 3I76A 1RJ9A 5JQGF 2YHBA 3CUSA 2QTNA 1KARA 2E89A 2D3WA 2YZGA 4MUAA 3UFBA 4OJKA 4C43A 2P11A 3AM4A 1HL3A 4PCUA 3B2QA 3FOWA 2O2CA 3N86A 1VJRA 3ZXYA 5ALZA 1JB9A 4FBLA 3O3MB 2VP5A 3E3LA 4RDCA 3UWOA 3ZQUA 1Q6YA 4C7XA 4G89A 5K3DA 4MW5A 4WBNB 4KGXA 3TOVA 5EJ2A 3WL8A 3ZZ0A 1X1TA 4E2XA 2W4MA 4TVOA 2IZ1A 4PVCA 3E70C 3U3JA 2PWZA 2H11A 5FADA 1V6SA 2VA8A 4CF5A 4Z0HO 1R88A 5HNKA 2XKKA 1NXQA 2GXQA 3JWJA 4PLWA 1F9AA 3PXCX 4YREA 1UBLS 3WGIA 2XDQB 4U8HA 3BREA 2ZYHA 3RF7A 3TZQA 5A4KA 5JPDA 2GEBA 3WK5A 1F4LA 4L15A 3O47A 4QUAA 1FXSA 1G8SA 2XTMA 4G5OA 3PYLA 1KYVA 2PANA 4DCSA 1FPMA 1Z6GA 5LQAA 2KYRA 3ORSA 4I9UA 3PCRB 4RKWA 1QHEA 5EKXA 5JRDS 1JEYA 4CMHA 4RD0A 2WZDA 1M34E 1Z6QA 4S04A 1YBAA 1R9MA 2QQFA 2X15A 2Q62A 1IK6A 2B98A 3S2GA 4F45A 4UTVA 5F4ZA 1O57A 3ZV4A 4XW2A 5JSQA 2HQRA 3ZUPA 2EQBA 1PFWA 3CLTC 3C8HA 5KBYA 2ZFUA 1BYIA 1CUJA 3DZFA 1UBTS 2WR8A 4V0ME 3I8SA 3D3EA 1ILWA 2YXDA 1Z4OA 3HCWA 3T95A 2EJVA 3JU3A 5IAKA 4QM7A 2R5WA 4G0XA 4CGZA 5BSVA 2BEUB 2R6HA 4INOA 1WR8A 3MTDA 5IT0A 1L5MA 4F4CA 2UYCA 1QG2A 1U98A 3BRWA 2XJ9A 1NVWQ 2VSOA 3E0QA 4MEBA 1OXBB 1U9ZA 1W2GA 4MO9A 4PLVA 1JR4A 4OXRA 4I36A 3E0XA 5LFAA 2OA0A 2O8VA 1RFGE 1UZAA 3EASA 4Z9FA 1E9BA 2GPAA 2AD1A 3L7LA 1JYSA 3OPYB 4YRNA 1DRJA 1N5DA 5BXQC 3R6TA 2CKMA 2AN9A 1NRWA 3NNNA 3SR4A 3D8SA 4NZNA 1E6KA 1VGQA 1Y3FE 1CETA 2IS1A 3RG8A 1L5SA 4I5GA 3EB9A 2OTCA 3DKKA 4TV9B 1DEKA 4QYIA 5DHRA 1WSBA 2VDVE 4NSNA 5JLAA 1OAOC 2G5CA 3QUAA 4QOEA 3NW9A 4HTFA 1RHJA 3OEYA 2PFGA 1A82A 1G3QA 2H7XA 3ADKA 3QXSA 4WY8A 121PA 1H1LA 4KIUA 3T5GA 5KNCH 5J4VA 2I3BA 1XR3A 5DWVA 4D26A 2ORIA 2YNMA 5A4MS 4JT8A 4UJ3A 1P91A 2JRCA 4P53A 5DNUA 2IC5A 1CHDA 1HA3A 1DKMA 4BB9A 2IHNA 3I05A 1K7EB 4JHLA 1V7ZA 5G0VA 2VATA 4B3BA 4U2CA 4WZAB 4CG3A 1B6TA 3O7WA 4LZNA 1QH0A 2FSPA 1C9EA 2W98A 3KVNA 1X9GA 2H1SA 2VHUA 3HP7A 4MI6A 4DLWA 3SYKA 2OV8A 4D8XA 1ACJA 1SXJD 1BJKA 5EE5B 1U02A 3UN1A 3DE0X 1E5DA 5DHFA 3S7TA 1H0KA 2O8NA 4Y1RB 4NWIA 1X7HA 3G5MA 3SXJA 1EFKA 1YL7A 1Y5NA 2HH9A 3C3WA 3LVFO 2AHOA 1ZGJA 2WMOB 3M89A 3OCYA 4FI3F 4I08A 3VYTB 5BSHA 2AKAB 3GXBA 4Y9UA 1PEYA 4HFJA 4PAWA 5H3CA 4MUGA 1E9FA 2GPTA 5IKEA 1TJ4A 3HVHA 3M1AA 4UEJA 1EK1A 4AURA 2EC5A 2V7VA 1EZ4A 3SSNA 4IRXA 5BVHB 4N3GA 2R7MA 4E2ZA 4HAVA 3DL7A 1ZVMA 3EZGA 4LY3A 4MTCA 3WFZA 4YT8A 1ICEA 2WKQA 2WHRA 3C3BA 3HDYA 3E9EA 2VF2A 2ZCVA 4KODA 4U3JA 1JEYB 3KDSE 5DXJA 2GAOA 2QUIA 3GGSA 4GOKA 2XQVA 4K87A 2GESA 1EIZA 2EZUA 2WDPA 1YT5A 4YO7A 1PIWA 1C3VA 1M6YA 5F98A 5DKFA 2YWJA 5GZ3A 5I7HA 1UEIA 2ZBUA 4D25A 1J33A 4A9AA 3TPCA 3JQBA 4LOAA 1IULA 1T2AA 3YASA 2GO7A 3ABZA 2ORYA 4MWZA 4CUKA 1L4MA 4DPKA 1DTSA 3HG7A 2UYQA 1Z7YA 3UAXA 1PKEA 2ODAA 2HJGA 4MH0R 1EWRA 2GHQA 3NJRA 1HT1E 4CR8A 1FNBA 5EYPA 3JRXA 1TK2A 1ZA2A 3KOZA 3G1UA 1PNQA 4JQCA 4LBYA 1ZBDA 1W85B 4K7JA 2NTVA 3GIDA 4O4HB 4B6GA 5I7EA 1VBNA 1P8AA 4AP5A 3I9NA 2B3DA 4UHDA 1YFLA 4CHTA 4Z3KA 1ZJZA 5JSZB 2Q9CA 2RGUA 3THWA 2Y1KA 3PB3A 1KDRA 1WMAA 3WG9A 1SK9A 3N2YA 3OETA 4JI1B 2FQ1A 4RD6A 1KY4A 2GPJA 3GO4A 2EGHA 4FCWA 1THTA 4LW8A 4B34A 4H3KB 1BAPA 1HUQA 2UVPB 4NYJR 4B31A 4F1KA 4QKQA 3W5HA 3UMBA 1T2EA 3HXMA 5FBZA 1KI6B 3A11A 4CEHB 5B2ZA 1GLGA 1G0OA 2ZJYA 3BGDA 4K9LA 4B9AA 2A4MA 2P9YA 3D8NA 3BTUA 3Q7SA 5T3UA 4MW2A 2H4ZA 2Q7OE 2OHIA 4P35A 4G0OA 3VNSA 1BKYA 3EAGA 1KDYA 1U9CA 1ZIYA 4NIMA 2W6NA 4ZOBA 5IC6A 1ZK2A 4BXOB 4LE2A 3TQSA 4UXJA 5U4XA 1CS4C 1JBEA 1E79A 2IYXA 3BIXA 3C3MA 1WULS 3MUOA 4IMRA 1ODFA 4PBSA 4XTRA 4DYVA 1T1SA 2QRHA 4K6OA 4DR2B 1QJ4A 4YXWD 4EW6A 2VCYA 1A8UA 3HJNA 2CMFA 3A4MA 4RDXA 3GJSA 1L7BA 1CY0A 5BOSA 1U0NA 1NAIA 4GZ6A 3HQ4O 3DSRA 2YNMC 3L79A 4O4LF 3ZY5A 1O5TA 3SXPA 4WMLA 1UPFA 2IBMA 3IGFA 2H0QA 1G6OA 1YBVA 5EPUA 1VL8A 3Q3JB 1J5EB 1LTKA 3T7EA 2WG1A 2IUUA 1LCIA 2O4CA 2PUGA 2I1LA 4JOQA 1OC2A 3GLUA 4GBGA 4CKZA 4AS2A 3WL4A 1ADBA 2PRSA 1BG6A 1P3DA 3F7MA 4GEGA 4JFAA 2ZM6B 1EWQA 4OM8A 1ODSA 3EY9A 1KR2A 1YE5A 2JFFA 4BZQA 5DM2A 4YQFA 2IS4A 4NYJQ 4CTOA 3C6MA 1RQNA 3QHQA 1H2ZA 1I1QB 1Y6JA 3ESYA 2FG6C 1CERA 2ZRJA 1HFWA 1MFPA 2AFIA 3RSSA 3IESA 3PL5A 2REXB 5IFLA 4MPJA 1NBOA 1QQBA 1RMYA 1EFRD 5FOQA 4HQ6A 2GLUA 1XTIA 4BKOA 1TZBA 3KSMA 5DSZA 4AZWA 2HTFA 3WDLA 4XD7D 1YS9A 2J6IA 1E8DA 1A8PA 4P31A 1NHWA 2PSJA 3Q3EA 4H3SA 1NAHA 3ASVA 3SY8A 1NXWA 2V74B 4FFWA 3D81A 3FPCA 4IOLA 1YR7A 1U11A 4W6ZA 3VR5A 5JDCA 4PC2A 4QJIA 4AVYA 1KY3A 4DV4B 3UATA 4JUIA 3WZMA 2J0SA 3ZBQA 2OYSA 3VHXB 1X15A 4QOFA 3SNKA 1EX7A 1P74A 2PX2A 4YRRA 2W43A 1C0IA 2PA0A 4HB2A 2WZQA 3MMPA 4JR2A 4C7OA 4DSAA 1DWOA 1C0PA 4INZA 3T5MA 4ZCTA 5K0GA 3ABOB 2UZ1A 1WQ3A 2JH8A 2RONA 1XL1A 2XMPA 4O63O 1EG7A 4Q93A 4UCXA 5FO0A 3S28A 2D3TA 2B8JA 1K75A 3ZV7A 4GKJB 3LDFA 4PZCA 4C1BA 1NWHA 2XQKA 4DVGA 2ECKA 1WXHA 2ZTSA 3DCNA 4P3XA 2DFPA 4DG9A 1MT3A 3COSA 3AESA 3HU5A 1UBFA 2A1TS 2ZBFA 1LTHR 1OF1A 3MWFA 1TM4E 4P7GA 2F17A 3EVAA 3WNDA 1IU9A 1R9GA 3DZDA 1TZCA 3N05A 5BV0A 4RMGA 4JB2A 4UQOA 4S0ZA 3VO2A 3M6VA 2NG1A 3SF8A 4GPIB 2QL9A 3OEEA 3AB3A 1Z6TA 2BFBB 3BKXA 3CF2A 1ZRSA 2C3MA 4EW3A 3U6KA 3C8MA 2X0IA 3DHYA 4K05A 5EP4A 3TSZA 4P1ZA 4RLSA 5CA1F 3GARA 3PHLA 1JQ5A 2CJWB 3LF2A 3NDRA 5C8ZA 3PNSA 2X5XA 3SVLA 1WD7A 2XLCA 3NC1C 4F5YA 4QIHA 5EIEA 5IYZF 1EUCA 1ZIXA 3EPRA 4LZOA 3RIEA 3U7RA 4YBZA 1SQFA 2EFYA 1TMKA 2ZJ4A 4MKFA 3D7LA 3LG2A 5B4VA 4FN5A 4U6QA 2PRIA 4E5KA 3E1GA 4BQSA 1MQAA 4J03A 3CLSC 3HR4A 3O1LA 3IAS6 2UXBB 1O95C 3OCWA 2PTGA 1ZM2A 3ILVA 1RP7A 4CCWA 1VSQA 2CLEB 4PF1A 4YT5A 2NYRA 3LHSA 3EYWA 1JAXA 3CZPA 3PQFA 4O5AA 4IIYA 4X5OA 3GLFA 4GD3Q 3RC8A 1IDN1 3LO8A 2PT9A 2J07A 3SOPA 1S3FA 4HAZA 4JBNA 2NAFA 3C85A 4XDHA 3BQNB 4Q9KA 4HHEA 3I5YA 3CKYA 4BHTA 2ISSD 3A3PA 3K0AA 4MKGA 4F46A 1P7CA 5CVTA 5K20A 3SVTA 2ZB8A 1T8RA 4Q1CA 1EE2A 1H4SA 1LVUA 5K8UA 5KQPA 4PN3A 5JJBA 1UXHA 2W6ID 2GEKA 3EODA 1GPH1 4KXWA 1UM9A 4LOJA 3NHBA 4ZO9A 5DVZA 3RM3A 3UGQA 2EBUA 2CD9A 2GA9A 3BH7A 3PR2B 5JANA 4I55B 1PX2A 1GZUA 3IALA 4H16A 4G0QA 4TLMB 5FWXB 4HUQA 3E18A 3OZVA 3F6BX 4O25A 1T1IA 3MJDA 3RRXA 3SDBA 1L5QA 5BORA 5CX4A 1W49A 2VHTA 3UJ9A 2H8KA 3TQTA 5KJ6A 4F11A 3VKHA 3WL5A 1X77A 3JW8A 3T15A 1LVHA 1F9EA 4Z9AA 2ZAYA 2LUOA 2WWRA 3CNOA 4BX3A 3K0HA 3DTTA 2TMDA 3H8WA 4L50A 2CY0A 2CB0A 4PLGA 3OZBA 1A5TA 1JDBB 2X1VA 3DMFA 3LCVB 3U48A 2R00C 3VBEA 1M34A 3PA6A 4DLKA 4I99A 3IB6A 3ZGNA 1WCXA 3HLTA 3UAVA 3IHTA 3NWPA 2JIPA 2VAMA 2OZVA 2QY9A 1I3NA 2WT4A 3KUDA 1SD2A 2DR0A 1CK4A 3Q4GA 4KIWA 3D3QA 1RAHA 2D1FA 4TSKA 4C1NA 5C1DA 1EWYA 4Q1EA 1ZDMA 2JFZA 2QXUA 4P4GA 3V7FA 3WGVA 3DDOA 4XWGA 3HI6A 1XLWA 1P4HA 1SIWA 2HLHA 1JQBA 5LKAA 3L7BA 2KS6A 1NU6A 4UOQA 2RC6A 4BFSA 3U19A 3QPVA 5KZMB 3CKKA 2WRZA 2I2BA 3OPVA 3KFVA 3EFHA 1KVRA 3CISA 1GIAA 2NO9A 4CQJA 1QRUA 3KOXA 1NM5C 3L0CA 4UPVA 3NNSA 3O31A 4Q3KA 1TCBA 3F1KA 3T4UA 3FKSD 3P0RA 3A6KA 4Q12A 4IHJF 1C4KA 3KLMX 5LOVF 1BGVA 3HXLA 4DRXA 1DJQA 2AOXA 1MP0A 2R1UA 5NULA 2A86A 1MB0A 2HRZA 2P3SA 3DM5A 1Y7IA 4Q9IA 3ICQB 4RK6A 4ARSA 4CI9A 2IPOA 1PI3A 4YMUA 2HJSA 1VJCA 2HRDA 3LUAA 4DEYA 3KLBA 5C1PA 2IU6A 3KZMA 4Q1AA 4ALNA 5A0FA 3OESA 3DF9A 5D2CA 4HX5A 2HBYA 2XOKD 1VYHA 3I53A 4CDNA 4TSFA 1OJLA 1K6EA 5GWXA 1SRRA 4FHZA 5IANA 3AVOA 3G13A 4FZRA 2G1JA 3SHTA 1I7SB 2DUWA 1UJ4A 2N47A 1NBIA 4FFLA 1NQVA 3KQWA 3KEMA 4DR6B 3Q3IA 4OUDB 1YI1A 2D62A 4DFDA 2QTVB 5TX7A 2QU7A 1F7UA 4ISBA 3ZDRA 2YJGA 2LDBA 3U26A 1E7WA 4QGGA 4A16A 2O57A 3KB6A 3I01A 3MN1A 3MMXA 4O2BF 1M8PA 3C3JA 3KSRA 4MI3A 3C1UA 3CRRA 4QARA 4KK3A 2V4ZA 4HDRB 3UZUA 1BZYA 2WIAA 5DB4A 2LV8A 1ORHA 3DFZA 3OLWA 3R0XA 4L7VA 3T1TA 5LDDC 4CKEB 3OP4A 1OYOA 3IBCA 4HLQB 3CIFA 2HV8A 5FUWA 5K45A 1LH0A 4YJFB 3FTQA 2QX7A 3EPJA 3OX4A 1IJBA 1BQ4A 1RFLA 3VO9A 5TMPA 2XMCA 2QVCA 1JT2A 5BXYA 4ODIA 3RNOA 2FWJA 3SF0A 1WXDA 3N6RA 3UT5B 4RD2A 1X7YA 4C3ZA 1EQAA 2FOXA 1PWYE 2VWHA 2C8KA 4JU8A 5UKDA 1W73A 2YVLA 1RU3A 2O07A 4GT1A 1M7GA 4Q01A 1VPWA 4GM0A 3VC7A 1UMCB 4H77A 3W1WA 1JLRA 1NUAA 1ZVVA 4BB6A 1G6HA 3TB6A 4EY4A 2X5KO 2XAAA 5HA5A 2O8FB 2IQIA 4ZC1A 1W52X 3ZE6A 1WUIS 3FF4A 3K9QO 3CPEA 1FZQA 1JXOA 1Z8NA 1KHTA 3GOHA 4GBED 5EUQB 1EGHA 3NAZA 4ETWA 1YCGA 1KOJA 1VIAA 2HEIA 4KGDA 4AECA 4MVJP 1E9VA 1IAVA 4O3FA 5EWLA 3WSVA 1OXTA 2WFLA 2PUTA 3ETJA 1F6DA 4YCBA 3QBDA 1HNWB 2AA3A 1V2HE 2EZ9A 1Y3CE 1HKHA 1E6WA 1M9NA 4GBMA 1E32A 2FPIA 1ZUIA 3LVRE 4P36A 5ALNA 5J47A 1I94B 4MS1B 1TYEB 2IA5A 2J3QA 4DNFA 4IILA 3PNPA 2ZRLA 4M1YA 3CCCA 1NOIA 4HFNA 5I01A 1B8NA 1Q1AA 4WOPA 3HWSA 4WY2A 1BGXT 3HBJA 4KJXA 3F6SA 1BMFD 4PG7A 3ZKWA 4D99A 5CLGA 2YJ5A 4YRFA 1RAFA 3K8ZA 1KRXA 1B0PA 2RJ3A 2VDOB 4JKOA 4Q3LA 3ITNA 4HWGA 3VXKA 3ISVA 3TCKA 1E8NA 3QI7A 3W2IA 4MJ7A 4R8LA 1BE1A 3NHMA 4KBFA 3D8TA 1LJLA 3QVUA 3QIAA 1W0CA 2HXYA 2ACEA 4RE6A 5HF5A 3VR1A 4EJSB 1CUCA 2FRVA 3VDNB 4BJ1A 2BDUA 2QSJA 3EXHC 4QGHA 1NSFA 3WYCA 2IEDA 4G9GA 3OOHA 2I2CA 2CLKB 3JQDA 4C4ZA 5CNKA 5G0SA 5J5VA 1FVXA 3FIJA 2XI4A 3H83A 4G67A 4F9EA 3LPNA 5CCDA 5K0LA 4JP1A 1EMDA 4J94A 3R7AA 3HFSA 3AH8A 3TQCA 4BQRA 5FIUA 1HMYA 2V5VA 2P2GA 3JZDA 1U7XA 2HO5A 5CB4B 2XBMA 3KJFA 3FSGA 2DVMA 3ZD7A 2AEFA 3PJRA 2BTEA 1GQOA 5KNBH 2H5EA 5BPHA 4O0LA 2MYUA 4K9KA 3H5LA 2N75A 2E4WA 2NYVA 3LP6A 1MJFA 4JY7A 2RH4A 1UQRA 1Y89A 2NNLD 3LCJA 4J1TC 1KNQA 3AYXB 4YRIA 3FA2A 2XA9A 4GG1A 3AETA 4LRYA 4TV8B 4GF5A 3UV6A 1R66A 1SHZA 2X0FA 1U6KA 4UTNA 1S7CA 4MK4A 1MZPA 2ORWA 1IAQA 1E92A 2OO7A 3WYAA 5G40A 2OC9A 1U2DC 1X94A 4Q24A 4BNGA 3OSZA 4EMBA 2JIRA 3GD7A 4W99A 5C18A 4PRYA 4C01A 1FFWA 1CQIA 3UAWA 2VJOA 4YRMA 1T1EA 5CG2A 2B94A 1ES9A 3ROFA 1W1UA 3RU3A 5CA1A 3OQNA 5BUCA 3JQBC 4WVFA 3TS1A 4DR1B 3ENNA 4GM1A 5I4CA 3QTLA 4AJ9A 1EHYA 3AJ8A 2FPPB 1HQYE 1V0JA 3A1DA 2AD5A 3QF4A 4US2R 3HDVA 3QOYA 2J7PD 1ZQ1A 3O2QB 2WFLB 1XF1A 1ADCA 1XCBA 4FU0A 2FVYA 3I9OA 4U7PB 3TQOA 2BAGA 5LOVA 3TIFA 1HYQA 3FPKA 1TVCA 3B53X 3WKCA 2QN9A 3B1JA 2NO0A 4NI5A 4HXFB 3GJ7A 3EQ8A 3UOWA 2JGLA 2O8FA 1L5HB 4R2LA 1SC6A