2NW6A

Burkholderia cepacia lipase complexed with s-inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined X-ray diffraction and QM/MM study of the Burkholderia cepacia lipase-catalyzed secondary alcohol esterification
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Lipase
total genus 131
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nw6A00
5ALGA 3HJUA 3IDAA 4EBBA 5AKIA 4YPVA 4NVRA 5ALIA 5LZ5A 1MNQA 3GZJA 5H3HA 5CXUA 1CUSA 1XQXA 3QMMA 2PL5A 3UUEA 4X71A 4CG1A 3D7RA 2Y2VA 4IHAA 3B5EA 4H7EA 1YB7A 2O2GA 1Y7HA 2QXUA 3YASA 4U2BA 1XLVA 1ZGBA 2H7CA 2YH2A 2W6CX 5HK8A 1A8SA 3UUFA 1R1DA 4UBNA 2R11A 4X6UA 5ALXA 5ALOA 2OGZA 2AJDA 4Y2PA 1UK6A 1AC5A 5SYNA 2BCEA 5LZ9A 3QMWA 2OGSA 2Q0XA 3BIXA 2D0DA 4P08A 3S8YA 1Q83A 4ARBA 2XQFA 1UWCA 3ZLVA 4YASA 4DNOA 5JATA 3AIKA 3ZWQA 5C8ZA 3LP5A 2BUBA 4QDOA 2YXPX 4I4CA 1UXOA 2QUBA 5ALMA 4EY6A 1K5PA 3D2BA 1LPSA 3ANTA 2HFJA 3I6ZA 4BDTA 3WA6A 4OYLA 1XQWA 4WY5A 4B9AA 2XE4A 5AM1A 2HDWA 2GYVA 3CN7A 5FPQA 1GPNA 1E66A 4H7JA 5ALJA 1DU4A 5HK9A 2JGMA 1ZI8A 1DT3A 5I8PA 2XUFA 1AQLA 2DHDA 1MT3A 5KWIA 1N1MA 3NOXA 3EQ8A 1XZDA 3STUA 1C7IA 2QR5A 3R40A 3C87A 5A7HA 3SX4A 1P0PA 2J4FA 4GDMA 2JEZA 4L9AA 1DX4A 1F8UA 4C6HA 4CIAA 5JAUA 2RGUA 2HADA 1SCKA 1GGVA 3H0CA 2WFLB 1LPBB 4I19A 4DLNA 3MUOA 1E8NA 1PJAA 4MEBA 2WM2A 4DMCA 3I28A 5ALDA 5DYWA 1VJ5A 3UMJA 4E11A 5ALTA 1FSSA 4G4GA 1P0IA 4E46A 4ROTA 4Y9SA 5AO9A 5C8XA 1VKHA 5T4HA 1R9MA 5AIBA 4QA9A 2PSJA 3G8YA 4OU5A 4CIBA 4HTAA 3IULA 1XRMA 3PUIA 1RP1A 4P9NA 1TCAA 4HVTA 5C7YA 3QMVA 5AKEA 1LPPA 2XUIA 3SC2A 5FXMA 4B9EA 1CFJA 2VSQA 4I3FA 4X00A 1LNSA 3BWXA 3KDAA 2EDAA 1VZ3A 3FCXA 3WL6A 1SC9A 2VAXA 2OXEA 1OCEA 1A8QA 3PE6A 4J0HA 1XZBA 1ZD4A 2OCKA 3H18A 5AKLA 5EHXA 1YB6A 2WJ4A 4QE3A 1P0QA 5FLKA 3SWWA 4J0JA 2DQYA 1MAHA 1TIBA 1EA5A 2DCMA 5C8VA 1ZIYA 4A5SA 1BU8A 5CW2A 4FDMA 4Y2SA 1K4YA 4DNPA 3AIMA 5AM2A 2OAEA 2WFMA 3O4HA 1SFRA 3C6ZA 4DSZA 5HF9A 1QIFA 1QIKA 2PBLA 5AM5A 1JFRA 1TAHA 2RAUA 3WJ2A 3FSGA 1WCYA 1ACLA 2QJWA 4FTWA 4XJVA 4BB0A 4MWTA 3TRDA 4OPMA 2OGTA 4NZZA 4WFJA 4AZ3A 1W4LA 3O4JA 3PI6A 2E3JA 2WFLA 2VAVA 4B84A 2PUJA 1GPKA 1P0MA 3O9VA 3WK5A 5LZ4A 4M0MA 1VE7A 2PX6A 4X93A 4BP9A 3G0DA 5JD6A 2B61A 1CUCA 5SYMA 3G0CA 2JEYA 3AZQA 4HXFB 1U8EA 4Q3OA 2WIGA 5IVDA 2Z8XA 2WU3A 1HLGA 3G0BA 2V98A 5E2IA 3FCYA 4V2IA 1ETHA 3W04A 5K3FB 3PFBA 4CCYA 5KWJA 3IURA 1EB9A 2QMQA 5EHNA 2AJ8A 4X85A 4U2GA 2LIPA 5EIHA 1VA4A 1LBTA 2WTNA 3L1JA 1NU6A 3AZOA 4QWMA 2BJHA 3E4DA 2HA0A 5K3AA 2DFPA 3VVLA 4U2FA 4QNNA 1DQYA 2HFKA 4F21A 4FFVA 3VJMA 4BP8A 4B83A 1QIEA 4L72A 4ZV7A 1GXSA 4Q3KA 1XZFA 4CG2A 4FLFA 4J03A 5AM3A 2HA5A 4XVCA 2PSDA 3IUNA 1ODCA 3R3YA 4RPCA 2XLCA 3DYIA 4G8CA 2XMSA 4TGLA 5AKXA 4UHBA 1YA8A 2W22A 1Q84A 4BZZA 3QH4A 2VJCA 2GBGA 4AX4A 2XUGA 3FYUC 5A62A 4DTCA 5ISMA 4Y2QA 1G66A 4Y2XA 1CUJA 1J07A 1QIGA 3GFFA 2BKLA 2ORYA 1Y7IA 1CUEA 4X6YA 3WA7A 4H7HA 3W2TA 1EVQA 1DWOA 3DJYA 3W05A 2VEOA 4MXDA 1ZI6A 4Q05A 4CFSA 3E3AA 4QWWA 4QEKA 4FOLA 3WYNA 1KU6A 3M83A 3IUQA 5ALZA 4ZGBA 3GUUA 3I2IA 4X91A 2Y2UA 3DL7A 4EB0A 4G4JA 4IH4A 4OB6A 4X95A 5JADA 1UKCA 5D3ZA 3QM1A 5F4ZA 3L1HA 1SCQA 3D4LA 4J0CA 5ALEA 3OOSA 5FPPA 5AI0A 1QTIA 3D2CA 3H2IA 4JYMA 3V1KA 1CQWA 1QZ3A 1BRTA 2WG1A 1W76A 1UOQA 5DNUA 2C7BA 1ODTC 1XRPA 3KXPA 2QKYA 4FBMA 4GHWA 3C5VA 3DD5A 3PUHA 4LYEA 5DJ5A 2VJAA 3GA7A 4UHHA 3F8SA 4BDSA 4N8SA 3IBTA 2AJCA 2QUAA 2WHPB 3WK4A 3ZI7A 4JNCA 3WIBA 4FHZA 4N5HX 3F96A 1TRHA 1N5RA 2BGNA 5ALRA 3G02A 1EB8A 1X2EA 2ZYIA 4LIPD 4ZREA 1BS9A 1A7UA 1EHYA 4B85A 4KAAA 3AFIA 4LXGA 3STTA 3CCCA 5AOBA 3WKCA 1DQZA 2VQ6A 5AOCA 3BL8A 3WL8A 5HF8A 1X70A 2UZ0A 5ALHA 3O0DA 3CN9A 4FLMA 4MQMA 5J3JA 2Y6VA 2C58A 1CV2A 2XQJA 3WK8A 3MVEA 3FLBA 5AK3A 4BBZA 3G0IA 5IVHA 3IIIA 5AKGA 3WWCA 2C0QA 3HEAA 3AIOA 3I1YA 4UBJA 2HRQA 4B0OA 2OG1A 1S8OA 2WG0A 4WDRA 2WLSA 1CLEA 5CT6A 2ONCA 1LPOA 5BWBA 2Z3WA 5ALQA 4QDTA 3IUJA 4UHEA 3EQ7A 4EZIA 3KWFA 4X6XA 1MJ5A 3O95A 4Q1VA 4W63A 4IO0A 2D5LA 4C87A 2OCIA 5ALUA 4J0KA 5CT4A 1O6GA 3WKAA 3GBSA 1ORWA 3FOBA 1LGYA 3WL5A 3DEAA 5HFAA 2VTVA 4J0DA 3ESDA 1R3DA 1EINA 2WIJA 3ANSA 3OTQA 3WKBA 5AKKA 1YAHA 2I3DA 5JAPA 4W1PA 5JAOA 1XQVA 1Q0ZA 1D07A 4FMPA 4K2AA 1WM1A 2O7VA 2C5GA 4X7BA 4AN1A 3ZLUA 1XLUA 2XUPA 3T52A 2HM7A 2QZPA 3F9CA 3STWA 2AXEA 4HRYA 1QO7A 4S0XA 5HKAA 4FLEA 1XKTA 1GT6A 3D5EA 3QPAA 3WKEA 3DS8A 4BZWA 1YSCA 5JIBA 2ACEA 3C8HA 3I2KA 1CIJA 1GZ7A 1XZCA 1WPRA 1BEZA 3DYVA 2Z8ZA 4C4XA 4AN0A 4PQEA 1XZLA 1ODSA 2WTMA 4G5XA 5I9IA 4GWLA 1CUHA 3RK4A 4HXEB 3BDIA 1XRNA 2WKWA 2HU8A 2ZVDA 4NS4A 4QLAA 4BCDA 4N8DA 5LKRA 2Y6UA 5HCUA 1QONA 2ZYHA 5EGNA 4ARAA 1LPNA 2QXTA 3I6MA 2G5PA 2WUDA 4C88A 4DNQA 3WQHA 5LP1A 4Z49A 4ETWA 2XQKA 5FKJA 3WK6A 5E4JA 3TGLA 3WWDA 5JZSA 1XZMA 3A2MA 1E5TA 1CUBA 4LHEA 1XQYA 1E3QA 2CZQA 2ROQA 5EIAA 1TCBA 3R3XA 4G9EA 1LZLA 1XRRA 2BFNA 1CUGA 1UKBA 1CVLA 2XUJA 2C0PA 4B82A 3F98A 4H7FA 3WIOA 3X3HA 2BAGA 1B41A 1FFDA 3AZPA 3O4GA 2WSLA 2C5FA 2BUCA 3FVTA 5T4FA 4B0PA 1WPXA 1DWQA 2NW6A 3IVMA 2I3ZA 4X92A 2VA9A 1JJFA 4GLBA 4C4YA 2OPHA 3Q0TA 3G0GA 2XMZA 2JGKA 1CUYA 1J2EA 4H7IA 4L3WA 4HZGA 1K63A 5JASA 1ORVA 4P92A 3HC7A 3QVMA 1MX5A 5LLSA 3W9UA 4Y2UA 2ZJ7A 4G8DA 4PSDA 2GYWA 3TEJA 4Y2VA 2FX5A 3W06A 3LLCA 3HACA 5DTIA 5LIPA 3FSGD 4X97A 2QJRA 1VZ2A 3F97A 2RHTA 1IZ8A 3M82A 4YK7A 2AJBA 5CBKA 4XWGA 4EHBA 1TKRA 4UBIA 4M0EA 2JBWA 5BOVA 3WL7A 3VJKA 4IH1A 1CRLA 1YASA 2WJ3A 4P93A 5K3CA 3IA2A 2GYUA 3GELA 1IMJA 1CPYA 5AI9A 4LXHA 3V1NA 3RLIA 4EY5A 1WB5A 4AO8A 2CB9A 3K9BA 1B6GA 4WCVA 3R41A 5HZGA 1F0NA 1HKHA 3K6KA 2V97A 2WIFA 4H0CA 4K5QA 1DINA 2WHRA 4UHCA 2HRRA 3H1AA 4BC0A 4Y2RA 4ZI5A 2DSNA 3LIPA 4FFWA 1EDBA 3FYTA 4RE5A 3G7NA 1C4XA 4EY8A 1DWPA 1G5FA 4JH0A 4Y7DA 5EHZA 2R8BA 5ALFA 1PV1A 4GECA 1VLQA 4GI1A 4BCCA 1RYYA 1QIJA 3WWEA 5CXXA 4BE4A 4JUIA 4J7AA 3DLTA 5JZ9A 5DTJA 2ZYRA 5CH5A 4BVJA 1JU3A 4K6GA 4INZA 3I2FA 3G9XA 5AKZA 4MYDA 1THGA 2XDWA 4H35A 1K6EA 1YA4A 5KBYA 4HS9A 4FWBA 2WUEA 1GQRA 1LZKA 1ZICA 4MWSA 1ISPA 2YYSA 3RM3A 3ICVA 1EVEA 1XZJA 4KE9A 2ECFA 5AKJA 2VJBA 2I78A 1A8UA 2G5TA 3QYJA 2XMGA 2JGJA 3PF9A 2IITA 5IVIA 2ES4A 4OB7A 2GZRA 1JMKC 2PPLA 5A71A 4U2CA 1X2BA 3STXA 5K5EA 5I7UA 2HHAA 1JKMA 5ALWA 2HU7A 1L7AA 4F0JA 1WB6A 1JI3A 3D2AA 3DOIA 1CUWA 2XQIA 5E4YA 1WOMA 4BVKA 2HU5A 3ESAA 4H77A 4KE7A 1AZWA 4QDZA 4UBMA 2QOEA 1UOPA 2OAGA 5AIAA 4DSAA 4EY7A 3KSRA 4WFIA 1FFCA 5AP9A 2H1IA 4KE8A 1OXMA 3O9MA 4UUQA 5CRIA 5DLPA 5JANA 1KU0A 4HXGA 5JYCA 4LXIA 1CR6A 1THTA 4Y2YA 2ZSHA 3OM8A 3FVRA 2O7RA 3QZUA 5A2GA 2ACKA 4ZV9A 5LZ8A 3RARA 1BE0A 4X3CA 1NU8A 3GROA 5EI5A 4O08A 3HRHA 4W1SA 1VE6A 1R4ZA 3HABA 4DMHA 1QE3A 2Y1KA 4PSUA 4X94A 1VOTA 3C6YA 3H2HA 3R0VA 4BATA 1U2EA 2DR0A 5KREA 5D6OA 3ESBA 4PW0A 1T2NA 2PU7A 3VJLA 3STYA 4Q3LA 1F6WA 1PFQA 4QLOA 4IQ4A 1HDEA 2XUKA 1UZAA 2VATA 2X8BA 4D9JA 5LYYA 3BJRA 1AKNA 3LIIA 3F67A 4MJ3A 3A6ZA 4H7DA 2WILA 3I2HA 4MEAA 2Z5GA 4BYMA 2GZSA 3R3WA 2XUAA 4GXNA 3R3VA 5FOQA 5AI5A 2JIDA 2XMDA 1M33A 5DNVA 4BAUA 3VKFA 4AB1A 1ACJA 1EX9A 3A2NA 3LCRA 4UBKA 3OG9A 2XMRA 1QOZA 2WIDA 3ZPXA 1N5MA 4G4IA 1ZI9A 2IIVA 3I2JA 5YASA 4WFKA 4KR0A 3HLKA 1WB4A 1GKLA 4W9RA 5HQ3A 3HXKA 4BTVA 3QPCA 4KE6A 2XUOA 1F0PA 5LZ7A 2XMCA 5DYTA 3ZLTA 4OD0A 1YS2X 4X90A 1EDDA 3BXPA 1VA5A 1XKLA 1JU4A 5K3FA 1H2WA 4B7ZA 5IVKA 4FBLA 1K8QA 5BV7A 4HAIA 3H17A 3RKSA 4MYSA 2DQZA 2ZSIA 1QJ4A 1QFSA 3AUKA 1UOOA 4OU4A 2PM8A 1N8SA 1W6RA 4BAZA 1MX1A 1VXRA 3EBLA 2J4CA 3FYUA 4C89A 3O4IA 2DHCA 4KEAA 1T4MA 2HA4A 1QTRA 1OILA 1CUAA 4W1RA 4QZVA 1LPAB 5ALLA 1XROA 3OC0A 5K3BA 4OSEA 3V1MA 5EHQA 2EDCA 2CMFA 1JJIA 4PF1A 1SOMA 3IUMA 4H7KA 3HYSA 4KRXA 1XLWA 4J3JA 2CKMA 2WUFA 1AURA 3MUNA 3R3ZA 1CUFA 1CEXA 1RWQA 2WIKA 4UBLA 1KEZA 3MGAA 2QTBA 3NUZA 5CH8A 4Q82A 4AMYA 2IX9A 1G42A 5EIEA 2VT7A 5ALPA 4BVLA 1DX6A 3K2IA 3FNBA 4AO6A 2JGEA 4W1QA 1JMYA 4DM7A 1CUVA 5FP0A 1UKAA 4J0IA 1TQHA 2JGLA 4E14A 3FAKA 4KAFA 4CCWA 5E4TA 5T4EA 4ITVA 4DMKA 2OCLA 1ZD5A 3D59A 3DKRA 5JARA 2QRUA 3VXKA 3H1BA 3FLAA 4UBOA 3C45A 1FFAA 3SK0A 4NMWA 1AX9A 2XMBA 1EI9A 5DNWA 4A16A 5AI6A 4G1FA 2OCGA 2RIPA 1XRQA 4J0GA 1WHTA 3HZOA 4WY8A 4GEGA 4RE6A 1E8MA 2XB6A 5AHXA 2BGRA 1WHSA 1QLWA 1DT5A 5LZ2A 4BRZA 1TCCA 3QITA 2FJ0A 4YX9A 4DIUA 1L7QA 1E89A 2I03A 3H2GA 4U2DA 2WU4A 1HBJA 1YCDA 1U4NA 2BUAA 1GQSA 4JYPA 3V48A 3WWOA 4JEIA 4CCYB 3VVMA 4DYHA 2JF0A 5FDFA 4KACA 3QPDA 2WHPA 1XZKA 3N0TA 1QIDA 3B12A 5ESRA 5AKHA 4WDQA 5AI8A 1AMNA 3LS2A 2GBIA 4FNMA 2B20A 3WI7A 1U65A 2WHQA 1CUZA 2XI4A 4KYVA 3WJ1A 3EQ9A 4A23A 3D3NA 1ZIXA 2FUKA 5CT5A 5ALYA 2QT9A 4B80A 2XUDA 1IUPA 1YAJA 4KJXA 3ESCA 1AUOA 2XUQA 2PKYX 5CT8A 3WK7A 5JALA 5CH3A 5ALNA 1ZOIA 4TPKA 4OUKX 3KOOA 3OURA 4UHDA 4BCBA 4F5ZA 1XRLA 4B81A 1HPLA 3PICA 2PU5A 5D7BA 1MU0A 1QGED 1TK3A 2PSEA 4OCZA 2RI6A 4LYDA 2CBGA 2QVBA 4AMZA 2WQZA 3NGMA 3BIWA 3P2MA 1XZAA 5HFNA 2O2HA 4XX1A 5HQ3B 3A70A 3WK9A 3W9BA 3ZV7A 3WLAA 3PF8A 5A7FA 2HA2A 3DNMA 5ALKA 3WMRA 4EUSA 2VT6A 3I6YA 2VF2A 1JT2A 4RNCA 4U2EA 1ZJ5A 2P8SA 3KWJA 1BCSA 4FNGA 4G8BA 1QO9A 2XUHA 3CXUA 3C6XA 2HL6A 3I1IA 4K6HA 2CJPA 5FRDA 2XT0A 2RONA 4AO7A 1UK8A 4UFOA 4EA6A 1CUXA 3ICWA 4PO3X 1CQZA 2J3DA 1QIMA 4QDUA 5AM4A 3G9UA 1C7JA 1R50A 3FYUB 2EEPA 4C4ZA 2JGIA 2V96A 1H2ZA 3C5WP 3AILA 2PVSA 5HKBA 1G4HA 3PDCA 3V9AA 1IVYA 4E15A 3ILSA 4PV7A 2HA3A 4FKBA 2HIHA 3D0KA 1ZD3A 1XZGA 2X76A 2H7XA 5A6VA 3BJMA 3PFCA 1Z68A 3DCNA 1UK9A 4Y2JA 2JGFA 2YASA 3BF7A 5CT9A 5AM0A 1FFBA 2PSHA 5JAHA 2PSFA 4UHFA 1FJ2A 5AJHA 4ZRDA 4DMFA 1EK2A 5HF5A 1XFDA 5AI4A 4B6GA 4N5IX 1W52X 1O6FA 3BDVA 1MN6A 4ZWNA 4F60A 2H9YA 3FLEA 1IZ7A 3L1IA 3DDUA 7YASA 1IUOA 3U1TA 4WJLA 3QBJA 3Q8WA 4HRXA 3IB3A 3VISA 4KRYA 2H7YA 4K6KA 2O2IA 5CMLA 4MQLA 1Q0RA 4AXBA 1MPXA 5AOAA 3B3QA 2G63A 2C4HA 1UT6A 1ZJ4A 3H2KA 5ALSA 4EY4A 1EK1A 3AJAA 4AQDA 1HQDA 3DOHA 1I6WA 3G9TA 5AKYA 4GW3A 5JD5A 1EH5A 5C81A 1MAAA 5CTAA 2WFZA 5A7GA 3WKDA 2QM0A 5ALVA 3E1GA 5IH7A 4BTLA 4QDXA 3EF3A 2DHEA 1XZIA 5DWDA 4XIIA 1W1IA 1BEEA 1R88A 1MO2A 4OYYA 1MX9A 3WZLA 3FBWA 3H2JA 5DYYA 3S2ZA 1W75A 1L7RA 4UPDA 2X5XA 1BN7A 3VDXA 3WZMA 1H2XA 3I2GA 1QFMA 1FFEA 4UFNA 3U0VA 3AINA 3DQZA 1HL7A 2VJDA 2GBFA 1XZEA 1LBSA 2WJ6A 3WWPA 1JJBA 1MTZA 3G9ZA 3BF8A 4BE9A 4M0FA 3TJMA 1SCIA 1BCRA 3V1LA 2J3QA 5BWCA 1GPLA 3STVA 2QS9A 3T4UA 4DGQA 1USWA 2CEKA 4H18A 1GKKA 4DNFA 2FJPA 3M81A 1YR2A 4L0CA 5EFZA 4OB8A 5T4BA 1QIIA 1A88A 1CUIA 2RHWA 6YASA 5AICA 1H22A 3JW8A 1XZHA 3H19A 2GBCA 5AK6A 4AZ0A 1MNAA 2B9VA 1BROA 4KAJA 2ZJ6A 1EXWA 5D3KA 1H23A 3EIOA 2Z3ZA 3ED1A 3HSSA 3H04A 1CUUA 2HA7A 3A2LA 3M3DA 4N8EA 1BN6A 2PUHA 1AGYA 1EDEA 2ZYSA 4LKOA 2XQGA 3JYHA 1LPMA 2OLEA 2HA6A 2V9ZA 4RGYA 3C43A 1CUDA 3DKKA 1R9NA 1E8DA 1DTEA 4Q34A 1LLFA 4CI9A 2ZJFA 1VXOA 3N2ZB 1ZD2P 3JWEA 3CCBA 1J1IA 2XLBA 4IH9A 4BRSA 1Y37A 2WG2A 3BE8A 4BC1A 4BAGA 2CUTA 5HF6A 5JD4A 4TVKA 2B4KA 2OQIA 3C8DA 4Y2TA 3WYDA 5K3EA 1UK7A 2AJLI 4G9GA 3C6BA 3E0XA 4PSCA 5FUMA 1NX9A 4C01A 1H2YA 5AK5A 1J06A 4UFPA 2G4LA 5K3DA 1IUNA 3R3UA 5CURA 1YS1X 4PNZA 4CG3A 3FWHA 4ZXFA 2OQVA 1QIHA 5IKXA 3OPMA 3HI4A 5AK4A 2XMQA 5LKAA 3DL4A 4GBGA 1UFOA 3KD2A 5JZBA 2K2QB 5AH0A 3NWOA 1ZGCA 3C70A 2WUGA 5FV4A
chains in the Genus database with same CATH superfamily
1OXBB 3K6JA 1KAMA 3HJUA 5ALGA 4RTRA 2G80A 1YBMA 3IDAA 5FX2A 1QHIA 4C2BA 3KJXA 4ZFNA 2VPXA 1Q1NA 5CX1B 1BD4A 3ILXA 2ON6A 1Z7BA 2G40A 3IQGX 4N49A 4P5PA 5F3DA 4CEHA 4WN3A 4JZKA 1XDGA 3SXUA 4HDMA 2HBYA 4HSEA 1PW5A 1UC8A 2AE2A 2H85A 2MSLA 1TJNA 3B52X 2V7BA 2NNLD 4NVRA 4RKYA 5ALIA 2GRAA 3DBRB 4B6OA 3B3JA 2NN3C 4JVMA 3NHKA 1O6ZA 1DJOA 1HV8A 4Q4HA 1HYQA 1NJFA 4OP1A 2CVPA 1ULAA 3GZJA 5BSEA 4FPXA 4MVWA 3FX2A 2CL0X 1P1RA 4ZZ2A 1HFJA 4RLSA 4BNTA 3BT7A 2VNIA 2N9UA 3NGXA 3N70A 3TNJA 4CNQA 3AG6A 2C4TA 3SHOA 3ITNA 2Y0CA 2HCBA 2X5OA 1BAPA 4A0SA 2MINB 3B78A 4Y1EA 3IAS6 4BNJA 4CG1A 3OZGA 2G1PA 1ZL0A 4YJ3F 2WJAA 1BD3A 1I7PA 1U3TA 3KTFA 1DEAA 1IB0A 4HGPA 1GNRA 1SBHA 4MPDA 1SXJC 2NVWA 4B40A 1KL7A 4JIGA 2P2YA 4EHNA 5LWHA 1DE0A 4H7EA 1NOIA 2R8OA 3HKCA 4L85A 4AG3A 4FYXA 3URMA 3YASA 4ABYA 3V8RA 4C04A 4JN6B 3V8NA 3GFTA 4DDWA 4U2BA 3U1VA 4GMXA 1KKUA 4XIFA 4K26A 4A1FA 1XNQB 4CMKA 1FNDA 5H3CA 3GW8A 5DT2A 4A82A 1PNVA 3T7CA 1YC2A 3O1HB 4L7VA 2F6RA 4YUYA 1SB9A 3FPFA 1XC7A 3KO8A 4B74A 3DCJA 1W44A 4UBNA 3PX7A 4MVCA 1ESMA 1H2BA 4R31A 5ALOA 4CTOA 1U9YA 3ZE0B 4JB8A 1Z2OX 2YVLA 4E1VA 1YR8A 3BGWA 1AC5A 2RH8A 1PVVA 4G4SP 3G59A 4IG9A 4NQZA 1DPFA 4O25A 5SYNA 1M72A 1T13A 3S1AA 4V1CA 1RJFA 5B55A 3QMWA 2HT6A 2JH3A 2OGSA 2Q0XA 2AXPA 1LEHA 2P2SA 3DDCA 4PXSA 2UUBB 1PEAA 1H6BA 2QRHA 5JJKA 3S8YA 1FFWA 1LTKA 1OYYA 2RHHA 3LDGA 4RWZA 3ABOB 2VRNA 3QNUA 2G28A 2WT4A 3ZTWA 1I3NA 3ZEAA 1P81A 3LL4A 3KQNA 1FNMA 1MUUA 3OQ6A 4E32A 1HE8B 3LZ6A 2ANCA 3Q7EA 2XYHA 3FMGA 1P2DA 4ZI7A 5C46F 5EE9A 1GN9A 2NSJA 4QECA 1X9IA 3AIKA 2KYRA 5E6SA 4X20B 4MULA 1RHRA 2I62A 2OHJA 1J1ZA 3A8TA 4RS3A 4TXNA 1FDUA 3CVOA 4ZP1A 5A9RA 5AHRA 5ELXA 2YXPX 1HRKA 4I4CA 1PGQA 4LF6B 5AYVA 4RY9A 1Z26A 2QUBA 3OP1A 4WZAB 1QHHA 1K5PA 2ZRAA 3DAGA 5IUKC 2RK3A 3PRYA 2VDJA 16PKA 2DFKB 2N0SA 1ZL2A 3QKSB 1ZUNB 4OYLA 4EYSA 1XQWA 4WY5A 4CETA 1JA9A 3OSZA 4MPPA 4RGVA 3MA0A 2ODWA 4MR8A 3B5IA 5TS2A 3O2SB 2GYVA 3Q9LA 4QRHA 4X63A 2IYTA 1OJ7A 1U7WA 4NECA 4P8RA 3D0QA 3TLAA 1E66A 1G9TA 2R7NA 4NPCA 1J4AA 2HXGA 4DEYA 2VRCA 3QEJA 3JQ8A 2HV9A 4MA5A 3GGOA 3PHCA 1GARA 5E7JA 3SR0A 2WV7A 2H9IA 1ZI8A 1CJSA 2QB5A 4WL0A 5JZVA 3ZX5A 1ONOA 3GLFA 3TSYA 2O54A 5I8PA 2GZ1A 3RIMA 4YXWD 4JASB 2BRUA 2I8AA 1VBNA 4NK5A 3EASA 2C84A 2R6JA 1N1MA 1HSZA 1NVAA 3KPYA 5D1NA 3EG9B 1UMBA 3NOXA 1WULS 3DE2X 1XU4A 1J8MF 1X8LA 3R40A 3QBEA 1N0WA 3FFBA 4NCJA 1QR2A 1D2NA 1J49A 3C87A 4I4TA 4UVIA 5FLYA 4XASA 1KOFA 3RSLA 2PMDA 4UU7A 2IXTA 2Y1GA 4DLUA 1L7MA 2HWWA 5KI6A 5JDIC 3V1YA 4HN2A 1G6Q1 1ZVJA 1YRHA 2R85A 2XCUA 3KOUA 1OIWA 3P5BA 3KQPA 4C03A 3CE6A 4GDMA 1M6VB 5JH7B 3CBQA 4YRJA 1DX4A 1KJYA 3JD1A 3SX0A 3IPCA 5JAUA 1Q7EA 2P4UA 2RGUA 3G0OA 4NNJA 1WKBA 5BYKA 1SCKA 3H0CA 5LPNA 3ETCA 3RUPA 4I19A 2Q5CA 4C7XA 4A0RA 3AL2A 2VUIB 2YZGA 5LLDA 4MDHA 1I7SB 3B51X 1E8NA 4YV7A 4MEBA 3GN1A 1Q44A 2WM2A 1RAAA 3D7SA 5F2EA 4DMCA 1MENA 2HHHB 4P7KA 2JD2A 1MC5A 2ODNA 3I28A 1N2XA 4FYMA 4WXHA 5C9ZA 5DYWA 3X0DA 1VJ5A 2PBZA 5C4IA 4UC0A 1GPBA 2MSDB 3DM5A 3EODA 1M5RA 2O8CA 4OBWA 3TQCA 4O2BA 3M6VA 1D3AA 3KLOA 1NYRA 2J5BA 4KQIA 3UAVA 1EVJA 1J23A 1ICEA 2LTAA 4E09A 4OJNA 1I33A 4P82A 3PPWA 4AZ0B 4RPHA 1E9FA 2OFOA 1OFTA 4XGIA 3AF4A 4Y9SA 5FCDA 3JVUA 3LW7A 1XD9A 4QT0A 3PXDA 1L5LA 1RE0A 4E5SA 4MMXB 1VKHA 3MMSA 1AMUA 1R9MA 4PSAA 4MYUA 5AIBA 1E7YA 4L8WB 4AWAA 3ZCRA 1WSDA 1Z0FA 1P7WA 3CJQA 2D7JA 1UBJS 4PLPA 4Y6QA 1K06A 2WM9B 3IULA 3RS4A 3RWOA 5C4MA 1DXHA 2YV3A 4H0NA 3X1DA 3PUIA 1EG2A 1LSUA 3KETA 3OLYA 2I6QA 3COVA 1EIZA 1RYFA 1RP1A 5GVSA 3OU2A 5TDHA 2G67A 3FA2A 4QJ5A 3UHPA 2QE7A 4MS3B 4RANA 4CL8A 2ACVA 2VF8A 4MVJD 4R41A 1NP3A 1RJGA 4S24A 1ID8A 1LPPA 3RFUA 1PFKA 2XUIA 3QU2A 1ZXXA 1B43A 5JVDF 1AO0A 2CSUA 4DJ5X 1SXJD 1JG1A 4V02A 4G97A 1A4RA 1WQ4A 4CLDA 2ALJA 1ZO8A 3EZ9A 2FZCA 1ZA2A 3HN6A 3PK0A 3Q12A 1H0RA 4PFJA 2X0FA 5HP4A 3HCFA 2JIMA 2QLTA 1VGVA 1CRZA 1FTWA 1E9AA 2HIMA 3BKXA 5B6JA 4CM8B 2GOYA 3N2NA 1IATA 5JAZA 1LBHA 4NCBA 1UMDA 2ZAOA 2EDAA 2HK6A 4QQ8A 4LISA 1VZ3A 3E3LA 3FCXA 3WL6A 1ZMXA 2HK9A 1DIRA 5L9AA 5BUCA 3MHPA 1OCEA 2Y76A 4DV3B 2C2OA 1WPQA 3C7DB 5AT1A 1TRKA 4G9BA 3B82A 3DF9A 3H18A 3K71B 2XYQA 1Q3KA 5EHXA 4CV2A 1JG3A 2DY1A 2HO4A 3F2IA 4MW7A 4O5AA 5F2KA 2CNLA 5CDGA 4KKVA 2AG5A 4B46A 4QE3A 2WWFA 5AW5A 1M3SA 1RZRD 3HY3A 4RH3A 4O2AB 3UAOA 4L8FA 2DQYA 1W85B 4GKAA 5EYPA 3T3IA 1MAHA 4EI7A 2QDKA 2DCMA 5COAA 2Q29A 4NATA 1E2DA 3L8CA 4G85A 4HEA6 4OM8A 2NUAB 3SHQA 4XSVA 3RDPA 3LGAA 1PD0A 3FLMA 4R8VA 1MR3F 4AN4A 2VYVA 1G7RA 4A5SA 3WYEA 2ZANA 3RUFA 2FMFA 2PZJA 3GRVA 1DV2A 2OK8A 1W47A 4KPYA 5AM2A 2R6ZA 3PGVA 1R74A 1ZMRA 2P62A 2ZS8A 3E81A 1XP8A 2NYAA 3NHZA 4W7SA 1B7GO 4DSZA 3UBTA 3BXGA 2XWJI 3QU4A 2VSFA 4PLWA 1N9GA 3EISA 2RGEA 2XQVA 1QIKA 2H1VA 2NSYA 2AR0A 1D5WA 4H3KB 3B20A 1M66A 4XOUA 5DBEX 2PYDA 3ITKA 1DJLA 1TAHA 2G1UA 2XMPA 4OA5A 4TMKA 2NYUA 4AW9A 6LDHA 1ACLA 2VUTA 3NTVA 4BZQA 2QJWA 4FTWA 3QSYA 4UMVA 1VRCA 3TRDA 3MWYW 3LX5A 1YUNA 2JNWA 2C9CA 2OGTA 4OPMA 1GZUA 1TJ3A 4XEHA 5EZYB 3AF6A 4IVRA 1KP3A 3V3KA 1IQ0A 4W6ZA 3FOZA 4LFAB 1U8UA 1OZGA 3KE9A 3F7TA 3N5KA 1M73E 1T6NA 1J42A 1IBRA 1K8XB 1LC3A 3TDKA 4AUMA 5AVVA 5C1IA 4OQ4A 3PL5A 3A4MA 1PR3A 2J5RA 3ZHVA 4ZYYA 2X7HA 4AYTA 3IXMA 3V42A 1X3SA 5LZ4A 4CEIA 4PPYA 1N32B 3OKAA 3R74A 1XAGA 2PX6A 4G0QA 1YU6A 2P27A 3FTPA 4BP9A 2Q28A 4NCIA 3TQSA 4JGGA 4UARA 4L16A 5JPIA 2Z95A 2B61A 5KC9A 3VX3A 3G0CA 4WEOA 1TAQA 2HYDA 1ULZA 4JP2A 4UM9B 1X13A 1XMIA 4JODA 3AYZB 1IJBA 3MWLA 3SC6A 2QU8A 4F9GA 1R3UA 1VHDA 3AZQA 1KSHA 5COQA 3LXXA 2YWBA 4TXMA 4GT1A 5L53A 5C8DA 1VE1A 3EUEA 4K86A 4Q3OA 2WIGA 4X7PA 3U7HB 2B2NA 3AKCA 1O6BA 2J85A 2AMJA 3FPKA 2WU3A 4PCUA 4ETIA 1UKZA 1MC1A 5SICE 5ARCA 2A7QA 4LYGA 4QUDA 1D6NA 4TUYF 1ZIPA 4MMYB 1MABB 4V2IA 1RWKA 4HMPA 3FCSB 1JQLB 1BHO1 1M74A 3MEQA 3U37A 3DVAB 2G6TA 3U4QA 4HR7A 4Q7LA 3CEMA 3ML1A 4MRPA 5K3FB 1F06A 1AF4A 4XRGA 1XUOA 2GK7A 5JJIA 3P0HA 2W6JD 3ZI0A 3NATA 2F9LA 3LO8A 4GQIA 2JFUA 4WLEA 3RSQA 4CRWB 3GLUA 2LBPA 5KWJA 4F2GA 1HH4A 1KAEA 1BWPA 1EB9A 2H3EA 3PDIA 4UUNA 3GEIA 5FHRA 1XYVA 3RWMB 3CO5A 2JGDA 1CHDA 2AJ8A 4E1AA 2RHRA 2W4MA 3W6ZA 4WOJA 1WUIS 2E48A 3EUWA 4MDEA 1V9LA 3EQ2A 3GNLA 4LNUB 1A5TA 1SCNE 2VH5R 2GNPA 3A3OA 4I8IA 2WTNA 1ZUD1 1A2BA 2TSYB 1P7VA 1NU6A 1T15A 1ZOLA 2GEBA 3DONA 4IHQA 4ARVA 2B1IA 4JI8B 2QI9C 2W98A 1ISSA 4A2WA 3HJCA 3OD1A 2I71A 4M0PA 1TTPB 5K3AA 1FJXA 2DFPA 1AH2A 1VMEA 3U9LA 3WB2A 3K73O 1FP4A 3I39X 4J4BA 1EUDA 3WRYC 2VTDA 5KTSA 3VVLA 4EA7A 3QPBA 4PCAA 1E9SA 4QNNA 1E9CA 2EQ5A 4QGSA 4YUWA 2QMOA 4DMLA 3OWHA 3DTTA 2IYEA 4F21A 3TK1A 1CW2B 2YNMC 2ZUBA 3KB8A 3R0IA 2C8LA 2O1EA 3BAZA 1GQ2A 3R9XA 1N33B 2CUKA 4G3XA 2RGDA 3LNTA 4MQEA 2Z3VA 2FLWA 4L72A 1QMGA 1A9ZA 3N8KA 1ZK4A 3Q3GE 2ZBVA 3VPSA 4ZV7A 2HPAA 2ID4A 1GXSA 1KGSA 2ZYGA 1NBMD 5IC5A 3THSA 4CUZA 1QRSA 4N18A 4CDMA 2C3UA 1V3QE 4Z53A 2DPYA 1GGHA 4B35A 2FMIA 3JWIA 3L93A 1AY0A 4BHTA 3IUNA 2I80A 1DC4A 1E5QA 2FZGA 1ODCA 1P9LA 2JRCA 4N6GA 3RYHB 4RPCA 3VSDA 2XLCA 3DYIA 1I4WA 2CEAA 1T9ZA 4KMOA 4OHVA 3UXHA 4BNLA 3KOXA 4QAJA 2QIOA 2OBLA 3CIFA 2FFHA 1IG3A 2QUZA 4G8CA 4IUDS 4YGXB 3TPFA 3T3OA 1FDWA 1JQAA 3P20A 3VR6H 3J81A 1ZJWA 2C5HA 4KN6A 1IQRA 4M7WA 2IOFA 1IHUA 3ZDRA 2GQ0A 5KSWB 1Q84A 4R9UC 1BYUA 3FTEA 1GTZA 2X77A 4BZZA 3LI2A 1XVUA 3JYNA 3KKMA 3MZ0A 1F7UA 2JHFA 1BDHA 3IE1A 1JB1A 4DWWA 1VJRA 4J0FA 4XRRA 4D42A 3QNMA 4X3PA 4K9LA 2NZ8A 2QMZA 2RGCA 4WUTA 3BBPA 5TEVA 3V4VB 3VSCA 2C77A 2YXDA 2FUG6 1XU9A 4RZSA 4YAJA 1AUXA 5DOVA 5ELLA 1LS6A 4MHSA 1HE3A 3BRWA 1H3EA 1SIUA 3HP1A 3IEKA 4H4EA 3RV4A 3FMPB 3OD5A 2OV4A 1F6DA 1CUEA 2GJKA 3AR5A 4H7HA 4OSPA 2JJ1A 4X6YA 1ZLXA 3M1LA 3DJYA 5TPZA 1PVDA 3EWAA 1CR2A 4G41A 2F43B 4N3GA 4E2XA 1DTWB 2V7PA 4DNXA 1NWCA 4OQNA 5BR4A 1IHXA 4MXDA 5DN6A 2J67A 1D4FA 2IPNA 1ZI6A 4Q1BA 5C1BA 4ZKEA 4Q05A 3RLFA 1KS9A 2HSWA 4CFSA 4I4TB 1FDVA 3L6UA 3OTHA 1W8IA 3TTVA 3ZS8A 1HDXA 4DREA 4HNTA 3KLBA 2C9ZA 1NT4A 2VYFA 2P9JA 1ZKMA 1QPBA 1WHSB 3AUTA 3HDGA 4TT3A 3SI7A 3WYNA 4BLPA 3IMCA 1M6VA 4XQGA 5DLQC 2PJUA 5PGMA 3RHTA 1NPDA 2OFPA 3M83A 2HNAA 3MELA 4QO7A 1AN9A 1UDWA 2BD0A 2XBUA 3AGPA 1IN7A 3GLKA 4NG5A 2XXAB 1MX3A 3AF2A 4MGHA 2PFGA 2RJOA 5G40A 2WYHA 2RC6A 3KQLA 1BCSB 2P5YA 1HMPA 5TARA 4AJKA 3IBFA 4JLWA 3TKLA 2JPDA 3MBIA 4F11A 1HQCA 1Z25A 4FVTA 3V6LA 1DLIA 1WF3A 4G4JA 1NNSA 4IH4A 4JQSA 4K6CA 4OIFA 4X95A 3KDPA 1X8XA 1MGOA 1VL0A 2IYAA 1UKCA 2C3PA 3CUVA 4N40A 3QM1A 5D3ZA 3L1HA 5DT9A 1SCQA 2P9ZA 1D6MA 4DV0B 3D4LA 4GKJB 2XVXA 2YJZA 3GI1A 4RACA 1QTIA 4FC7A 5L3QA 1SVOA 3THYA 3D2CA 3H2ZA 3WLNA 3GCDA 3T61A 1XMPA 3AL0C 1CQWA 2HRDA 1QZ3A 1JNXX 3H9UA 4OBEA 5BMVA 3RVOA 2Q0SA 5DGHA 1W76A 1UOQA 2IU3A 3E9CA 4INPA 3BSYA 4IKPA 1KFEB 3L8HA 3N5CA 1Z4PX 2DE0X 4F7DA 1F17A 1D2AA 3DO5A 4FBMA 2LVBA 3MM4A 4LX0A 2WJYA 5CFPA 1ITZA 3BA6A 3JAKA 1WMDA 3HPRA 3C5VA 4L4RA 4LYEA 1R10A 3NIGB 2RHLA 3RO7A 2Q4OA 3CLKA 5LM3A 3AKZA 5A5EA 2O14A 2GLXA 4BMYA 2M6SA 4L2IB 4WRRA 2VL7A 5KYWA 3H42B 3DEJA 2PBFA 1OFHA 3EA4A 3OT1A 4BDSA 5JFGA 3BCHA 2IS2A 1JDZA 5ERXA 1ETUA 1N2GA 1PZHA 1ZGAA 2MSKA 3UF0A 4E03A 2QTTA 2WHPB 4JDPA 1E2LA 4HGNA 1V26A 3VA7A 1EGQA 1JPJA 1O9GA 2Z8YM 3HV2A 1ANKA 1O95C 2CD7A 3HJNA 3JQGB 1L5QA 2I91A 4M0DA 4N5HX 1OXTA 2C7OA 5ALRA 1NYQA 1F1BA 1PNTA 1AKUA 1EB8A 1QPGA 2NXEA 2VAPA 3G02A 3L18A 1T26A 3GWZA 3KD3A 3MNFA 4MS1B 4YRSA 4LIPD 5KIAA 1YDMA 2EVWX 4TVBA 4ZREA 5B58T 1E2EA 3SKXA 1A7UA 3VYWA 1L6RA 1C81A 3CEJA 4MMZB 1F8FA 4GVLA 4RTLA 1YT5A 3B7GA 3NUGA 3M6WA 4I36A 1I6MA 3AFIA 3STTA 3F3KA 4ND8A 4DXHA 2WM3A 2A9JA 2I2AA 2IEGA 1LJ8A 5AOCA 2XA1A 5ALHA 4DQXA 5JO0A 3CN9A 4Y7CA 4X3OA 4B4WA 1IPHA 1W2HA 5GJCA 2BR4A 1EWYA 2NTJA 2FPGB 3PQEA 2YC4C 4XUEA 1C5KA 3WWYA 1A0OA 1GHTA 3UQYS 4H7PA 2PANA 4E5NA 1QGYA 4WA8A 2XDQA 1CV2A 1T1SA 1MB3A 1TF2A 3MMZA 4MTLA 1W9MA 4BBZA 1CJTC 1YZTA 1ZS9A 3DZDA 4L0MA 3RYTC 1R0WA 4P31A 1JEYA 2FHPA 4ECAA 1NXPA 2IOQA 3VNSA 5AKGA 2Y93A 1OLSA 1QHEA 4YRPA 1P1HA 3UUWA 1Z38A 2HMYB 2QM8A 4IG4A 1BTOA 1TVKB 1XIVA 2IZ7A 4BLVA 3T7DA 3F78A 3COSA 5B2EA 3LKVA 3R7SA 3FGPA 3EGXA 2X15A 2WG0A 3M6XA 3MCVA 3WLPA 1E5LA 4MVJG 4BECA 1GTMA 2WLSA 1K88A 1AK1A 3F8WA 4CF3A 1Z08A 1E6LA 3QVVA 4GX2A 5LQMA 3A9SA 4V0LA 5IAKA 4ID3A 4FHDA 4QDTA 2FA9A 1RKBA 5K8CA 4HAYA 1HT2E 4IEEA 4R5MA 5LMNB 1G55A 1Y6RA 3HCRA 3VO1A 3HM2A 1C9JA 5JWHA 4ARIA 3OU6A 1Z17A 3PNBA 4I55F 2NUPB 2VNKA 5KNCA 3GDWA 5EC8A 1YR6A 5B7QA 2PIDA 3M6AA 4DXDA 4TTPA 2F1OA 4HUQA 2HAEA 3PFHA 1XCMA 3D4IA 2BMVA 5JDIA 4C87A 3H5OA 3QW2A 4GNKA 2B30A 2IDMA 2P68A 4I55A 1RE1A 1E0KA 1UZMA 4FE4A 1RWOA 1GZ4A 5CT4A 5KKAA 1TL7C 3D3WB 3VRHA 3EXIB 3TTTA 2B98A 3FHOA 3LBAA 1J24A 4PZUA 2KMLA 3WL5A 5H68A 1QKKA 4EHAA 3VH2A 5JNUA 3IO5A 2NU8A 3TLGA 3T7KA 4BFZA 4KIJA 5HFAA 4F2DA 3AJRA 1FRQA 2VTVA 1Y3DE 4J0DA 1EUCA 3D6UA 2VHWA 3ZD6A 4UTZA 4YAGA 5FADA 3WKBA 4PS1A 1J0XO 4F38A 7ABPA 4Q4JA 1EFPB 3KK0A 5ENVA 5EJAA 2XD9A 1E3LA 1Q0ZA 2H52A 4D9MA 5A3RA 3P27A 4HK4A 2CBXA 5H7XA 4D74A 4MV5A 4FJ1A 3QHPA 5F9MA 2OESA 3A0UA 2BBTA 3KZCA 2Q5FA 2I4RA 3QYPA 1WM1A 4KN8A 4MYHA 5FPTA 5JCPA 1G1MA 3B36A 2J46A 4L8YA 4XWWA 4JC4A 2OHFA 3EC1A 4Q21A 2P9EA 3AP2A 2EIXA 3PHIA 1XLUA 4X8MA 3WRVA 3ZQJA 3I61A 1XPUA 1QK5A 2HM7A 2E55A 1KRXA 4YBZA 1PT9A 4YALA 1M2KA 3UC9A 3A6HA 5CLLA 2C3OA 2EZ8A 4ZQHA 4NV1A 4EYGA 5TQ2A 1APBA 1OYWA 5EIXA 1HWYA 4DILA 1N8TA 3RNLA 3TCKA 3THWB 5HKAA 5GONB 5FTMA 3JZFA 4P0PB 1NSTA 5FOUA 3AXTA 4TWAA 4MQFA 2H48A 1CNFA 4A6DA 4OXXA 4UUMA 1SHUX 3B3FA 4IGAA 2CNWA 2SECE 4BTEA 5C7OO 4B6JA 2EP5A 2RDMA 3C8HA 3I2KA 2P9FA 3BN3A 1RZVA 2FW8A 3JZIA 4GAEA 4KK4A 1WPRA 3ST7A 1BEZA 1A9YA 3ZD8A 2ZVQX 2Z8ZA 3UHOA 1CY1A 3NBZC 3TBFA 1O6CA 3MT0A 1E6WA 3UJ3X 1GPJA 2DFDA 1K98A 3OLQA 1O8BA 1ZR2A 1Y1RA 2DPXA 1ODSA 4YAIA 1UXIA 1I0LA 1NAHA 2NGRA 2WTMA 4G5XA 2HEGA 2GHQA 2ZRJA 2BFBA 3K5WA 4J8PA 4Q19A 3U6KA 1KIFA 1CZKA 4GWLA 3N28A 9ATCA 1NF3A 3UWKA 4E21A 3RK4A 4Q4AB 4XAQA 1IJKA 2AMLA 2ZBPA 3GY0A 1HOTA 4BFUA 3DAPA 5JSFA 4EUHA 1TM1E 4KBFA 4HNRA 2F48A 2JATA 1P2SA 2I33A 2YHSA 4JLNA 1JSRA 1E3WB 2HU8A 3GHYA 3HWRA 4KHZA 4NS4A 2UYCA 3FSJX 3K35A 2VSXA 1FUYB 4YP1A 1L3BA 3OPYB 5CM8B 2XNCA 3ACBA 3K9CA 3HNRA 1W5SA 1KZ4A 3FHLA 4R4JA 1HYHA 2GVDC 4OHUA 5L3RA 3SBOA 1I1QB 4O59O 1NC1A 5DXFA 1W35A 1MG0A 2Q6KA 4TUYB 2HMVA 4BNHA 2AZMA 1H2RS 1U7OA 3OFSA 4EKIA 5J2UF 3W34A 3L6EA 4MS4B 4A0GA 2E4WA 1W59A 1DG9A 2PUTA 2QVCA 2ZYHA 3V4OA 1A50B 4I14A 4C6SA 2PX4A 1G8PA 4AZVA 5EGNA 3PPVA 5DM70 3C16C 2DERA 4LRQA 4NENB 4ARAA 3BMQA 1V39A 4C7OB 1Q15A 1LDYA 4Y2HA 3RSFA 2G5PA 3ZGZA 3R8XA 1P5JA 1NBWB 1Y1KE 3BIJA 4C88A 4XVUA 2ZJBA 1ST2A 4BRUA 1C1XB 5F23A 3MT7A 3PCXA 5LP1A 1KAGA 3LCJA 2V0GA 2GPAA 5FKJA 2QX4A 1SXJE 1VLZA 2GJ8A 4JX8A 1QH1B 3O26A 4OJKA 3R6GA 4WLVA 5KNDD 3H05A 2CL7X 1VI6A 2HJ9A 4Y67A 1GCUA 2HZ7A 4XXHA 4M9XA 4WNAB 2VJKA 1XA4A 4S2UA 2P3LA 1ZD1A 1QUFA 4HDRB 3A2MA 1VQ1A 2LR0A 4NICA 1OWMA 1E5TA 3TH5A 4JI4B 1CUBA 3L4BC 4IFEA 4LHEA 4EYOA 1FDSA 2GAOA 1CLUA 2R6DA 2AS0A 3N6XA 4FI3C 1SKYE 3AOGA 4G9EA 1XP5A 4IMRA 1GNLA 2XKBA 1ZD9A 4I5FA 1VRVA 4PLTA 2R4QA 3U7IA 3PEWA 4DR3B 3DXZA 3M89A 3NNNA 1T2EA 2CW5A 2MSEB 1CUGA 3N7UA 1EUCB 1DDOA 1C3EA 3CPSA 2VHTA 3IPYA 2FPOA 1ZXLA 2FW7A 4LSZA 2P67A 3X3HA 5C3MA 2VZEA 2I7VA 2Y77A 2PZMA 4V38A 3AZPA 1B41A 2GEVA 4OHFA 4PC2A 3SYRA 4P0TA 4BB9A 1WCIA 2QTHA 1ZN9A 4CV1A 4AKIA 3A3KA 5JCJD 2PAFA 3G5AA 1BWQA 4WKCA 4PHHA 3AUAA 3CRZA 1X94A 3CINA 2QZ4A 4LXTA 1BVUA 2BUCA 2PRSA 3RIHA 3PZBA 3EIQA 2RHDA 3WIVA 4B0PA 1QCZA 5KNCH 4V0MA 2NW6A 4OIMA 3AHFA 4X92A 2VDUE 3GFGA 4GLBA 4GYJA 3EQ6A 3SVZA 3CX7A 4FHFA 4O1HA 4IGIA 5BSKA 1H65A 3GCGA 1B2RA 3G0GA 2XMZA 3Q0TA 1W1WA 1CUYA 4QEDA 4S1WA 3NCTA 2WKPA 4RHXA 2JZCA 2E18A 4QUBA 3EOZA 3L6CA 5E6UB 1Y9AA 4DUGA 2OOSA 2XRFA 3LUDA 2WZBA 3AU9A 3DMTA 1SKAA 3JD2A 2Q3BA 2QAJA 3HC7A 3QVMA 1MX5A 2L69A 4TLAA 2JFFA 4Y2UA 1V45E 2A9RA 4JVSB 2DUMA 1YGYA 3RREA 2NO1A 1N34B 2F3PA 1L8AA 3JPYA 4YR9A 3E2MA 3EC2A 1T3SA 5TMDA 2I4LA 3U3OA 4PSDA 2R6AA 3EXFA 5M7EA 4RVGA 4EDHA 3VJRA 3Q6IA 3CF6R 3VI4B 1GDTA 5E3JA 3TIGA 4BP3A 1UKEA 3HACA 2WB4A 5DTIA 1B0ZA 2V3WA 3AKDA 3F97A 3TJZA 2RHTA 5CHEA 1MIOB 3M82A 5G4KA 3S7ZA 4WAUA 3UA4A 4HAXA 1JJVA 1Y5LA 1R5NA 1N9ZA 2AJBA 2FP4A 1V1MB 3PXBA 1NA5A 2CCJA 3TSZA 4V1CI 5T3YA 2ZSAA 1TKRA 2ZCVA 1XX6A 4ENSA 4MJXA 1UPBA 2NT4A 3PHJA 2HDHA 3SBEA 5T57A 3MB5A 3HU5A 3WL7A 5AW1A 3FDZA 2KS6A 1CRLA 1IDN1 3M34A 5CX1A 4B6FA 2ZI3A 3LCMA 4JLUA 2HCFA 1W5EA 5GGXA 1V47A 3GT0A 4LDPA 4P93A 4C20A 4C06A 4FSXA 2B4AA 4RUKA 5HG0A 2IDZA 2IXEA 1BJTA 2JFHA 6ADHA 1T5OA 5CPBA 2UYQA 2J0SA 1BS2A 3CRQA 4G4SO 2GYUA 3SVTA 3I5MA 1M2FA 2A0UA 3K5PA 1TGYA 2ECOA 3GELA 3K1ZA 4O02B 5IJWA 1N5DA 3V1NA 1QRAA 4E5PA 4EY5A 4DKJA 1C29B 1J7KA 1Z0DA 3OMXA 1A8IA 1W93A 3JAWA 4AO8A 1HF3A 1F5NA 4HAUA 3TVTA 3AFGA 3CVVA 1I4EB 1MV8A 5CLFA 1HT0A 3OA2A 3EW9A 5FD8A 4RZXA 2AK3A 4BWFB 4FFBB 1T9KA 2IYOA 2IYNA 3EEYA 3FHTA 2QK4A 5HZGA 2QL9A 2HF2A 3KSDO 4S05A 1E2JA 4QSHA 4B3RB 1QV7A 3ONDA 1WNFA 2EL9A 4H0CA 3HY4A 4B2LA 1DINA 5FUXA 3K9WA 4MV7A 4DLZA 1PJ4A 1GCIA 2HRRA 5A4JA 4HRAA 2CDAA 5DNDA 1LBIA 1N3IA 4FMBB 4AU1A 4BLQA 4I6GA 5IJZA 4GOOD 1VL6A 2BKXA 3C6MA 4M1OA 2WA2A 1ZH2A 1RCFA 2Q8PA 3ED5A 5COBA 5GV8A 2DSNA 3LIPA 4HQFA 4FFWA 1EDBA 2HRZA 3FYTA 1I2CA 3G7NA 4CV0A 4IIHA 4AJIA 2PX3A 4PYJA 4Q4LA 2A3RA 2GYYA 3HLTA 1USGA 3MBKA 2P69A 3AEKA 5ALFA 3DTNA 1MZPA 1L0BA 4OQEA 4KQKA 3RASA 4B7UA 3BFPA 1C1DB 4OEHA 5FTJA 1RS0A 1JV2B 3KJQA 1TTHA 3GO4A 3LT2A 4XDGA 1LWNA 4UUAA 4BCCA 1NJGA 4YDHB 2JL1A 1IOWA 4BX3A 4ZICA 1QIJA 1VFNA 1JKJA 3AM5A 4CR7A 2EIHA 2RBEA 3RODA 4LF7B 3HR4A 1C9NA 3GV0A 8AT1A 4HWOA 4GMHA 4JSYA 3W8EA 5JZ9A 4HNUA 5IKMA 421PA 5DTJA 1QAMA 1NF9A 1WZEA 2BEVA 1N5JA 3SYNA 8ATCA 4K2HA 3ZCVA 3FRIA 1N7IA 3R7NA 1U90A 1N6OA 3UXMA 1DL5A 2WKSA 5JY1A 5KTOA 3L46A 4RIEA 1IYZA 2ZRHA 3E2IA 3P2IA 2YV4A 3G9XA 3SQXA 3LYHA 3QU9A 1G41A 3CUEF 4MYDA 4RJLA 2ZI4A 1YA4A 4RK5A 5KBYA 2DR3A 3U39A 1X7GA 3ETHA 4BB6A 4LDZA 4TT3D 4JT2A 1Y8ZA 1THZA 4XARA 3HVRA 3ZWWA 4GMDA 1QHHB 3M3PA 3HY6A 3NYIA 2H92A 1ZICA 3ZCSA 2CV1A 3WGHA 4QU5A 4LBVA 1EFVB 4YMHA 2MYTA 5LP6A 1EK6A 2ZJ2A 2XNKA 4FYPA 4Q4JB 1E77A 2ZBFA 4QO8A 2ZR8A 3VTAA 4G0VA 4MWSA 4PAGA 1AZSC 3PXGA 2CF5A 2YYSA 4ILEA 3MCWA 2BBSA 2E5LB 1XZJA 4IP0A 1F2TA 1B8NA 1FU8A 1YDEA 5ESDA 2I1LA 1K6XA 5HSGA 3P52A 2VJBA 4WZAA 5L95A 5F9FA 3NWEA 1JALA 2INGX 3VYVA 3LY5A 2BMAA 3I52A 4ALNA 1KVTA 2RCYA 2FPKA 4LOLA 2CXXA 4X9XA 1Z6PA 3K09A 3AF1A 3HB0A 2G5TA 5CLGA 3B1FA 3DMNA 3I01A 2XIQA 2QU7A 3CY6A 1LQTA 3TW6A 5TMEA 2YV5A 2ES4A 4YJDA 2DAPA 1OWOA 3NXKA 1GA4A 1E1RD 4XCVA 2GZRA 4MUNA 4MIEA 4CMAA 5KWVA 2Z2IA 2HSZA 3EULA 3PQDA 1JMKC 4GVXA 1JPVA 4LTDA 1W0JA 1H8HA 1RLMA 3TS1A 2VWGA 3T5GA 4YHHB 4W7HA 5A71A 2QRGA 3HCPA 5HR5A 4HNAB 3MTIA 2JKVA 3ZLJA 3CRMA 4IIJA 5K5EA 2HHAA 2FWRA 5ALWA 2DT5A 4H27A 4JUBA 1WZCA 3X43A 2V7QD 3JQAB 1C0IA 4UE2A 1OH8A 2PS0A 1VIVA 3Q7QA 5HGJA 4P34A 1J0EA 2UYOA 1A77A 2PGAA 5AXBA 3ZDDA 2XEXA 4RTQA 2ZVJA 4M54A 3G1TA 2IYRA 4K9QA 3DL0A 2EG5A 1RYBA 5E4YA 5CFLA 3V2UA 1M0SA 5I7RA 1ZONA 3M4NA 3S3TA 2ZXUA 3CW2A 4FKMA 4H08A 3U2QA 1N2CB 4EG4A 5F98A 3HN2A 4ENRA 2F8MA 4KE7A 1C1YA 1NN3A 1P6UA 2QZSA 1MXFA 3EIWA 3IT2A 1AZWA 3QVSA 1UFVA 4QDZA 521PA 2O19A 1AT1A 2Q1TA 1KKLA 3PEVA 2F67A 3Q2IA 4JK3A 3E4CA 1OZ0A 4O4IB 5IJAA 4DSAA 4WFIA 2VP3A 4AZTA 4CMEC 4EO9A 2H1IA 2Q4DA 4KO4S 4ZRNA 3I0MA 3PC8C 3H2YA 4KFSA 5D5QA 5B12A 3QEAZ 3ZD7A 1HNWB 1GU0A 4IGKA 3GIWA 1PL8A 3HI6A 2ESRA 4HXGA 4UNNA 2C95A 1U0SY 2YOHA 4AY4A 5JYCA 1NV8A 2R6CA 3RU2A 1OA0A 5E2BA 3VC7A 1P80A 1THTA 3ONVA 4ZZ0A 3C48A 5JI3E 4FHEA 2RH5A 3K4HA 4S1VA 1U7TA 3IJ5A 3OAAD 3Q9UA 4QEZA 4G09A 3QZUA 4ZODA 5DV9A 4CF6A 4LY3A 2DQSA 4ZV9A 3JQPA 1BE0A 2CZGA 1DBVO 2PR2A 5AXCA 4HDRA 1NU8A 1G0NA 4WVFA 4X3CA 1IOVA 4BFXA 1KRWA 2Z9CA 2OE2A 5F35A 1ONPA 2GAAA 1U0HC 5CLHA 5DN6D 4EX6A 1ZRNA 5GINE 1UJ2A 2NXWA 2A6PA 4P7BA 1XF1A 1AQ6A 2R48A 3VH1A 4BNYA 4DMHA 5CJ2A 1U04A 4IJWA 5B1YA 1UMDB 2GILA 3OJOA 1UP7A 4M1SA 2ZB4A 3UJBA 4PBTA 1XCPA 2GH1A 4JI3B 3H2HA 1W5FA 1TKCA 1YRBA 4IYJA 4EF5A 3EK2A 3KAKA 4BATA 5K3OA 1EFVA 1V4NA 4Z5XA 1G9XA 3P71T 1V8PA 3NC4A 1QNFA 3WGUA 5D6OA 3FPGA 4OJTA 2DY0A 2P4HX 3FRJA 1HC7A 3HBAA 3R5XA 3SMVA 1MAVA 3EWSA 3WLQA 2AD1A 4QOGA 4F6RB 5BSVA 4RLFA 4FN4A 5TJ9A 1Z4KA 4D44A 1Q50A 3CEAA 1YB2A 4JLKA 4XYMA 2B94A 3DWGA 3HWSA 3KL4A 4LDAA 3QX3A 2BFCB 2FUEA 2IDJA 1TYAE 2R62A 2A35A 3WLTA 1R6AA 5MDHA 4ME6A 3F8TA 4YRLA 3TQFA 1AM4D 3GUZA 3AY0A 2VJPA 4RV4A 1H4SA 2OCAA 4X6LA 3WXMA 4CLEA 4D9JA 3AHEA 1RU3A 2P91A 3F5SA 1CETA 2V4MA 2EBFX 2OKGA 1TGVA 3IB6A 3P9XA 3U3RA 4B71A 1O94D 1W1UA 2FRDA 5DBIA 3WFJA 3L4JA 3UMYA 3F67A 4LGYA 4IDPA 4O2LA 2PLWA 4PAWA 3DO6A 4K9RA 5BQFA 4H7DA 4A8JC 3E6AA 1E3JA 3QEBZ 3L79A 5D5PA 1F4LA 2IODA 2VHQA 3V4PB 3U3MA 3KYDA 4JI2B 1NQUA 1U5AA 1OFUX 3ADKA 5ITZA 2DR2A 1L3IA 4BO8A 2IELA 5HVNA 1WY5A 3N8GA 5AI5A 1G98A 1B8UA 2ZU0C 4ZOBA 3ZJ5A 2XMDA 4YCJA 2EX1A 3MWDA 3SU8A 4DLLA 4LRXA 5LQNA 4R9RA 1LVUA 1ZHOA 4BAUA 4NR0A 4Q47A 4AB1A 3E53A 2G8LA 2QYOA 3DEKA 3MYRA 1XHLA 1XN1A 2C1XA 1JXMA 1YIAA 4HYYA 4NWIA 2PZLA 4BLSA 1VE3A 3QVUA 4RH1A 4MP3A 1T1EA 2WIDA 4ZT5A 1A2OA 3WYFA 5KYTA 1U28A 4ZJPA 2E37A 1FU4A 2PGIA 3PGA1 4MV1A 1NVFA 1PFWA 3NEPX 3OO0A 4G4IA 4RM3A 3U4MA 1E79A 4RETA 3UWOA 3NTRA 3BSSA 4NY1A 4OHXA 4DZZA 1ZNXA 5C8YB 4UMDA 1STOA 4JHXA 1U7HA 2EATA 2NZUG 1RYHA 1UBEA 1X7DA 2G0AA 4WFKA 5YASA 3TR5A 3U9SA 2BGJA 1CIPA 3UMCA 3HLKA 3K31A 3E9MA 3UIEA 5J40A 4FHGA 5C34B 1SU6A 5AJUA 3TIFA 4CF5A 2CXOA 5JSZA 1JKXA 2X0EA 4KE6A 1ZAKA 2XUOA 4LK2A 1F0PA 1JHXA 4OOFA 1UM8A 3LCUA 3WLOA 5K8VA 2PA0A 4BY9E 2XMCA 5DYTA 2Q3LA 3AHJA 3FFAA 4OD0A 3W6OA 3ZLTA 4F4JA 1KSFX 1PN3A 4PZAA 1OKKD 1S2OA 2GAJA 4EUNA 5K99A 3L41A 4LGVA 2C0CA 5DP1A 3N58A 3RKUA 2GVZC 1CU1A 1H1TA 2PD6A 2JIPA 1XKLA 4BKQA 2Q3DA 3DMYA 3F6BX 3QP9A 3ZOZA 2O59A 1JSLA 3IEIA 5IAEA 4X45A 3WGOA 4I4TF 4PLFA 4AYWA 4TL8A 3CF0A 1H2EA 1TADA 3LYAA 4PTLA 5BN4B 2BGTA 3QIAA 4UVDA 3SS8A 1FC0A 5KTNA 5IVKA 3N2IA 3M6LA 2WSYB 4IZHA 3VHQA 4KWCA 2RHOA 2ZAIA 4HAIA 2D1TA 4RVUA 4CLOB 1IEQA 2B69A 2VIIA 1UBHS 3H17A 3PJGA 4MYSA 4WINA 4Z99A 1NPTO 5BYJA 3RKSA 2YMPA 4MZXA 4L95C 5KOJA 1U0NA 3SP1A 2VF5X 4F2WA 4GEKA 3FTQA 4LHZA 3FB4A 4MYCA 3F7NA 2DHQA 1BMFD 2HQBA 3NJRA 3LBYA 4XD2A 5JMTA 1TW2A 1H9AA 3MOSA 1EE1A 2Q7DA 4PQGA 2H51A 1X7HA 3I45A 2GF2A 4H6PA 1N8SA 1W6RA 5IX8A 3JZMA 4BAZA 4P6VF 1E4VA 1VXRA 3HCEA 1KXJA 5CAEA 2BEWB 3IUBA 1RNLA 2GFQA 4TV9A 2OBMA 2P7HA 2F7SA 2HDOA 4KK3A 4O4HA 4RYDA 4K6MA 3LLVA 4RF5A 3ET5A 1TJ5A 4O2BB 2H16A 5C1PA 1CXZA 5KHLB 1OILA 2FJUA 1MCZA 1QUEA 1CUAA 2BY4A 1UF9A 3Q88A 4I4IA 4W1RA 5IJ0B 4TWIA 3OCXA 5B4TA 1JKJB 1WSWA 2ILTA 2X3UA 3EUFA 5H1YA 2OT3B 4QZVA 1LPAB 1PG2A 1WEKA 1C9EA 3FGNA 3OC0A 3U61B 1E2GA 1YBFA 2XGSA 3HDHA 3MSCA 3OE7A 1QU3A 1W88A 1XQ9A 1GADO 4GC5A 1QF7A 3KOZA 4UUBA 1Y3HA 1RYZA 5EHQA 4LDJA 2IYPA 2EHJA 3CNHA 3H9EO 1MIHA 2P79A 4FS8A 4YH1A 3IUMA 5GZ1A 1OLOA 2CHQA 2WYVA 4MUJA 1L5HA 1YF3A 2AEMA 4KRXA 2H5JA 3KVYA 1U2DA 1QH0A 3E03A 3AEQB 3N2KB 3PLRA 4BMDA 4HATA 2WUFA 1NIPA 4TZ0A 3N3BC 3L5OA 3D7LA 1SCUA 4NI5A 4M37A 1B6TA 2JI6A 3VDRA 1EVLA 1KVSA 2ICAA 4UBLA 1KEZA 3WISA 2ZDQA 4NJEB 4TTJA 5LP6B 3E9QA 1W0KD 2CMGA 4G25A 4LEIA 1OAOC 4HZUB 4MO2A 4AMYA 4YRKA 3ASVA 5IF9A 4XPIB 3I01M 1C9YA 5B36A 4WCDA 1UBOS 5F64A 4FGSA 5ALPA 4BVLA 3EVDA 5IBRA 1DKPA 5H8WA 4YJFA 5DLDA 1NUTA 1SHKA 1ODLA 2E6UX 2JGEA 3U0BA 2VT3A 4YPOA 3R8FA 2JG3A 2PS1A 4W1QA 2AUMA 4RQTA 5FP0A 1LF0A 3T9AA 4I50F 3ZWPA 1TQHA 2BH2A 3L7CA 1PR2A 3CZCA 3VPDA 5IXSA 5DFAA 3LW8A 4TKMA 3ZXSA 3IQHX 4E14A 2EP7A 3G49A 3QQ5A 3VOTA 5DNYB 4M88A 1XQ6A 2YDXA 3MAAC 4YB8A 1OI4A 1H66A 4A1OA 4CCWA 1W5BA 4LV6A 1DXOA 4DV7B 3R0ZA 4ITVA 4ASUD 1O58A 3C5HA 4DMKA 1P44A 2VDQB 1RDFA 4GU5A 3WDLA 3ZJYA 4ALKA 2Z8YA 3VTKA 4UCWA 1FX1A 5TPWB 3P9ZA 3TXYA 4AT1A 2DMRA 3DKRA 1D7AA 4FYJA 2QRUA 1R6VA 1VE5A 3N3AC 3NVDA 4GPAA 1NULA 5FFFA 1L5KA 1P5RA 2CBZA 5AVRA 3IQWA 3V7UA 3IR6A 2OK7A 4NMWA 3GJXC 2D5CA 4RAOA 3IP3A 3Q85A 1GD1O 2JDIA 4LXUA 5K8TA 4DA7A 1TQ4A 5AW6A 3WL3A 3GFOA 2V74B 5AI6A 5ER6A 1JZSA 4XVQA 4EBFA 3H2SA 1SAYA 1Z3CA 2WJZB 3OETA 4LSMA 4OI0A 4YQEA 4DCUA 2WICA 1P8AA 3PFIA 4QPJC 1EFCA 1DUIA 4TYPA 1YTUA 5HQJA 1R0CA 4EPXA 4CMHA 2O2ZA 3BWCA 3HZOA 5KX5F 4KQFA 3WWZA 4RE6A 1QP4A 3A36A 4M2LA 3JQCA 1WA5A 4H3SA 4WI1A 4B32A 4LECA 1GTL1 2VTBB 2PQMA 4BFTA 2M32A 5JY6A 3E5NA 3I23A 3IA7A 2XB6A 3KTOA 5AHXA 3RC3A 4OQMA 1PAUA 4TLBA 2VPWA 1DT5A 4BRZA 4PC3A 1ESCA 4HRVA 1A2KC 2DUWA 1FS5A 2IGBA 1SVWA 3L8EA 4NJMA 1OHHA 3CTMA 2GNAA 3RJMA 4NESA 3THYB 1JQ5A 1Z8NA 3NBKA 4OH7A 2YWRA 2DECA 2IXAA 3N2GA 4V39A 3UUGA 1X7ZA 4DIUA 3TCNA 1E89A 2NTEA 1IN8A 5DB4A 1JDUA 4ZVQA 4V3BA 4R1SA 5GAJA 2CCGA 5FUVA 1DO8A 3HA5A 3KQSA 2O2EA 1XXHA 1JBEA 3AL3A 3I53A 4U2DA 4UM7A 3O4FA 2VTEA 3F47A 3H1FA 3LOQA 3PUWA 4JLVA 2V6MA 2VF4X 2XE8A 4CQNA 4TSFD 4CM1A 1YCDA 2BMDA 4YCAA 1U4NA 2I67A 1VDZA 2GEJA 5FQNA 1SOVA 1Y34E 4P3XA 5A9SB 1S96A 2DHRA 2BUAA 1GQSA 1PZGA 1NONA 4I9HA 1R0LA 1EAYA 3A6LA 4UE3S 2Y92A 4YIKA 1NFQA 3AFOA 3G2MA 3H4IA 5F73A 3QGMA 3ZVNA 1FDOA 1VG9B 2IPAB 4D9CA 1NW6A 4DYHA 4QKQA 2CB0A 4LV8B 4JKOA 2LWIA 3W5IA 3QPDA 3Q98A 3H99A 2QNRA 2W70A 3U56A 1YQDA 3N0TA 5DRYA 5FOXA 3PCTA 1B2LA 3AEQA 5DPMA 4ZU6X 4HBGA 1VGRA 2P8JA 3TFOA 3ZIAA 1QS0B 3KALA 5KHAA 4NL4H 1YFLA 2OZLB 1P45A 3QE2A 4R2WA 2O8BB 2IHYA 3N0VA 2YS7A 2VOJA 1KQOA 3BHJA 5GOZA 1YFKA 1JWBB 1U1FA 4BKPA 3FPCA 5DDIP 1AMNA 3UXEA 4EIWA 3CVWA 1J1UA 4R54A 2YJ5A 2PZEA 6ABPA 4RFVA 3PX2A 1OXVA 5P21A 2J32A 4ND8B 2VK1A 4NYMQ 3WI7A 4ENTA 4XPIA 1RM3A 3INRA 4CWAA 3QUCA 4OLHA 2P1RA 1QDLB 2E82A 2N1BA 3GLFE 3NS7A 1SXQA 2IZ5A 2VDWA 5D5HA 3CB2A 5ITWA 3R9XB 3EQ9A 1TK2A 1TCVA 3LZDA 4OGLA 2I8CA 4DCSA 5FQOA 1OAKA 1VJTA 3DZCA 3MUFA 3JASB 1V7QA 1RYDA 2FUKA 3EIEA 5CT5A 3OKPA 1V35A 2QN6A 3WGNA 3RVBA 1O9HA 4M6WB 1ZH8A 5ALYA 4AKSA 1EBFA 2GM9A 3FM9A 1QR6A 2ZETA 1UQUA 3HE3A 3B2QA 4KJXA 4DUYB 4BU1A 1QORA 1AUOA 3H1TA 4E22A 2PUBA 2XZLA 2SKEA 3K0CC 3SEQA 5CT8A 2Y4NA 1N4AA 4MWCA 1TCUA 1WMAA 2ANBA 2P11A 4EG0A 2VCYA 4HYEA 4HPWA 4BWVA 4NIMA 3NBAA 5BW6B 3TF5A 4WESB 4B7XA 3KYDB 5ALNA 2C2WA 3WHPA 2OO7A 4J2HA 3VKUA 2K4MA 3X1WA 1Q6ZA 1TB4A 2F8TA 3KOOA 3MUEA 1BFKA 1RCTE 2ZWMA 1CF9A 1JE1A 3A7EA 1GDHA 1OLSB 2FU5C 1VBFA 1S0UA 2XNJA 3ABQB 2VR1A 3GRUA 3IT0A 4FB4A 5LU9A 3FOWA 3BQMB 2VH1A 1E3DA 2O4UX 2F90A 1E3MA 1H4TA 3IUPA 2AFHA 4Z86A 1N0IA 3NHWA 2BM8A 4QRDA 1MU0A 1QGED 1L6IA 1PR0A 2G9NA 1IVNA 1EWVA 1VLJA 2OKCA 3GG2A 3MTEA 1X92A 1E9RA 2PSEA 5D2CA 4KU4A 1P3JA 4K05A 3RRJA 3O2NA 2B35A 4LYDA 1GTVA 2CBGA 3UT6A 1EJ6A 1NW9B 2QVBA 4LNHA 1U8YA 4GKVA 4AMZA 4EPVA 3L8DA 3M6UA 4ETWA 3W7VA 4Y1RA 3G2JA 2QUIA 3KUDA 4W9NC 4C7BA 3P45A 5REQA 1B00A 5KAPA 3CZMA 1IY9A 2J9GA 2G4CA 1JFSA 4Q9LA 5LP6F 1BDBA 1IIRA 2JJ2D 4EVQA 3R6WA 3W9BA 2FPWA 3E22B 1DOHA 1FFSA 3QEOA 4HYTA 1ECFA 2MYNA 4YJGB 4OGWA 2PT9A 5CVEA 1XPRA 5ALKA 5ECGC 2B8WA 4EUSA 2FPMA 1KIMA 5L3VA 2QRMA 3HWX1 1EBUA 4AZWA 5E9AA 4U02A 1AS3A 4LWQA 2H31A 4CM9D 1R12A 3D5TA 1G4AE 4LJKA 4QYSA 3SYKA 2UU9B 2I5PO 5SYAA 1BCSA 1U8TA 5IULC 1IL0A 3BGDA 1E0SA 3GJZA 2XUHA 2ZSJA 4FI3F 4RVFA 2NMVA 4DR4B 3C1TA 1CVIA 2HL6A 3BD8A 1HY3A 3WADA 4PCLA 2XBLA 1U4SA 3BB3A 4F7WA 3SEZA 3FZEA 1FA9A 4K6HA 4AM8A 2G72A 4AO7A 1KR5A 2QRPA 1UK8A 5I01A 5F3WB 3W2FA 3WLKX 3JTEA 1UL1X 4MIKA 1WIWA 3EXG2 1N0VC 1PHPA 2XJ9A 3WTCA 5CFZA 4YMVA 3RRNA 3X2FA 3U4DA 1CQZA 1MO3A 2P78A 1JWLA 2VZ0A 2FSVC 1QIMA 4CR8A 4D92A 3O83A 5AVZA 5AM4A 3G9UA 5TGDA 3GDFA 2VEDA 1CNMA 4GI2A 1E3EA 1QH8A 3NHMA 1LLQA 3H5IA 3KTAA 2AR9A 2KLHA 3PWZA 4G0ZA 1Q1BA 3ZHYA 1ND6A 4JWTA 1VSBA 3GLSA 1ULTA 1L8LA 1PX2A 4Q18A 2GXSA 5J63A 3RC1A 1QYWA 3L4BA 1SQ0A 3TR6A 1T5SA 1OE0A 1MB9A 1UDCA 2PVSA 2I6UA 2VBGA 1ZH4A 1U11A 5B3KA 1BDJA 2X13A 3A3PA 1F8YA 4CQMB 4JR2A 3HUTA 4MUKA 4TMZA 1Y42X 2CMHA 5A4KA 4QPPA 1NN5A 4NYMR 1MLDA 3OPYA 2PLRA 3M1IA 3NU1A 2RHMA 3FCEA 4PV7A 1FTYA 2GK3A 5ICGA 4PYRA 4QTZA 1ZM9A 2V9PA 3CRVA 1XBTA 4XSHA 1ZD3A 4FFPA 3ME5A 4JKIA 4CQLA 1Z5WA 2ZSEA 4IIBA 1ZH0A 2TMKA 5JNLA 3TG2A 5E6RB 4EG1A 3OOJA 1I3OA 3AVPA 2H1RA 3GJ8A 2C3MA 3H1PA 1QHGA 1X1BA 3I6QA 1NRIA 3O2QB 3BXFA 4K1LA 4TYQA 1KOLA 3ZWBA 5A6VA 5BNTA 5K0SA 3QMPA 2PRKA 2REBA 13PKA 1S2IA 4MIYA 2H57A 1VYVA 4R1NA 2VXOA 5AUNB 2PGXA 1L4UA 2QAGC 1UK9A 3DBOB 5ETJA 1XDSA 2CY0A 2R8YA 5FUYA 5LOVA 5JYEA 1BDIA 1Z0IA 4RZHA 2ZG6A 3I5UA 2WSBA 2EF0A 5A5GA 3KP1A 1G8SA 2ATCA 2YASA 4R2IA 3AM4A 1A4UA 4LMAA 1VLHA 4L5AA 2BE9A 2X86A 1TMYA 2ZDHA 3C98A 2OXIA 9ABPA 4QOJA 3TLKA 1Y81A 1SBIA 4F1KA 1RPNA 4L0QA 1NW3A 3E5HA 1CY7A 1OT5A 4YECA 3L9WA 3BMQB 4C7OA 3QFTA 4W9MC 4NXNB 2YX1A 1IHOA 5D87A 5HF5A 3UO8B 1XFDA 3IHWA 2R86A 4HX5A 1KQPA 4DEVA 1A7KA 1GQFA 2CE2X 3UKOA 1W52X 1AKWA 1PR4A 1MN6A 3ESXA 2QI9F 1NTOA 4ZWNA 3QUTA 1D0SA 4A6XA 3W5CA 2F1HA 121PA 1ADGA 1BZYA 1G291 3KXIA 4KXNA 2E6KA 1LW7A 1M1YB 3CPHA 3NBFA 4UHJA 6REQB 5JFOA 4N0QA 4FK8A 1PWXA 1T3GA 1P4JA 2MT9A 2R6GA 3H8VA 4DLYA 1Q7BA 2W93A 3IB3A 3KSAC 3DR5A 1OB2A 3RW9A 1QWSA 5ELMA 5IHPA 1W36D 2VXCA 2O2IA 1QGAA 4MQLA 1NR1A 4F45A 2QIPA 3DE4X 3A1FA 4H0FA 3FYDA 1GGNA 2Q6TA 3QVJA 2OWEA 2J33A 5AK0A 5SY4A 3VR6A 2VK8A 3I9V6 2IY8A 2VBIA 3MC1A 4DV6B 2X9GA 1DAPA 3O3OB 3JATB 2VQSA 1QPZA 2PZGA 2CJFA 4OFZA 5EA2A 5HDQA 1F1JA 3NAZA 3H9BA 4HO1X 4JT4A 3GFSA 1UWLA 3P26A 3PQCA 4C0WA 1NQVA 1CY0A 1HQDA 1T4GA 3B6EA 1ISMA 2BFAA 2C9YA 3FPEA 2YXBA 1KH1A 4N39A 4U9UA 1JSXA 3E15A 4PVDA 4N5DA 3PNKA 3NG1A 2NUPA 4DDTA 3LFHA 1ECLA 2GCPA 3GGSA 3WOVA 3A4NA 1QRRA 3PHHA 5CTAA 1KDVA 1I0ZA 2R65A 3FGOA 5CVTA 2J59A 3EMVA 3L6OO 3Q40A 2AN4A 3PUKA 3ZS9A 4X1IB 4QLBA 1GKYA 5ALVA 3C5CA 3RS9A 4Q7KA 4F5EA 4AVYA 3T99A 4XGQA 2HLHA 1XXHB 3L4EA 3DZJA 4BV9A 4EO7A 1G3MA 3QEKA 4QDXA 3L77A 5A06A 4O0MA 5AJYA 4G0YA 3HCNA 1H85A 3OCVA 2GZ3A 2PH3A 4Q39A 1RC0A 1W1IA 4Q3NA 5CDUA 1MO2A 2QLJA 3IKVA 4YJHB 3UT5A 4BNZA 2FYTA 5A9SA 4L6CA 1AUQA 2FP4B 5G3ZA 2Y0EA 1OA1A 3KDSE 1OSNA 3FBWA 4D8WA 3SD7A 2PLFA 4E1BA 2BZGA 3RG8A 4YQYA 1FLAA 1GYQA 5I9MA 3S2ZA 4ZJYA 5A5VA 2GLTA 1QGDA 1SC6A 1VP9A 1W75A 2YVUA 3BSFA 3EXFB 4I50A 5GONA 1L7RA 4UPDA 3TOCA 1KAOA 2GHRA 3FNRA 4FT4A 2X5XA 1XVAA 3C97A 3D7KA 3EDYA 3VDXA 1RYMA 2ZLBA 1Z0ZA 2CDRA 1NJ6A 2CF6A 4MVYA 4A92A 5KWEA 5E6RA 3I2GA 1JI0A 4JLBA 2XSZA 3SC4A 3CLHA 4KR2A 4N65A 3EVNA 1SJ9A 3B9PA 3K8YA 3LUFA 3ABIA 3LK7A 1QGOA 3U0VA 1JEOA 3DVRX 1QZZA 3PUYA 1KFKB 4RDCA 2GBFA 4HC4A 3I9OA 2IPMA 5JWOA 2BFBB 2G9UA 4AAYA 3JR3A 4DLKA 4B73A 1KQNA 4NKRA 5TB5A 3PJDA 3FN4A 3H9GA 2JLAA 2FNAA 1Z3IX 2WJ6A 4I1RA 2ZQYA 3W5VA 2AKEA 3WGLA 2I0FA 3I30X 4REQA 5M29A 1HDRA 5D3MB 5I9BA 3ZWCA 1H2FA 1MTZA 1SU7A 4W6QA 4TKUB 1Z28A 3BICA 4ZYTA 3EEBA 3TZLA 3NYWA 2IH2A 1EFKA 2BSAA 4KW7A 4O4JA 1SCIA 1ST3A 4E2FA 4EO4A 1KEPA 2QHXA 2FWMX 2AG6A 3C3DA 3M4YA 1YQ9A 4LTNA 4US1R 3V1LA 5BWCA 2VG8A 3IBSA 3STVA 5B4VA 3NTUA 4JLAA 2MWMA 4RV5A 5JOQA 2NPFA 1JUDA 2QS9A 2I76A 1U3WA 1ZWLA 1T5DX 2BTOA 2OB2A 2VYVD 3MW8A 5KYYA 2J7KA 1ND5A 4CFZA 4B3XA 3JSAA 1USWA 5CNMA 1KO5A 3CJRA 1MAUA 4AMGA 3WO1A 1E1DA 3W8NA 5ADVA 3Q3EA 3OM9A 5ENDA 4URWR 1E94E 1JHDA 3RC7A 3DLBA 4J91A 4YLYA 3Q8MA 2PO5A 2OCBA 4ETMA 1BMDA 1EGVB 3ZJUA 2YY5A 1MMFB 3VAAA 4UQLA 4F84A 3IHTA 3TLEA 1HORA 4NMXB 3UGJA 4N41A 4OAOA 1M5UA 5AICA 3D1VA 4J9VA 3LQKA 3S28A 3NFRA 4PO8A 3PVZA 3OHSX 4RGQA 1XZHA 3IILA 2EFYA 2V7EA 3H19A 1XTTA 3LOPA 3PNSA 1RBYA 4XFKA 2AX3A 1WE2A 2QVYX 3V8MA 3EY4A 3AF5A 3GCWA 3R20A 3FG9A 2PMWB 4J94A 5FPHA 3T9DA 2CKDA 2YBDA 4OBBA 4DC9A 1MH9A 4TL6A 5F5NA 3WRYA 1J20A 4ZU3A 2J6CA 3EOBI 3OFJA 1H23A 2RIRA 3OCJA 1AQJA 4HZIA 1RWMA 3DB1A 4L5JA 1CBUA 2BEJA 3S40A 1Z5NA 1M34A 3ZV3A 2ADFA 3DMDA 3ADPA 1ZGZA 3E27A 3MMXA 1PGNA 4M49A 1KDRA 1Y8RB 1CUUA 1HI9A 2MINA 3ROQA 2AOUB 1IN5A 1AGRA 2GCOA 3L7IA 5C5EA 2WA1A 3KKKA 4GICA 5REQB 3V1TC 2I6SA 2XTAA 5DM1A 4YCLA 1C0LA 3ZI4A 2JLSA 3ETLA 1AGYA 5LL6P 1NMZA 1QWOA 1EQUA 1O95A 4LKOA 5M04A 5EP4A 1KJZA 4BQRA 2G07A 3EMKA 1ODKA 3JYHA 1LPMA 3NM4A 3HXOA 2POQX 4RGYA 3C43A 1ATZA 1CUDA 2CFTA 3PGJA 1T91A 3U3ZA 1J2RA 1E8DA 4QQFA 4DG5A 5IN4A 1LLFA 2W2XA 4V0OA 3WC4A 4CFYA 3GCXA 3CGGA 3M5PA 4HDKB 1QC5A 4AS2A 3RGWS 1MW9X 3F6YA 3GDGA 1G8FA 4M1KA 1T4DA 1S2LA 2LGJA 2QPTA 1UPCA 3ZK7A 5AVQA 1M0EA 3JX9A 4J43A 2XLBA 3TSAA 2QX9A 1Z75A 3H2BA 1ZX1A 3WFZA 3ZU3A 2QQGA 2YZMA 3O1JC 1VCOA 4RA6A