2NW6A

Burkholderia cepacia lipase complexed with s-inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Combined X-ray diffraction and QM/MM study of the Burkholderia cepacia lipase-catalyzed secondary alcohol esterification
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nw6A00
2OGTA 1ZIXA 3O0DA 4FFWA 1W52X 1EINA 2OQIA 5CXUA 2WU4A 2GBCA 5AIBA 1AMNA 2YXPX 4EY8A 2Y6VA 4O08A 5K3FA 3O95A 5JIBA 3G0BA 4F60A 4FDMA 1LPOA 1R9MA 1NU8A 1H23A 1UKCA 5AM1A 4X93A 4UUQA 3O4HA 2K2QB 3I2HA 1QIEA 5K3EA 3H0CA 2WM2A 1DX4A 3K2IA 4AZ3A 3H1AA 4OCZA 1VE7A 4MQMA 1WB6A 1A8QA 4OD0A 4K5QA 3PUIA 2OAEA 5AKXA 2ROQA 3IBTA 4HAIA 1S8OA 3OURA 2P8SA 1TIBA 3CXUA 2PBLA 3M83A 5DJ5A 1K4YA 3R3WA 3M81A 2C7BA 1BCRA 1AX9A 1YASA 2IX9A 4J0KA 2PKYX 4GEGA 2OLEA 5AJHA 2GYVA 2YASA 1R9NA 1CVLA 3X3HA 1HDEA 3DKRA 1G5FA 3FLAA 4G4GA 3PICA 3T4UA 1F6WA 1WM1A 3DD5A 4UFNA 2ORYA 4BRSA 2W22A 3WA7A 4E14A 5DWDA 5H3HA 1WOMA 5FDFA 5ALGA 5DTIA 4X6XA 3MGAA 4XJVA 5CT4A 2XMDA 3FYUB 1VLQA 5T4FA 2D5LA 2X5XA 5CURA 2QS9A 4C4ZA 1QIGA 4Q05A 4BC0A 3QH4A 4BE4A 1VJ5A 2HA3A 5AO9A 2JGMA 1D07A 4G5XA 2BUCA 3WI7A 4K2AA 4D9JA 3N2ZB 1CUWA 4TGLA 3WJ2A 3OPMA 1ACJA 4KE9A 1L7QA 2VT6A 3GFFA 2V96A 4MWTA 1MAAA 2VJDA 1THTA 1G66A 4FBMA 4G4IA 1SCKA 3M82A 5CT8A 1QTIA 3H2JA 4LKOA 1UZAA 2RI6A 3CN7A 3R3XA 5ALQA 3FNBA 2RHWA 1X70A 1H2WA 4IQ4A 2WIFA 4AO6A 4OPMA 3MUNA 2PSEA 1DX6A 2GBIA 3DCNA 3DYIA 1SCIA 1MNQA 5HFAA 4Q3LA 5JADA 4M0MA 4I19A 5JZBA 2ZJ6A 3VJKA 2C0QA 1BN7A 1AC5A 4QEKA 5ALZA 4CCYB 4TPKA 5JANA 5AI9A 1CUVA 2WJ3A 1VZ3A 2O2IA 3IUNA 3KDAA 4N8SA 5A7HA 2J3QA 5CXXA 4YPVA 4Z49A 3NOXA 5AKJA 3LP5A 3K9BA 4DIUA 1EH5A 2QR5A 3BF7A 4OSEA 4HXFB 2DHCA 1EXWA 2IITA 1QZ3A 5JYCA 3WLAA 4OB7A 1AUOA 1EB8A 2PL5A 5E2IA 1EVEA 3V1MA 1QIIA 2BAGA 5FRDA 3O9VA 5SYMA 4LXIA 2GBGA 5A71A 1XZCA 3KWFA 1ODCA 2GYWA 1UKAA 2WFZA 2XQIA 3C5VA 5CW2A 4FMPA 4B84A 2WTNA 4B83A 2JBWA 4X7BA 2OPHA 2QTBA 5DLPA 3B3QA 4KJXA 4BVKA 4K6KA 1MU0A 4C4YA 3WL8A 4E15A 2RGUA 2Z3WA 3SX4A 2XMCA 1CUJA 1W75A 4KAJA 4H7HA 2G63A 1EDDA 2EDCA 3WKAA 3C87A 5JD5A 1GGVA 4ITVA 3R3UA 1XRLA 2Q0XA 3HXKA 2PX6A 4PW0A 4B6GA 3DJYA 3PI6A 5EGNA 5JASA 4DSAA 4NMWA 4AMZA 5DTJA 3F96A 4MEAA 1T4MA 3DS8A 2OCGA 4W1PA 5JALA 2WHQA 3L1JA 2VSQA 4PF1A 1R4ZA 4CCWA 2O7RA 1ZJ4A 2O7VA 5AKGA 2I3ZA 4H7FA 4Y2VA 3VVLA 3IDAA 5CH8A 5I8PA 5BV7A 4F5ZA 1E5TA 4G1FA 5EIEA 4AN0A 1C7IA 1BROA 4DSZA 5JAHA 1USWA 3R3ZA 2WTMA 3VISA 3BF8A 2UZ0A 4CG3A 3NUZA 3C70A 2QVBA 4BAUA 5ESRA 3I6ZA 1FJ2A 4B81A 1YAJA 2OGSA 2QJWA 4XWGA 4IHAA 1GQSA 1BCSA 1OILA 3WQHA 4JYMA 4ZREA 4I3FA 4XVCA 3H18A 2XUGA 4RNCA 1ZD2P 2QXTA 3KWJA 2DHEA 2BKLA 2XUPA 3PF9A 1VXRA 1XQWA 5ALYA 3G0CA 1UK6A 5AK6A 1WPRA 2I03A 4UPDA 1E89A 3SWWA 3HSSA 4DMKA 4J3JA 1VXOA 3QPAA 2ACKA 4QLAA 4WDRA 2HRQA 4HRYA 4UBIA 2V9ZA 4DM7A 1XLWA 1UOQA 1TCBA 3H2IA 1XZDA 4OB8A 3GELA 5YASA 5K3CA 1J06A 1CUCA 3D3NA 3G8YA 3A2NA 2WLSA 2J4CA 5AM3A 4MYDA 1TKRA 3RKSA 2PSDA 3AUKA 4KEAA 1UWCA 1P0QA 1CUZA 2DQZA 4U2GA 4INZA 1EB9A 5D3KA 1EK2A 2QRUA 2GZSA 5K3DA 3D2CA 5EHZA 4QWWA 4UFPA 2XUJA 2WFLA 1DINA 3C6YA 3WK6A 3I2JA 2WUDA 1VKHA 2BJHA 4AMYA 2X8BA 4E11A 1O6FA 3FCYA 5AI4A 4Q82A 1GPKA 2FJPA 4WY8A 5CT5A 3LIPA 1YB6A 2EDAA 2XQKA 1WPXA 3V1LA 4BDSA 4BAZA 2OCKA 2ZJFA 5ALLA 1CEXA 5HQ3B 3WYNA 4RPCA 3C6XA 3UUEA 1ISPA 3A2MA 1IZ8A 4EBBA 2PU5A 2ES4A 3W9UA 3N0TA 3K6KA 4Y2XA 1DWOA 1YS1X 1MJ5A 3IURA 3E0XA 3ICWA 4Y2YA 3F98A 1HLGA 4BATA 1MO2A 3I1IA 4U2BA 2HA2A 2C5GA 1CUHA 2AXEA 4ZV9A 4WFKA 1ZI6A 1MAHA 4RGYA 2PSFA 5JD6A 1QGED 1R88A 3WKDA 1J07A 5EI5A 4U2DA 2JGLA 3D59A 4YK7A 4FLFA 1M33A 3FAKA 3STTA 1QLWA 1CUBA 1PV1A 2XDWA 3AIKA 2B9VA 1G4HA 3EQ7A 3EBLA 5D3ZA 5DYYA 3DL7A 1H22A 4G9EA 4PSCA 5IKXA 4H35A 1LPAB 1XQXA 5T4EA 1MTZA 3C43A 4OU4A 5F4ZA 5AKYA 1ZOIA 3ICVA 1QFSA 4GBGA 4H7KA 2QT9A 4B0OA 3R0VA 4OUKX 4Y7DA 1GKKA 3CN9A 5AP9A 3I2GA 1XZEA 3AILA 1A8SA 3OG9A 5HZGA 4P93A 3ILSA 1YAHA 1TCCA 1QIMA 3W9BA 4U2FA 4FFVA 2XLCA 4QDOA 5HF5A 1XRQA 4KRXA 1U8EA 3DDUA 4Y2JA 4GHWA 4DNPA 2J4FA 2VT7A 2V98A 3HRHA 3IUJA 1JFRA 2AJCA 3O4JA 2O2HA 5AKKA 2RHTA 4IH9A 5FOQA 1DT3A 3ESBA 3AZPA 4Y2SA 3PFCA 5EFZA 3H1BA 4OYLA 3ANTA 4CIBA 4KAAA 4UBLA 3VXKA 2WHRA 2PUHA 3W04A 2YYSA 3LIIA 2V97A 3EQ9A 2OXEA 3B12A 2WG2A 4X94A 5ALUA 3CCBA 1JU3A 1F8UA 1XQVA 2WHPB 4KR0A 4B82A 3STWA 5EHNA 1XRNA 2DHDA 2CKMA 3AFIA 5HK9A 3TRDA 1FFEA 1GKLA 4B9EA 4KE6A 1MX5A 4UBOA 1IVYA 1EDBA 2C0PA 4XX1A 2XUDA 4BE9A 4N5IX 1XQYA 1CRLA 2OAGA 3VVMA 3F67A 3R3VA 3PUHA 2ZSIA 4MXDA 3CCCA 1XKTA 4A16A 4LYDA 1QTRA 5IVIA 2RAUA 3UUFA 2CB9A 2JGFA 4KRYA 3STYA 3DKKA 5JAPA 2B61A 2XB6A 1DT5A 3I28A 2XQFA 3H04A 3IUMA 3WWDA 4BCBA 2XUKA 1EDEA 4P9NA 5LZ5A 5K3BA 5CT6A 1ZD5A 3SC2A 4H18A 1ETHA 5AM4A 1FFCA 4DMCA 1AGYA 1CUFA 2HA5A 3AJAA 2JEZA 3BIWA 4KAFA 2XUQA 4M0FA 4UBNA 3C5WP 3FSGA 1A7UA 3QMWA 4FNMA 2ZYRA 5E4YA 3W2TA 1YS2X 5HKAA 1RWQA 1UKBA 2FUKA 3QBJA 3EF3A 2XMBA 3C6ZA 2WUGA 3O4IA 1EI9A 4OB6A 2PUJA 4GI1A 4MQLA 4PV7A 4BDTA 4OU5A 4BP9A 5ALXA 5JARA 3EIOA 2C58A 3QZUA 4BTVA 2DCMA 3PE6A 2G5PA 1KU6A 2WG0A 1QE3A 3BXPA 1XZFA 2VATA 4FOLA 3S8YA 3WJ1A 2WUEA 4Y2UA 1AQLA 2FJ0A 2XQJA 4DNQA 3TJMA 2WG1A 2WUFA 4MEBA 3I6YA 4IH1A 5AOCA 3GUUA 2OQVA 2PU7A 4ETWA 1JMKC 5SYNA 4J7AA 1W6RA 1AZWA 3GA7A 3BJMA 3M3DA 1LPPA 3JYHA 4L72A 3OC0A 4GW3A 4G8DA 3QMMA 1Q84A 2WIKA 1JI3A 2WIGA 3JWEA 1E8DA 1IZ7A 2VAVA 4QNNA 1GQRA 3WIOA 4AXBA 2HFKA 4LXGA 4X85A 2H1IA 3FOBA 3IVMA 1CUXA 4QA9A 1UXOA 6YASA 3DYVA 4WFIA 2JGJA 5ALPA 7YASA 4ZRDA 4L9AA 3WWOA 4DMHA 2QMQA 4XIIA 4LYEA 4QLOA 4CG1A 2PSHA 3WA6A 3NWOA 3WL7A 2HM7A 5EHQA 1QIKA 1JJIA 1N5MA 4H0CA 4PSDA 5LP1A 3D5EA 2OG1A 1OCEA 1XZIA 1ACLA 2HU8A 4QDXA 1SCQA 1A88A 5AI8A 4BP8A 2Z5GA 3QITA 2H7YA 1FFBA 4WFJA 4B7ZA 1Q0ZA 2XUFA 2JF0A 3F9CA 1PJAA 1ZGCA 1C7JA 5AHXA 4X6YA 2WQZA 2Z3ZA 3WKBA 4QE3A 3QM1A 2HHAA 4HXGA 3G9XA 2OCLA 1MX1A 1LBTA 2CZQA 2JGIA 4QDTA 2BCEA 4MYSA 4BYMA 3BDIA 2BGRA 3BIXA 5JAOA 2ZSHA 3GBSA 1KEZA 3WIBA 4KE8A 4B80A 1UOPA 5D7BA 5DYWA 3V48A 3AZQA 2HA6A 2BUBA 4NVRA 3FYUA 3I2IA 2Y1KA 4HZGA 1RP1A 1RYYA 3FYTA 5KREA 2ZYSA 1QIFA 4GECA 4JUIA 2CMFA 3B5EA 1DWQA 4UBJA 3UMJA 3WL5A 4C6HA 4J0DA 2IIVA 1LGYA 5IVHA 3FWHA 2XUOA 4EZIA 2QOEA 3IA2A 2I78A 1ORVA 3BE8A 3ZWQA 3WKCA 2J3DA 1UK8A 4W1SA 4NS4A 4ZXFA 1LZKA 2HA7A 2WU3A 3HABA 2B4KA 3SK0A 5JZ9A 2DSNA 1IUOA 4L3WA 4H7DA 5K3FB 1SOMA 3I2FA 1XRPA 3VJMA 1KU0A 2ZJ7A 3ZI7A 2CUTA 3WKEA 4X95A 1H2YA 3I2KA 5A7GA 4JYPA 3H2GA 1CPYA 2ECFA 3FCXA 4UHDA 4QWMA 3T52A 3W05A 1R50A 4PO3X 1QIDA 5FPQA 3WK7A 4CCYA 3PDCA 4A23A 1XZBA 3G0GA 3I1YA 1LPMA 5AKIA 4BVLA 5AKHA 4DLNA 3QPCA 5AI5A 1UOOA 2QUAA 1YA4A 2HADA 4N8EA 3E3AA 1BU8A 5AK3A 1EVQA 1L7RA 1Y7IA 5KBYA 5C8ZA 5AH0A 2OCIA 1ZD3A 5AKZA 2H7XA 1XZAA 1YR2A 2QZPA 4G8CA 5CH5A 3TEJA 1WB5A 2WIJA 2QKYA 2JIDA 4N5HX 4Y2QA 3U0VA 1W76A 1X2BA 4H7JA 4L0CA 3HLKA 1XZMA 3G0DA 1UFOA 2JGEA 1ZIYA 5ALHA 1E8MA 1TCAA 3G9ZA 4A5SA 4K6HA 1QFMA 1GPLA 4HVTA 2ZYIA 4DTCA 1DQYA 4DGQA 5A62A 4WJLA 4QZVA 1Y7HA 2PPLA 3E4DA 3ZLVA 4BTLA 3OM8A 2Y2UA 5ALEA 1JJBA 4BCCA 2D0DA 5CRIA 5I7UA 4EY4A 2G5TA 3I6MA 1ZICA 1ZI8A 3AINA 3QMVA 2W6CX 5DNUA 5AI0A 2PSJA 3FLEA 2AJ8A 2VF2A 2XMSA 1WB4A 4DMFA 3RK4A 1TQHA 5DNWA 2XE4A 3FLBA 1EA5A 5LLSA 1CR6A 2ONCA 1BEEA 3KD2A 4Q3OA 3IULA 1BS9A 5C8XA 1ODSA 5T4BA 5LZ9A 2WSLA 4Y2TA 2HRRA 1H2XA 5AIAA 5E4JA 5LIPA 1LPBB 5CH3A 1ZI9A 5FPPA 4RE5A 1QO7A 2WILA 1E3QA 1QJ4A 2R11A 1JT2A 3R3YA 4GDMA 4AN1A 4PNZA 1EX9A 1MN6A 5HF9A 4X6UA 1N5RA 1W4LA 4U2CA 4IO0A 3RLIA 2NW6A 3BJRA 1E66A 3QYJA 3YASA 2C5FA 5LZ7A 3NGMA 4J0CA 4RE6A 1ORWA 4UHCA 3TGLA 3JW8A 4W1RA 3IIIA 4H7IA 5ALTA 1ZJ5A 1P0IA 3AIMA 2AJDA 4EHBA 4ZGBA 4W9RA 5HKBA 4PSUA 4Y9SA 1HKHA 1CUDA 1B6GA 1W1IA 5A2GA 2OGZA 3RM3A 1VE6A 1R1DA 5EIAA 5AK5A 4UHFA 1P0MA 4DNOA 2VQ6A 2HIHA 1L7AA 2DQYA 1GZ7A 3HC7A 4W1QA 4JNCA 4C89A 4H77A 2XUHA 3WWCA 4P92A 5LKAA 4FKBA 1NU6A 1JU4A 3MUOA 1LLFA 2YH2A 4X3CA 1Z68A 5LYYA 1LZLA 3WL6A 5AM5A 2CEKA 1U4NA 3HYSA 1CQZA 2CBGA 4J0GA 4CI9A 4FHZA 4ZWNA 5J3JA 4W63A 3DEAA 3C45A 5ALRA 1CUYA 2GYUA 3DNMA 1DQZA 1R3DA 5CBKA 1HQDA 1N1MA 2HDWA 3FBWA 5AK4A 4ARBA 1N8SA 4X97A 2QM0A 1P0PA 4U2EA 2EEPA 1BN6A 3LCRA 4IH4A 4X92A 1UK7A 5HCUA 2BFNA 1FSSA 4S0XA 2HA4A 1CUIA 4AO8A 4F0JA 3LLCA 1LNSA 5HQ3A 5KWIA 2HL6A 3R41A 3HACA 5LKRA 1I6WA 3DOHA 5AI6A 3ZPXA 3A6ZA 5CMLA 2H7CA 2QUBA 5A6VA 3EQ8A 5C8VA 4MWSA 2VA9A 1A8UA 3WZMA 4BCDA 1BEZA 1WHTA 4Q34A 5ALWA 4EUSA 3ESCA 3ESAA 1UK9A 1ZD4A 4GWLA 1CQWA 2Y2VA 5KWJA 3V1NA 4EY7A 3ZLTA 1FFAA 1MNAA 4TVKA 1ZGBA 4LIPD 4H7EA 4NZZA 4KE7A 2XMRA 1EK1A 5JD4A 5AOBA 5C81A 1TRHA 3IB3A 5ALVA 1Y37A 4FWBA 4QDUA 4B9AA 4I4CA 3D2BA 2JEYA 1XLUA 3QVMA 1Q83A 4Y2RA 3KOOA 1G42A 4QDZA 4WDQA 4N8DA 4BBZA 5ALKA 1VA5A 4BC1A 2VJBA 5ALFA 4FBLA 5FP0A 1GXSA 5ALNA 4FLEA 5K5EA 3FYUC 3WYDA 3O9MA 4PQEA 4BZZA 1MT3A 2HU7A 1LPNA 4Y2PA 2G4LA 2H9YA 1SFRA 2VJCA 2XI4A 1CLEA 1EHYA 2C4HA 4Q3KA 4UHBA 2WFLB 3D4LA 3D0KA 3L1IA 4K6GA 1XZLA 3PF8A 1MX9A 2FX5A 1PFQA 4FNGA 5JZSA 1TK3A 3A2LA 4EY5A 3OTQA 1CUSA 1JKMA 2B20A 4BB0A 3WK4A 3G9UA 1C4XA 5AM2A 4CG2A 1XKLA 2GZRA 4G8BA 5FKJA 1THGA 3HZOA 3S2ZA 1U2EA 4ZI5A 4CIAA 1FFDA 4OYYA 4P08A 2BGNA 2BUAA 4B85A 3Q0TA 3VDXA 2RIPA 2WHPA 2XMGA 1XLVA 1DTEA 1IUPA 1O6GA 1XRMA 3ESDA 5T4HA 1CUEA 1XZKA 2DFPA 3OOSA 1WCYA 4V2IA 2Z8XA 3WK9A 5EHXA 2HFJA 1YA8A 5AKEA 4BRZA 3F97A 1LPSA 1AKNA 3C6BA 5DNVA 4HRXA 5FXMA 1IMJA 1U65A 4ZV7A 1F0PA 5CTAA 4GXNA 2HU5A 2Y6UA 3KXPA 5ALDA 4FLMA 2WJ6A 3DOIA 1YSCA 3WK5A 3BDVA 2XLBA 1VA4A 3QPDA 1HBJA 4X91A 5E4TA 2JGKA 4FTWA 5C7YA 5AM0A 1QO9A 1TAHA 1HL7A 1VZ2A 2QJRA 1J1IA 4BAGA 5FLKA 4C01A 2ACEA 1J2EA 2WIDA 5JATA 3FSGD 2Z8ZA 4UHEA 5HF8A 4X90A 1NX9A 1CFJA 2PVSA 4LHEA 4MJ3A 3WMRA 4C87A 2CJPA 2VAXA 5IH7A 5HK8A 4JH0A 3V1KA 2VJAA 4X00A 3RARA 2WJ4A 3G0IA 4WY5A 5AOAA 5AICA 2ZYHA 5HF6A 1MPXA 3HJUA 3A70A 4C4XA 1QONA 4M0EA 1K63A 1HPLA 1CUUA 4X71A 3C8DA 3HEAA 2AJLI 5LZ2A 1OXMA 5HFNA 1JMYA 5EIHA 4AO7A 2XUAA 1XZGA 4JEIA 3C8HA 4BVJA 4UHHA 3WWEA 3O4GA 5AKLA 3KSRA 3PFBA 5CT9A 3FVRA 4UBKA 2LIPA 3W06A 1E8NA 2QXUA 5K3AA 4DNFA 3HI4A 1DU4A 1YB7A 1K5PA 1LBSA 4DYHA 1GPNA 1GT6A 5IVKA 4HTAA 5BWBA 5ALOA 1XZJA 3BWXA 5IVDA 3GROA 4Q1VA 4G9GA 2WFMA 1UT6A 2AJBA 3AIOA 3AZOA 5DYTA 1XFDA 2XQGA 5ISMA 5A7FA 3P2MA 1QIHA 5ALSA 3STXA 3H2HA 5LZ8A 1H2ZA 2VTVA 4F21A 1YCDA 3E1GA 5ALIA 1DWPA 2GBFA 2XT0A 1Q0RA 1SC9A 4AX4A 2DR0A 3H19A 1JJFA 3LS2A 3ZV7A 3WWPA 5ALJA 2O2GA 3DLTA 2PM8A 4EA6A 2ZVDA 3G02A 2XMZA 5LZ4A 5FV4A 4KYVA 4LXHA 4UBMA 1CV2A 4AQDA 1XRRA 1WHSA 1K8QA 1X2EA 3ANSA 2X76A 4J0IA 4EY6A 5BWCA 3L1HA 4KACA 4BZWA 3ZLUA 4ROTA 1CIJA 1AURA 3F8SA 1BRTA 4J0HA 1T2NA 5BOVA 3FVTA 3V9AA 3R40A 2VEOA 1VOTA 1ODTC 1QOZA 3MVEA 1CUGA 3ED1A 3U1TA 4UFOA 1XZHA 2I3DA 3WZLA 4GLBA 3WK8A 5ALMA 1BE0A 3G7NA 5FUMA 4HXEB 1K6EA 4J0JA 4CFSA 3IUQA 2HA0A 3Q8WA 4AB1A 5I9IA 2R8BA 1CUAA 4E46A 1F0NA 1B41A 4C88A 2XUIA 4YASA 4WCVA 4ARAA 1XROA 4YX9A 1QIJA 2WKWA 3DL4A 4EB0A 3BL8A 3DQZA 4B0PA 2RONA 3G9TA 3H17A 5JAUA 3H2KA 3D7RA 2E3JA 3VJLA 4AZ0A 4J03A 3STUA 4G4JA 5D6OA 3VKFA 3D2AA 4HS9A 2XMQA 3STVA 1IUNA 3GZJA
chains in the Genus database with same CATH superfamily
2OGTA 1HDXA 3UJ3X 3O0DA 4OREX 3RS5A 1NHGA 2AH5A 1EX7A 2OQIA 2PGAA 1N75A 1O8BA 1W5SA 2VWQA 2C03A 1J8YF 2GBCA 2WU4A 3MRVA 3EMDA 3PDWA 4LZOA 4AK9A 4DA9A 2CHFA 2PA0A 2YN2A 2D0OB 4FFLA 1IBMB 2YXPX 5JIBA 3PL5A 1PQPA 4JBHA 5C5DA 2GILA 3A05A 4WZAA 5E95A 1RWVA 3G0BA 2P41A 3ICQB 1NUSA 4FDMA 1AF7A 2PIAA 4JEMA 4EHLA 1LPOA 4CYMA 4BKQA 2QT0A 1NU8A 4Y1RB 1I4DD 3EEBA 4W8GA 4U3JB 1UIMA 1PJBA 2QR2A 1GAEO 1H23A 1N25A 2XOEA 5D8DA 3VTZA 3O4HA 3EWIA 1OT3A 3GL9A 3I9JA 3SYNA 4CKBB 5K3EA 2GJ4A 1P9OA 4I4LA 2CJFA 4MCHA 5IG2A 4P8RA 1ONPA 2AT1A 1W5BA 1FTSA 1HEYA 3K2IA 3TE7A 3B9QA 4JLAA 4AMGA 4I2VA 2FNAA 2EL7A 2IHNA 3JQ7A 1N36B 3WVNA 1E3JA 2NP6A 3MAJA 1G3MA 1C8BA 2WI8A 5K0TA 4BKPA 4WTOA 1Y6JA 1QYCA 5KJEA 3E3NA 2IIPA 2BI8A 2D2VA 1FDOA 2J9FB 4EHJA 1P4SA 5KYUB 4DG5A 3WLOA 1YC5A 3HR4A 2I6QA 4BMOB 1JSRA 2QE7A 3TTXA 3CC8A 5EFOA 4OUDA 3WLIA 2M2IA 4GICA 1S8OA 4KQ1A 4U7DA 2P8SA 1XF9A 3D0OA 4OL9A 3BK2A 1VYHA 4JCOA 4YMGA 3GJ8A 2PBLA 1RP7A 4TZKA 4V0KA 3MOIA 2ILTA 4L8WB 5FAXA 4A9AA 2G0AA 4Z3OA 5DJ5A 1RZVA 3DE2X 4L8GA 1MJNA 2FZ4A 4YVFA 2QAGA 1S7CA 2ZR7A 2VNIA 3R3WA 2FGJA 1Z8DA 2VT2A 3OD1A 4KU4A 3MJVA 2R8EA 1BCRA 4M60A 2FW9A 1YASA 1XEAA 3VZBA 2VAMA 2C92A 2IX9A 4MGYR 4EO4A 4NZ9A 2OHIA 3K31A 4GKAA 4JOBA 4Q9DA 1EUYA 1NOKA 3ZHOA 1DHTA 1NPDA 2CSUA 1MH1A 5A9RA 2FE1A 4UUBA 5FPKA 1Y3FE 2PUWA 1V26A 4M0DA 2O3JA 3TLGB 1TM3E 4ZHSA 2IF2A 3G5LA 3UY4A 4A6EA 1IB6A 1Y8QB 1M67A 3QQ5A 3L6CA 5C2JB 4DLSA 3PV0A 4FR5A 1IAVA 1W2WB 3PICA 4A0SA 1F6WA 1V3VA 2OHJA 4F6RB 5A1TA 3WFJA 4UD6A 2OL4A 3JQFA 1U02A 4RTKA 4YV2A 4HO1X 4CF3A 2CGEA 3E1SA 3U9TA 3O3NB 4UFNA 2ODNA 3IQDB 4RTNA 2WB4A 3N2YA 1XDZA 2IUFA 4EKEA 4OM7A 2FDRA 4F5YA 3OZFA 2DUNA 5EP4A 3FPKA 2PUAA 5FDFA 5B3LA 1NMSA 4X6XA 3H6HA 1MVLA 2AZMA 2Y4NA 2R3SA 5HCNA 4DEYA 4LBZA 2ISCA 4YNBA 3EGOA 1KK3A 1KH3A 2OQ2A 2WUWE 3WB2A 3RVKA 2WW8A 3THSA 4DSOA 4LDQA 1CVIA 1PD0A 1U1EA 1ZMXA 1HSOA 3LQYA 4QT4A 4UQPA 1DP4A 4HS4A 2FR8C 1FYXA 3UG7A 2GCEA 2WF5A 4C4ZA 3QH4A 2C61A 1K5GA 1FPMA 1U2RA 2GN1A 2Q5QA 1JQ3A 4FFBA 1C7ZA 2JCVA 3BWCA 4R1MA 1C5KA 4L07A 1O8CA 4HWTA 3RD5A 5AW1A 3L8FA 3MUEA 3QOFA 5CA0F 3AT1A 5ELLA 2PS9A 3KQMA 1GKYA 4N5MA 1QYVA 4PX3A 3LT1A 2GCPA 1IN5A 1JLRA 2LTAA 2YMLA 4P5PA 1KR5A 3I92A 5FBWB 4BP3A 1RLOA 4D9JA 1X7GA 3CURA 3EVFA 1G5RA 2AR7A 2EP8A 2VZ9A 4HP8A 3LL7A 1Y4ZA 4O4LA 4KDRA 3GQBB 4L4ZA 2O2ZA 1ACJA 3E84A 1XTSA 1Z39A 5AW6A 1PK8A 4BIIA 1WU8A 3CX7A 3LE8A 5KHAA 3UV3A 3SR3A 5FAKA 1CNMA 3C5HA 3PKJA 4MWTA 5GJBA 1ZSNA 2OHOA 3LOQA 3NB0A 2I66A 3K9CA 4QSHA 2G1PA 3HPQA 4GS5A 3WY9A 1D8TA 1R4MA 4FBMA 1N2JA 4QU0A 3TQTA 4Q4JA 1SCKA 1V37A 1V8BA 3CLUC 4WA8A 2CN1A 4OLHA 2H92A 4CVNA 4R3UC 5JCXA 1FDRA 1SIBE 3DZGA 2PO7A 3M82A 3E0QA 5CT8A 1O97C 1RCFA 4AI6A 2QRVB 2L82A 4DJJA 3G1UA 4B2IA 5LBTA 2DULA 2ERXA 3D2LA 1NUAA 2HLPA 4RIEA 3WV5A 4R71A 4NZMA 1WVIA 1PT8A 3F5MA 1EFRD 2RGDA 3CN7A 4MI1A 2Z6AA 1AS3A 5ALQA 1NQTA 4JJAA 2IZZA 1EK6A 3NVKI 1O0SA 4GGOA 4PAGA 1I9CA 1H2WA 1YDWA 3KOYA 4MO2A 5FTWA 4CR7A 1T3SA 3MERA 4IQ4A 2GN9A 3QI2A 4FU0A 1UM8A 1Q19A 1YB2A 1JDNA 3FX2A 1Q0UA 1CY1A 2KBEA 1S01A 1JV2B 3W90A 1SK9A 3ZD9A 1BDJA 5IAAA 2I71A 2OBBA 2XOKD 1IN7A 2PSEA 4LMRA 1PR4A 1T6NA 3RKRA 3AY7A 3DYIA 4ZO4A 1CY2A 1SCIA 1MNQA 1YMUA 5T6BA 3NBYC 4RFVA 2P69A 2R0QC 3B1FA 3QHPA 4PC7A 1PGPA 5EP1A 3OJ0A 2YVKA 4I19A 3D43A 4BNZA 2VYFA 1C9DB 3W1WA 5KSWB 4FGLA 4E0BA 4TRRA 5HJ5A 1JDSA 2IVZA 4KXLA 2C0QA 5EQTA 4EI7A 1RYMA 2P1RA 2NMVA 2VR1A 9MHTA 5LCXA 8LDHA 1KDTA 1A8PA 2IYWA 1KAMA 3QE2A 4LYFA 2WY2D 3U17A 4POAA 1ZH2A 5FWAA 3VR2D 5C37A 821PA 1E1LA 2WJ3A 4HRAA 5IWCA 3EGXA 1B4DA 2CNOA 4BX9A 4W4TA 4MUEA 1YZQA 3KDAA 1K4MA 2X0IA 3MCVA 1HT3A 3THXB 3OECA 2J3QA 4YPVA 1FTGA 2Q3FA 3MWGA 2OCAA 4LZJA 5DF1A 3LP5A 4DIUA 4F3NA 5A06A 1II9A 1OMOA 1QAMA 3WO1A 3CBQA 3DZ8A 3UK0A 1FUYB 4GVXA 3S2EA 5B7QA 1EUCA 3BF7A 4O0LA 3PR2B 1YRQA 1X8LA 3ZCSA 2Y0CA 3WWZA 3MELA 1P2FA 1EXWA 1NL3A 1QZ3A 2ZIXA 4EKNB 1QC5A 2JASA 5F1KA 1AUOA 2WABA 3CZQA 3RRXA 1BG6A 3D6AA 3LXMA 1XDGA 2BWJA 3B48A 4WNAA 4LXIA 2GBGA 5SYMA 1MVOA 5A71A 1SPBS 2P90A 2O5EA 3VTAA 3RTCA 3IPRA 2FB9A 1Z5NA 1LD3A 2WDPA 3ASZA 1SWWA 1PHPA 2DSTA 4IOLA 5LWHA 2H0RA 1C30B 4XUCA 4YRLA 1OB5A 1E3EA 1WG8A 2PD6A 1IZ0A 4N7BA 3T5DA 3C5VA 1RMTA 4MUAA 4YBZA 4QECA 4JI3B 3K1AB 3VDRA 4CTMA 4ALKA 5L4SA 2Y9PB 2ZRIA 4FMPA 2IZ0A 4ZOAA 4IHJB 2JBWA 4MV0A 3U9SA 1FW8A 1IJBA 2DQKA 1H8HA 3E5MA 1N9KA 1XFAA 2B35A 3QIVA 4Q39A 5EWJB 3T3IA 1JWAB 1UH5A 2W71A 5J2TA 1I6LA 2YYAA 1BHO1 1E3TA 4KJXA 3VNQA 3EHDA 1GTVA 1A9ZA 1N6HA 3TOXA 5A5EA 4KNYA 3DM5A 1XCJA 3IEKA 4HDCA 3N2GA 4L5CA 2IU4A 1KAEA 1ZITA 3DBHA 4WLEA 5IH3A 1NVWQ 4Q93A 3WL8A 2GN4A 4IRMA 3O8CA 4BZPA 2V5UA 4R0NA 2RGUA 2A9FA 2VDVE 2Z3WA 4FYVA 4PZZA 1CUJA 1W75A 2YV4A 5E3JA 1KOLA 3SX4A 4YAJA 4O4JF 4TLBA 4KAJA 5DMXA 4H7HA 5CIYA 4M8LA 2G63A 1U8YA 5D1NA 1QP7A 3MSXA 3JATA 2GVZC 2EDCA 2OGWA 3Q98A 4G89A 4IIFA 2D1RA 1VMDA 4RF2A 3QJYA 2LDBA 3IB6A 4D9BA 4DQVA 4DR1B 2NVUA 3DF7A 3LGSA 2VDUE 3TLAA 1GU7A 1GPWB 3NV9A 3GZNA 4DBLE 1GGVA 4JQSA 4ALMA 1LF5A 2V1XA 3GLFE 3R3UA 1DB3A 1OTYA 1DRWA 2V03A 2Q0XA 1ZUD1 4XQGA 2EWWA 4IZ6A 3MCZA 1KBZA 1US8B 2ZOSA 3IHLA 3PD0A 1PW5A 3CB2A 2PN1A 4CEIB 5EGNA 3OKAA 1DJMA 2RGBA 5B1SA 5H80A 1KS2A 5BOSA 4FDTA 4IGKA 5AQ1A 4FGSA 2PUGA 3PGKA 1W4BA 5F5LA 3W6UA 2AX3A 3CUEF 2X8LA 4J1QA 1UZMA 1O5IA 1SBYA 1NWHA 1BNCA 4M1YA 4MEAA 5CFOA 2GM4A 4EHAA 4EVIA 4O3MA 1O95A 2YJ3A 2ZCJA 1PGQA 1EVIA 3LHIA 1R18A 2CMDA 3M4JA 1YXMA 3JAKB 5DTMA 4DCJA 4BX2A 1ZJ4A 3MEQA 1FFHA 5AKGA 3R76A 3PEEA 4P4GA 2BMDA 1Z08A 4Y2VA 5AJYA 3AEKA 3VUEA 5LP6B 1DEAA 1X1BA 1ZJJA 2BKUA 2VJOA 4M7OA 4X0EA 5TIIA 3KHTA 2OHGA 4GX0A 3ABRB 4F5ZA 1O0BA 2W2XA 1YC2A 2J8ZA 1E79A 1MD9A 2PXXA 4QG3A 3GP8A 2BP7B 1GG8A 2JKYA 2FR0A 5EIEA 4RXMA 2ATVA 1T6YA 1P45A 1EX1A 2C5BA 2PQ6A 1JLHA 2YJGA 3SS8A 3EGVA 3VU3A 4YJ2A 2IBSA 4OXQA 1E3DA 3R3ZA 1LU9A 1HYBA 4TXLA 1KQGA 1SVNA 2BZ0A 3FVVA 5FO0A 4GSLA 2QUKA 4BV2A 3BF8A 3G88A 1RPNA 4FVTA 4RABA 1ZKMA 1P72A 4MOWA 2MSKA 4U7GA 3QUQA 1J70A 4QUKA 1BXGB 4MPTA 5BUQA 3GLFA 4JJFA 3D8UA 1WP9A 2AF4C 1E3LA 2W5UA 2PZAA 3FPEA 3LP6A 2QVBA 2CLEB 1P6XA 2EIXA 4FMCB 3HN7A 3M9LA 2DVMA 3BMNA 2Q0HA 5EE3A 2Y1WA 3I6ZA 1FYFA 3R5FA 5LA6B 2YRFA 3TMKA 4WHMA 3P2JA 3RFCA 4KR7A 2DBYA 4Z4GA 1PZMA 1SVIA 4Y6QA 1MZPA 2O3SA 4ZAZA 4DJ5X 3TCNA 2FAXA 2HSEA 4XWGA 4B8YA 3TM4A 4Q3BA 3D02A 4OHMA 1X7XA 1XYVA 1NMYA 1GQSA 1EBUA 1BCSA 4FZ5A 3ZEAA 1V0JA 1W19A 1Z0KA 2I76A 4IINA 4ITUA 4JYMA 4PHCA 3ROZA 2DHRA 2OBYA 5JXIA 5TPWA 3H87A 4DV3B 3I0ZA 3RIXA 1E1MA 1V5EA 4GP7A 3OAAD 4NBTA 3QYPA 4YAOA 4MIEA 4RNCA 1EFCA 2YVQA 2QXTA 4HNAB 2XXJA 3TB6A 2DHEA 2WQ7A 3IP8A 3N58A 1FSPA 5ADVA 1XQWA 1RQPA 4IF6A 4MW2A 5HSGA 4UHJA 3KYDA 1RXEA 4YQEA 3KUXA 3QXJA 1Q20A 1I10A 1D6MA 1OXTA 2JJQA 1Y6GA 1H3EA 3RRNA 1XF1A 4B74A 2JLAA 1WPRA 3NZEA 3DH0A 4RGVA 3E27A 1T4CB 2BKEA 1O4WA 3CF2A 3X1ZA 3DFZA 4PWYA 4MARA 2GDZA 1I32A 4EEXA 2ACKA 2Q5HA 4QLAA 4WDRA 1U3DA 4I8XA 5CDTA 3OX3A 3HA3A 3FYSA 4ZOLF 1ZCBA 2FWMX 3P1JA 1E94E 5EVJA 4DEVA 4E7OA 5KYXB 1TCBA 3RYCA 3B1YA 4CETA 4OB8A 5L7TA 4P4TA 4UHKA 5K3CA 3KT0A 1PSDA 3BEDA 4LOLA 3FWPA 1U0BB 1TUIA 3DDHA 5AR1A 2BGWA 2DKFA 5AUOB 2QY6A 3RBAA 1G17A 1ZW6A 2GI4A 1OTXA 1ZNWA 1XCBA 2J4CA 3EGCA 5AM3A 3UPTA 3RRMA 2NUAA 5LBUA 1G8MA 3T94A 3GGCA 3EVAA 1E0JA 1NP3A 2QSUA 4D98A 2ZM5A 3RC1A 4JR1A 2J3HA 3QLEA 3CR8A 2PSDA 3KTFA 4WRRA 4LI0A 5JSFA 1XJQA 2IXTA 3GVHA 4KEAA 1E3WA 5CVDA 2DQZA 5F5XA 5CFRA 5IYZB 3ER9A 1UMDA 1J8QA 4S24A 4INZA 2IPAB 5FIUA 4Q7MB 3QLTA 5T8KA 1RKVA 4HB0A 3TNFA 4D9CA 3HCPA 4AUEA 1D7OA 5JSHA 2FLVA 2ZIUB 4MS3A 1TD9A 3ZXSA 1WXHA 3B8HA 4ZT4A 4CLRB 4KXWA 3GGGA 4G0YA 1U90A 3JVEA 3PL1A 3QE9Y 1VRVA 5BUZA 2XCOA 2BGUA 2B0JA 1LI4A 5IC4A 1E9FA 1YBFA 5D84A 4C3OB 5EHZA 3UT0A 4UATA 3B9BA 3IESA 4CFYA 2K4MA 2OECA 2DY1A 3P2IA 5C4MA 1KJYA 3R7NA 5DI9A 3ONNA 1BE8A 3I30X 4IXNA 3A6JA 2BMWA 3FE2A 4LE0A 3QRWA 2NYAA 1R5JA 2C4UA 1O6FA 5SZHB 4C1NA 5AI4A 1C8KA 4Q82A 2PNJA 4KPEC 4JB8A 2FJPA 2BTEA 2FJUA 3SG0A 5CT5A 2CDBA 1TJ5A 3B85A 1IHPA 4Q48A 4R8RA 4JLKA 3HHEA 2R4UA 1DQNA 1IBLB 5DNCA 3TCXB 2XQKA 3WRYC 1B74A 2XGSA 1A77A 2F1IA 3D8SA 1BS2A 3IRUA 4RGBA 2VHQA 3M6LA 3P5SA 4YMTA 2VWPA 5JH7A 2KLHA 3TD6A 5EMLA 2O07A 3A36A 4MKRA 4C21A 3PX7A 1MV5A 3WGUA 2ZJFA 1EQAA 3L0CA 5ALLA 1SHZA 3PUWA 4NPHA 1TMGE 2ZXUA 1RM4A 3OIWA 4NNJA 1J33A 3C3DA 2ZJ0A 4G56A 1IONA 4EQ6A 2SBTA 3OP4A 4WZBE 1YHZA 3L8ZA 3UUEA 4YCSA 4RL4A 5HXAA 2R1ZA 1C9EA 2E82A 2WSIA 5JWHA 5THXA 3CVJA 2GH1A 3PPIA 1BX3A 3INGA 4FCTA 4DCUA 1EUDB 1EU1A 2GT1A 1P2UA 3D6NB 3GEPA 1ZIPA 3OTGA 2C98A 1K0FA 1NBMD 1NUHA 2NXEA 2UYYA 3W9UA 2DUWA 4JSRA 3I9LA 4L27A 1UPBA 4CM5A 4BFSA 3W6PA 5CW1A 3FYCA 4BVGA 3CVWA 4P54A 1YS1X 3OJWA 3IURA 5I7OA 4DG9A 5A0FA 1EYZA 2HHJA 3FKSD 3NIWA 3WLQA 3KUKA 1N3LA 4ZU1X 4X8HA 1JIXA 1HT0A 4MIOA 1KEKA 4D3YA 3MLBA 1JSZA 2GA9A 4D3FA 4FQ7A 1DXQA 4JOSA 3CT6A 5FOVA 2H63A 2GO7A 4IIVA 4MVWA 3UYLA 4BATA 4GKBA 5CIQA 2G9NA 2WMNB 4HX9A 3ZE2B 3I1IA 4U2BA 4PRKA 1TQ2A 2C5GA 2A5GA 3OJOA 4KQIA 1DKPA 5A5GA 4ZV9A 1V25A 2J3JA 1Z6PA 5IJXA 2Q3JA 3RIHA 1ONOA 3HWWA 2QAGC 4BQPA 2ZPUA 1Z4JA 2IA5A 1ZI6A 2JL1A 1Y8AA 5LUBA 3DMDA 2HGZA 1P8AA 2R8XA 1H6DA 2ONYA 4GYKA 5GZ1A 3QPUA 1JDZA 4JCCA 4LY3A 5D01A 1KMHA 2Q0SA 2QSYA 5BN4A 1LC0A 2C2OA 1R88A 3WKDA 5FWNA 2GPJA 5F9FA 4XM1A 1YRBA 2FW1A 2NUBA 3BE6A 3I9OA 4WZBA 5FWXA 3D59A 4FLFA 3KUCA 2ORIA 4D4IA 3ZCVA 5AXBA 3IPYA 3FAKA 1QLWA 2H4FA 5B6JA 3TH5A 2J31A 3F7NA 3NHYA 4S1OA 1PV2A 4EYEA 4NU8X 4PGGA 1U8CB 1XJWA 2J3MA 4YRJA 4A1OA 1IG3A 2POQX 4OGFA 4Y7CA 2P2DA 3OM0A 1OLXB 3WBBA 4C14A 1HNZB 1O57A 2P2ZA 3JQFC 4MQFA 4GZ3A 2GMWA 3ELUA 4BLOA 1Z0SA 4HLQB 1HI9A 2H2AA 4AY5A 4YRQA 3WDLA 3F74A 2IS2A 3DHVA 4KGZA 1OD6A 2CNDA 4I4TB 5FTJA 2Y8EA 2BBTA 4YRPA 4EPRA 1D7AA 4F4IA 1EUQA 1YQEA 4FDVA 4RA6A 3DL7A 2P40A 1JILA 1OKKD 4DS3A 5DGHA 3RS2A 4EJMA 3JQPA 3E9RA 2RKWA 2QHXA 1WW3A 4RSGA 4EB6B 1MOPA 2EW8A 1HDGO 2BFDB 1XQXA 3D4PA 5G02A 4F06A 2H2FA 4RPIA 5T4EA 5NULA 5D5PA 3JRNA 4XUEA 2POCA 5DVZA 4UM9D 3ZKWA 3PLRA 5CDFE 1K3UB 1YFZA 2UV8A 4YJDA 1LJ8A 4F5EA 5AW4A 3OP1A 3MRXA 1GFSA 3ICVA 4OQXA 4CWAA 5JNVA 5C52B 1WQ4A 1Y4SA 2IEGA 2IPMA 3R4CA 4BMSA 3VO2A 4Y7DA 3AM3A 1L1EA 1PK9A 3FJOA 1NMQA 2FMFA 4IJWA 1NVMB 4KK4A 2BISA 1X1AA 3OG9A 3IT2A 5HZGA 2N75A 4K9OA 4P53A 1D6SA 3BCSA 4MLPA 4KK3A 3SJAA 3GVCA 5IU6A 4OLJA 4Z9AA 1ONNA 4AKTA 4BQNA 2F8LA 2DH5A 3A3YA 1UXGA 5DCUA 1E6LA 4YAEA 1TCCA 1QIMA 4OJMX 1UMCB 4PICA 3UJDA 3JYPA 4L08A 3PXBA 2JIMA 5EJ5A 2QV0A 2C2WA 3LQ4A 2XLCA 5HF5A 2QD2A 4NNPA 4O4LF 5EXXA 2GETA 4M54A 2A5LA 4BO5A 5IJZA 2JD1A 3COVA 1XRQA 4YB8A 3LQRA 5MN4A 5BN3B 3JWGA 4PRYA 4TLMB 2JFNA 4DNPA 1JAXA 4C6TA 4IXTA 3AO0B 2EWVA 2AMJA 2QVYX 4QOIA 2JK1A 2V98A 3OZRA 2AJCA 3O4JA 2O2HA 1R0SA 2FKNA 3BSWA 4ECAA 1MOSA 2WU0A 5AKKA 2PWYA 1QTQA 1WLYA 1L8AA 2ZRKA 2XD4A 1Y5MA 1RLTA 2ZXFA 1UZLA 1E4OA 1YZVA 5AMXA 3RFTA 4F8JA 3JZFA 5K0JA 3P0HA 5ER9A 1Z6XA 1BKDR 2JANA 1KZYC 2I2FA 3KYBA 1R0ZA 1FP1D 2CLSA 3ANTA 1BJTA 2IOYA 4OYLA 1EP2B 1Z9BA 1IHOA 1ZBQA 2MMGA 5EHIA 2EG5A 3Q7PA 4IDNA 5CDFA 4WBNA 3FVWA 4L8YA 3TLYA 1YF3A 3KBBA 4HQRA 4JJ6A 4Z0PA 3I4FA 1A98A 4OQLA 2YYSA 4BGDA 2O23A 1UBFA 1FMCA 1OH6A 4RX1A 1Z0JA 3S7TA 2W6MA 3EPLA 4IIHA 4LVNA 2W90A 2XCTB 3WQRA 4JITA 4C78A 4N0PA 1JTVA 1G5QA 1SIWA 4ZCRA 1UKVY 3CCBA 4DBZA 2VN8A 2CXUA 4NRDA 3ZGOA 1VP9A 1VMKA 2FPOA 1KVUA 2HK6A 1Z29A 4R7TA 3AUXA 1JMVA 2ZIAA 4LJLA 3EK2A 1Z47A 2REBA 2PWPA 5EHNA 5JJLA 4BNVA 1TAGA 3VPXA 5HW0A 1O08A 2ZVJA 1NVBA 1IATA 2DHDA 4XEHA 2VPXA 1IL0A 1KDRA 3C7TA 1OTHA 1TJPB 1GRQA 4L6CA 1JR3D 1WUJS 1C0KA 3FH0A 4BEBA 1Q92A 1SKYB 2D3TA 2DRIA 4OKSA 5FL7A 5HE8A 3EQ6A 1MX5A 1Q3TA 3BA1A 3PVCA 5KZMB 3PXDA 2VXBA 4UZEA 1QP4A 2CCGA 4BE9A 4KFCA 1ZRMA 4NJEB 4PBTA 5EUQB 5KNBH 1CJUC 1V2GA 5DM1A 3KQSA 3EG9B 3VVMA 3KJZA 3IE0A 1AMUA 1XAJA 4B09A 2ZSIA 4X63A 2UYOA 1TAQA 3QBTA 3CCCA 1OFUX 2PVCA 4HVCA 1HE3A 5DK6A 1IVSA 4ZN6A 2QJTA 2A9PA 4RELA 3TRIA 4FHFA 4LYDA 1J42A 5DSTA 2XADA 3HBNA 1QTRA 4V1CI 1EXVA 2CB9A 2JGFA 4KRYA 3STYA 3DKKA 2FN3A 2G8NA 1U6KA 3FWKA 1DS6A 3REQA 5GONB 4AJNA 4DUGA 5JAPA 3RNOA 1GILA 2Z8YM 4LF5B 4EGFA 1MTOA 1KBQA 3LK7A 3BQNB 4M0CA 4P2GA 1PUIA 1OE0A 1I4LD 3D31A 4FUQA 4ENSA 1P7YA 1XZPA 2X14A 3CISA 3IQFA 3LZCA 1ZRNA 5KYGA 2H1CA 5KNBA 1B42A 4M8KA 4EPYA 1D0VA 2P2GA 1Y1KE 2XUKA 4R9SA 4KHPB 3GCWA 5CVEA 4P9NA 4HWPA 4UCWA 1Z4MA 5LZ5A 5K3BA 3A7EA 4DN6A 2HO4A 3DMNA 3GJ6A 3NORA 2A94A 3CX4A 4NENB 3TZBA 1JFFA 4QUBA 2I87A 2MINB 3D0QA 1BQEA 5FUBA 4DR5B 4F92B 1X15A 3GRZA 4MVCA 1AGXA 1VI2A 3HGMA 4B4VA 4WFQA 1J0CA 5J2TF 1AGYA 1GZ3A 1STOA 1CUFA 4HFJA 1LB1B 3LY7A 2EOAA 4HAWA 4JJIA 4M89A 4TM7A 5LDGA 3O3OB 3QQPA 3K0FB 3U3JA 4AJJA 1VFNA 4MJXA 2XUQA 4UBNA 2QUJA 1KFCB 3ADPA 3RU9A 4UM9B 1RS0A 2OV1A 3FSGA 4HDNB 4OBXA 4FHGA 1U31A 4PY2A 1NUTA 3L49A 4EA9A 2C77A 4R3WA 3NJ8A 3QMWA 4M1SA 3Q5EA 5E4YA 3W2TA 1YS2X 4B71A 3VPGA 2N1BA 5D85A 4INAA 4W5JA 3S44A 1N5DA 4ZVKA 1EWTA 3OBIA 4N0EA 1ITZA 1P5HA 2EZUA 3ZDBA 2PYDA 4QXQA 4CIVA 4B4OA 4Q19A 1G2OA 3QBJA 3CLRC 2CNWD 3ORHA 4ZAFA 3SSOA 4UTNA 2DECA 3TBKA 1P9RA 4TWIA 1WBBA 4RGQA 3MTJA 2UXBB 3O4IA 1L5MA 3MS4A 4EYOA 4QELA 5GOTA 3W77A 1XTIA 1GTZA 4DCCA 2EHDA 2PUJA 2XOXA 4RK7A 4KBGA 2JC3A 1ECCA 4WA7A 4DJFC 4IO1A 1EAYA 2HF8A 5ALXA 1I36A 3N8IA 2XZTA 3E9EA 4KO1S 4QDJA 3K2QA 5A4AA 5JLJA 1RDFA 3UN1A 1O95C 3RVSA 1W9HA 3ORSA 1REQB 2P0EA 2ET6A 2YNMD 2DOKA 5EERA 5J2UA 1ZJZA 1I3NA 3I9V1 2VATA 3K70C 2C9OA 3FKQA 2C4WA 3E8MA 2WJIA 4PGMA 4WLUA 4Z1MA 4NYMR 3WJ1A 1M6NA 2WUEA 1BSVA 4RZIA 1NJ8A 2NLOA 1W30A 3H7IA 3CR7A 1AQLA 1X14A 1CHDA 3ETDA 1TYDE 3OMLA 3E3LA 4LMBA 2XWBF 3E05A 4ESOA 4DNQA 3JQAA 3NAMA 3SF8B 3KZCA 5C9ZA 2O5CA 1CJMA 1HY3A 3QWBA 2G8LA 4JJGA 3PWKA 5EKUA 1M2JA 4C6SA 3PTLA 1XAHA 2O4CA 3AGPA 4DBLC 1QQ5A 3CV3A 1R8YA 1EWRA 3BFPA 4J7AA 1YBVA 4O59O 1RLMA 4O4HA 4PR0A 4YJ2F 2NU9A 4IP0A 3SHWA 4AAYA 1JE1A 3D3WA 5JECA 5EN4A 1PFUA 3QI7A 3M3DA 4QGAA 4XSVA 1N4AA 3ZIDA 4CMIA 1Y1QA 3QJGA 3RUFA 3L06A 3TSAA 3OM9A 2NT3A 1HQKA 3OC0A 1Y9ZA 1L7OA 3GR6A 4GW3A 1CKEA 2WIKA 4QOHA 2JHPA 2ZUWA 3OY2A 2MHCA 1UFVA 2QM8A 4P2BA 4XH9B 4JIMA 1N2ZA 3OLCX 3X2EA 4XLLA 3TM5A 1PR0A 1E8DA 3JWEA 1G8YA 2Q1SA 4YUZA 2ZT6A 4LHXA 5J43A 1L5FA 1WDMA 3BREA 3SHVA 2CVOA 3B2NA 1Q22A 5CA1B 1Z8NA 3FPBA 5DEOA 2VAVA 1W85B 2QRMA 4DA0A 4JT8A 1J9EA 1GNLA 1FP7A 4OJQA 4NCIA 1NA5A 2SICE 2HXGA 4R8LA 1P80A 1SUBA 1DUIA 2H4HA 2HFKA 3SDSA 3ZWCA 3BGOS 3T6KA 1WXIA 2P8JA 3PITA 2H1IA 1DAHA 4KN5A 4PLYA 2AVNA 2V9PA 3FNFA 4B3DA 2FMUA 1XUOA 2RAVA 3LI2A 2RHMA 3FUUA 4L9WA 2C8LA 4WFIA 2EP5A 2XEDA 3ZGYA 3PJDA 4MYCA 1NBOA 3DZJA 2PGIA 4L9AA 4DMHA 2XNCA 2YTZA 3PJGA 1QG2A 3NIBA 1DPFA 3BSFA 2OC4A 4X1OA 4LYEA 3UCFA 2ZE6A 4IEFB 3W8FA 4EGCB 1IU9A 4AS2A 1SA0B 1LWOA 2WWHA 1RQLA 2YZKA 2Q46A 3L1KA 3V8RA 4EZBA 3U7RA 5FOUA 1RWXA 3C6MA 3WA6A 2D2XA 1U5BA 1ULSA 3LFUA 2O19A 1QQ7A 3CNHA 4H0CA 4FYWA 3ZYCA 3ZJVA 1UF9A 1E1RD 3QWFA 4G0QA 1R5NA 4RAQA 3KKZA 2GPAA 3WB9A 1JVSA 1RNLA 1YQ9A 5KQGA 3KT3A 4QDXA 1NN3A 2LP4Y 4CHTA 3AR9A 3QITA 5T8KC 3CXRA 3QVVA 1FFBA 3MWLA 4TWZA 2F43A 3N87A 2HDNB 4M9ZA 5C1PA 3OA0A 5DM70 1Q0ZA 2XUFA 3E6AA 4M6WA 4PLZA 5F7ZA 4YGYA 5TMEA 4BLQA 5JFTA 4YJKA 2NTJA 3TFOA 3O90A 4M7PA 1QRRA 1Z17A 4X6YA 3DHYA 4IQGA 3PWZA 3B1WA 4PZLA 3WKBA 3IMKA 3UBMA 1FS6A 2NVOA 2ENWA 2Y0DA 3O8OB 2A0KA 3LSTA 4JUDX 4EG7A 4LXUA 2AK2A 4BMPB 4RL6A 4ZARA 5BQOA 3UAZA 2OBLA 1B14A 1RHQA 2B2XA 2JKZA 5K05A 1X80A 1R0CA 2CZQA 3GRAA 4RSMA 4MR8A 2JCXA 4MQBA 5KAMA 4LE2A 2WAAA 2JCSA 3BN3A 4QYSA 3U2QA 4MYSA 5HA5A 2GK3A 3RGWS 4TSKA 1PR9A 2FSFA 2N46A 3G7UA 1QGUA 2WNSA 4BYMA 4H6WA 2OESA 5EKSA 3K96A 3GBSA 3WRYA 1KEZA 3ID6C 3QKSA 4PTYA 3B7WA 1XV5A 3TAXA 3FDFA 1KERA 3QU7A 1Y7PA 5D7BA 1ESNA 2YJ4A 3I9KA 2FEXA 2VP0A 4C0SA 3TIFA 5B58T 4MTCA 5LM3A 4QHYA 3NS7A 3C24A 4W9NA 4MICA 3FYUA 3OE7D 1OZHA 3OF5A 2D1YA 5BVHB 2OBNA 1U7WA 2I0FA 3O2SB 3R5HA 5JH7F 1U0TA 3UGQA 1QHFA 1RP1A 2JIQA 5K0BA 2LCIA 3KVOA 3FOEC 1G19A 4IIJB 5KREA 1IH8A 1ZIDA 3I34X 3VV2A 1QIFA 3A9UA 4LS3A 3ZCTA 4RLFA 4L2IB 1H2EA 2QN9A 3GCDA 3OMWA 4M21A 4TSFA 2A2ZA 5BSVA 4BKMA 2YJZA 1JALA 4B35A 4MWBA 1D6NA 4P4UA 3GLIB 1LGYA 3HYCA 3M6MD 1G38A 4BL5A 4EZIA 5IVHA 4EA8A 2ZI4A 3IA2A 1YZFA 5K0SA 5LD2C 3P45A 4ZZ3A 1XPJA 4C4AA 3AEUB 5CHYA 1ORVA 1NW7A 2WZCA 3ZV6A 4NBLA 3RRBA 4KIWA 3P32A 3LLUA 3BXZA 3HG7A 3LQ2A 1CF9A 2ZBUA 4W1SA 3HL4A 3VOSA 4PN7A 1QDLB 5M34A 5CPBA 4NOLA 1I80A 4GWGA 3UYKA 4D9NA 2H29A 4F4DA 3VKHA 2IY8A 3ND5A 2HA7A 2O48X 3L7CA 4HQ0A 4IDPA 2EJBA 4QU9A 1YQTA 1PS9A 1YE8A 3SK0A 2Y71A 5CB8A 1PZEA 5JZ9A 1T2AA 3RIEA 2OV4A 3BWYA 1WQ3A 4HFRA 1A5SB 1MO6A 3W78A 1CHNA 4RIHA 4EY3A 1BE1A 3HFGA 3TSYA 5KMGB 4JLDA 3TLEA 4FFDA 2XNDD 4IGFA 3WYEA 1A9XB 1TEZA 5DM2A 4N12A 1BMTA 1SOMA 2AYZA 3OEWA 1ESEA 1EM8B 2KQUA 2AN3A 4ZVSA 2XBLA 1XJCA 4LZPA 1FK8A 1RMQA 3CWCA 3FUWA 2Q2VA 4FT4A 5EPOA 2CUTA 2HR1A 1LTKA 4MRNA 4RDIA 1DIGA 4X95A 2AI1A 2Q3LA 4DAEA 5J4VA 2R84A 3C1AA 4LUCA 1QFZA 4LHZA 2JVIA 1NXOA 2QPOA 2IYQA 1FC0A 1JWLA 2GBPA 2M6KA 3C7AA 4ND1A 1IEWA 2EFYA 4RHEA 2VJYA 1Z0DA 2JZOA 1M5TA 4IFBA 4KVZA 5A7GA 1SCJA 1N6NA 1QS0B 1UBCA 2ASEA 4IMIB 5FI1B 1ZK2A 4TRNA 3T15A 3UKDA 2A88A 3KWMA 2RG7A 3HU5A 2FEKA 4NOJA 4PHHA 3FCXA 4FW9A 5JS7A 4GBED 3RFFA 3IOCA 4V3CA 2IXAA 5BV0A 3OFJA 2OCXA 2K6GA 4FP9A 1R50A 4I1UA 5FPQA 5KVQA 1GLVA 2Q4BA 3K32A 4MS4B 4C4RA 2J0SA 1F6DA 3L6UA 2K87A 3PDCA 2RSLA 1CR2A 5CVCA 5C31A 2IYUA 1DTSA 1OQAA 4LC1A 2FW0A 2FX2A 1BWPA 1ORIA 5CLFA 2QX4A 3F6RA 1UOOA 2LPMA 4HEQA 1KBOA 2HTEA 4Z99A 4BP1A 1YA4A 4QQKA 5EQFA 3S2SA 1ZCZA 2D1SA 4BJ6A 1ISRA 2F1OA 1G5PA 3OHPA 3RU2A 3UAOA 3VNRA 2O8DA 3IEMA 2J7PD 3TGPA 5DISB 4D26A 1X74A 3SE7A 4OX9Y 2ZBFA 5FI5A 1IRXA 2VRWA 5GY7A 2OZPA 5KBYA 1V8ZA 5AH0A 3LBHA 1DDGA 1UC5B 1ZD3A 5AKZA 3MCAA 4XQEA 5IM4F 1Y1SA 4Q4CA 1E2MA 2R6GA 2ZE5A 4IQ8A 5GZ6A 3QKRB 1GCOA 2BPOA 5H70A 1YFJA 3OTHA 1XZAA 1YR2A 3DLPX 5CH5A 4J90A 3SGLA 1TQ8A 2VHEA 2WIJA 3CTPA 4FW8A 1OJLA 4MUBA 4PYMA 4OGLA 5EUMA 4LF8B 3H11A 1WMDA 3CPSA 4YXWD 3SNKA 1GGNA 2YS7A 3U0VA 1TIPA 5BPFA 4DMMA 4H7JA 1IY2A 1FNBA 1L5QA 3HLKA 3LK6A 3CPJB 5E8JA 4OA5A 2GFIA 4A0RA 3I04A 4JLSA 1R3UA 3WG9A 4QQ8A 4ND5A 4DJAA 1TCAA 3K0AB 4YJGB 4A5SA 3IP6A 3T41A 5CDUA 2XKJE 3UMBA 4W5NA 3DZDA 6PFKA 2BDUA 1D09A 5EJ7A 5JROA 3OZTA 2IEDA 4K9MA 3DKPA 3X0DA 5G53C 3FNRA 4DTCA 4FZVA 3CW9A 4CXMA 3L2OB 1MIOB 1M1XB 1ZXXA 1I01A 4RO0A 2OM2A 4O63O 2R6R1 1TDJA 5H3CA 2Q5FA 4L8VA 1IQUA 3X1XA 3EQZA 3SJUA 1JJBA 1N6OA 2H5EA 4TMTA 4URXR 2Y77A 2P2SA 5FOXA 4I9HA 3FOCA 1ARZA 4DREA 1KEWA 2C8JA 2GPSA 2R6JA 2CL5A 2JPDA 3OWOA 1LLQA 3DF9A 4LFAB 4EL0A 2I54A 1J00A 1G5HA 2Q3CA 4XCVA 5TGDA 1ULTA 2W4MA 2RBGA 2FGKA 5B1DA 2E0IA 4JQOA 3V8VA 1ZICA 3ASVA 3ET5A 1SKMA 2G09A 4CF6A 1M3SA 1DAMA 3TIIA 1QORA 2QL7A 2XR1A 1FLAA 3SC4A 1DG9A 2BKXA 3FLEA 4DV5B 3H1FA 1OC4A 4QBGB 2EQBA 1T26A 1K4KA 1KI6B 3O9ZA 1FDUA 3QE0A 3OIGA 2QG4A 2VF2A 2XMSA 4CT5A 5FBHA 4DMFA 3NU1A 4OFBA 2ZXEA 5F1OA 2EYQA 1FUIA 4BO9A 1NVEA 1EA5A 4WL0A 2Y05A 1CZOA 1RYZA 4FGZA 4L50A 5IJ9B 1IY8A 1W87A 2PRKA 3CG4A 2W11A 4ZI7A 2G3YA 3KD2A 3OZSA 4FGWA 3GFTA 5BR1A 4FPXA 3WRXA 3AVTA 1Q6YA 1ODSA 1L4UA 1SEVA 1Q5PA 3CEAA 3T5TA 5MGNA 4Y2TA 1TNDA 4TQUS 3OQMA 4BLSA 2CKDA 3RK1A 1WO8A 2L17A 1JECA 3CU5A 5IJ0A 5DB4A 5B6IA 1MVNA 2B9EA 4UAVA 4YJFA 3VKGA 2HRRA 1T0JB 3DXZA 2R751 2QLJA 2H07A 2BN4A 5EUBA 2DBZA 3X1YA 5HIJA 4C0WA 1WY7A 3CH6A 5L7YA 2G07A 2K5UA 3WQHA 1BA2A 4OXYA 2Z1MA 3TPFA 2J41A 3NYWA 2VRNA 4LVCA 5IC5A 1LPBB 1UBKS 3EXIB 4JDUA 3QEJA 1PKXA 2WILA 5CYFA 4AKHA 5FTMA 1VGVA 5CHEA 1PFYA 3LKDA 3VNSA 1TK2A 3EXFB 2Q6TA 3DB1A 1N5KA 3R75A 2CC2A 3WGOA 5BWNA 1OX6A 2GDJA 4ZQBA 5BURA 5C4IA 4TYWA 3VX4A 1JT2A 4UOQA 1MB9A 5I9BA 4B6JA 4DC1A 2VPIA 3HGQA 1NF3A 4L5AA 1VPTA 5TQ2B 4PU0A 3VGJA 4RACA 4CM4A 5HRUA 4Y6RA 3VJRA 4L85A 2W6OA 2AG5A 2FK7A 3NXSA 2GO1A 1VLJA 1ZMTA 4Y0AA 3IERA 4BKUA 5TLSA 4IBOA 1TZBA 2M6LA 4DB4A 1DDOA 1O9GA 4IO0A 4EKDA 3EVZA 4W6ZA 2EKQA 2NW6A 2Q2WA 3OOEA 4RTLA 4YP0A 4PAOA 1E66A 3SIPA 1UBOS 4HADA 1RMYA 1G3UA 1Z33A 2ARKA 3FR7A 3KYCA 4IQFA 5LZ7A 2RHGB 1WW8A 1P3Y1 3NGMA 3PXUA 4K3VA 5FCDA 5AVKA 4KMMA 3DOEA 3FJYA 3A0UA 4UHCA 1E4EB 2G25A 2Q6VA 3EC2A 3TQSA 4W1RA 3GRCA 3WS7A 4BB6A 4K9LA 3PHJA 1T0BA 3NGXA 3EPRA 1LF0A 3VPDA 2ZJAA 1P0IA 3IELA 3AIMA 4EHBA 4ZGBA 1RQ2A 4ZA2A 1XMOB 1FQKA 2N9UA 4TV8A 2DM6A 5EJGA 2XNJA 4LYYA 1HKHA 4LJ7A 4PAMA 1XSEA 1U0HC 4B17A 2O8NA 3C7KA 1W1IA 2VF7A 3KXKA 1CIPA 1Z6QA 3DVLA 4X66B 2C54A 3UB4A 2XWJI 3H6KA 4GMFA 4X1YA 3RUPA 4PWZA 1AV7A 4LE1A 2A0UA 2FOLA 1E1QD 1AQIA 3AIIA 3GLSA 3BE4A 3NRBA 3O1IC 4GSYA 2QJFA 5CVUA 2EZ9A 2HLNA 1TL7C 5AK5A 1Y6ZA 3PNOA 2D06A 1THZA 4HSGA 1JEQA 5DW0A 3SKXA 2NT4A 4GT1A 4UOEA 3ERCA 2XWPA 2JGDA 2N42A 3JPYA 3U4QB 4CM8A 3FOZA 2H1FA 1P17A 2VQ6A 2HIHA 5KC9A 3IT3A 4RSRA 2I55A 3X2SA 2UVPA 4R9VA 3SX2A 1QCCA 3UJPA 2X22A 2OSBA 4NV1A 4BJ3A 4ENPA 1SZPA 3PIRA 5KYYB 2EEZA 1RZUA 3PA6A 1RIIA 2GLUA 4UDXX 2BBSA 3I0MA 1L4MA 3HC7A 3RYTC 4W1QA 5DBHX 3PQFA 2GKGA 3QFFA 4LJ8A 4OSPA 4D4LA 3SBOA 5KQSA 1JAYA 1M6VA 2C31A 2ZYWX 3GA5A 1W93A 4CGZA 1NY5A 2OE2A 4ANFA 1I4TD 3IJRA 4GEKA 1MENA 5EXTA 2W37A 1X1DA 1PJQA 2D5CA 2R44A 3OT4A 3ZKAA 1NU6A 4GMDA 4GM1A 5J2UF 1Q95A 1NLUA 1I30A 5F33A 5B3KA 1IBKB 2F64A 3ESXA 5KUTA 3LQQA 2F7SA 3MUOA 3PQEA 1A9YA 4Q4LA 2CNBA 4DVGA 3B1XA 1ORHA 3C48A 1ISJA 1CP3A 1FNNA 2OCPA 3ZZUA 2A9QA 4HF7A 4BGEA 3NT4A 4G5RA 2GNOA 4JK3A 3E61A 2QYSA 3P9PA 4RKWA 3NNDA 2BSQA 1U5AA 4I4TF 1TUGA 2HD4A 3QJ5A 1CQZA 3KSZO 3ZDYB 1V4VA 4KN9S 2CBGA 4JLOA 4J0GA 2FXVA 2EQ5A 3Q1LA 4QUEA 3NM4A 1UWKA 3OT5A 1ECBA 2REXB 1EIZA 3FPJA 1YVDA 3HKEA 4KIJA 1RU3A 3GXBA 1QO0D 4G5OA 3HH8A 4JKOA 4PANA 1VHDA 4NONA 3DNMA 1Z22A 3EBPA 4HGRA 3U7JA 4QXRA 1R3DA 2BFCB 1HQDA 2WHEA 1Z56C 3A4NA 2VBCA 2NPIA 4J94A 4O4HF 2Q1XA 1KY2A 4AJ4A 4JMPA 3G2PA 1YQXA 4L9RA 1VRCA 1YONA 3QWAA 1MF7A 4HH3C 3RYFA 2BDEA 4WIAA 1RBZA 5BYAA 3E3OA 1N8SA 3KQNA 1ZZEA 1J22A 2ZETA 3EGEA 2JAQA 3FFBA 5PNTA 1U6JA 2QM0A 3T34A 4D8UA 4EARA 4EHDA 4AY6A 1EP1B 2AFRA 3PVSA 3LCRA 3DB2A 3DE1X 1N1GA 1OHHD 2YVLA 2LCFA 4WADA 4IH4A 3TTWA 4X92A 3IVGA 1RRGA 5HKKA 1GTRA 1UK7A 4JLBA 5HCUA 2JIBA 4TTAA 3ZXIA 3H1EA 5KIAA 3DVAA 3U31A 5LXTB 4JI4B 1PJ8A 3DBRA 2J5XA 3ROKA 4NFLA 5SZJA 1M7BA 3MT0A 4AO8A 1LNSA 2O5VA 3KELA 1EE2A 1GG5A 1Z15A 2DPXA 2DWQA 2J6CA 3JWPA 4PGFA 5JXWA 4MQEA 1QGZA 4MDEA 3N0VA 2LRHA 3VZSA 2C3UA 3GDWA 1N1DA 1NW5A 1FU8A 2V3VA 3ZE8A 5I6DA 4RORA 1N34B 2HL6A 3MTBA 5I3ZA 1BX0A 2BYTA 1XL0A 1Z35A 2ZVPX 2A30A 4R83A 2ZRBA 1FVHA 3NOOA 3R41A 2FG5A 4PFJA 2XCUA 3WFIA 3O7WA 4GGPA 1AZLA 1DRVA 2GA8A 3VC3A 4UJ3A 1ODIA 3BT7A 4LWQA 4NFSA 4HGPA 3UOGA 3NXKA 1U3GA 2V6IA 1DRKA 1DADA 4KOAA 4D0RA 4L28A 1UBRS 5AI6A 3WICA 3TTSA 2NO1A 1VHLA 4I36A 5A6VA 1OR8A 1WDTA 1RPTA 1UXHA 3R7FA 2GCNA 2V7QA 2R96A 4R5HA 5CBPB 1HE5A 3EW7A 1OX4A 2M6SA 3QVOA 5KSOA 2Q1TA 2DETA 1BEZA 4QULA 1G7TA 1BYIA 1OAOA 1PX2A 5ALWA 2ZJOA 2OWEA 4R40A 1GR0A 5FPSA 2PQ0A 4BFVA 3FFWA 2KX7A 5GWXA 3NVAA 2BE7A 1MQAA 1Z4IA 4FILA 4PCUA 1ACMA 1GNQA 2IWHA 3ZLTA 4YLYA 4NICA 3U7IA 3HNRA 1LVHA 2VDRB 2JI7A 4AJ2A 1ZGBA 2CDAA 2QX7A 5H9VA 1GL3A 2XMRA 2JIRA 5KOJA 4GMHA 4XVRA 2OLJA 3Q5GA 5I7SA 2DLDA 1XNGA 5AOBA 4NZNA 3PGVA 1T5DX 4KLCA 2P68A 3UAXA 2IEYA 1XLTA 2X4GA 1W5AA 4Z4EA 3LMKA 1AS2A 1V5WA 2JAXA 4G4SP 1Y37A 2HQRA 1YIAA 4FWBA 4PCVA 1YRYE 4B9AA 3TNYA 2AZ4A 5J23A 3A6EA 4I5GA 2JEYA 1KE2A 1XLUA 3V1YA 1NXWA 3EFOA 4UTXA 1J2TA 2GCGA 3HV2A 5JQGB 1IEVA 3H2ZA 2VLBA 2GEVA 3E8XA 4QDZA 1WDKA 1NI4B 1P9NA 1OI7A 1C7FA 3RC3A 2QAIA 4BQIA 4CTNA 3ESYA 5BWOA 2VHJA 5IDXA 2WSSA 2VDQB 4BPBA 2H8KA 3FNHA 4BC1A 4YECA 3RJZA 3NT2A 3BMQB 3BZBA 1EWKA 5JNRA 1XVIA 1VPLA 2AMFA 1QHGA 4YJHB 1GXSA 1VLLA 2GHRA 4LVOA 1CW2B 5ALNA 1GQFA 5K5EA 1P0CA 3MD0A 2JDIA 3NC0C 1VGQA 4W9NC 2W48A 2YVUA 3HEBA 3FYUC 3SQOA 2FPGB 4CEHB 3GMSA 5GONF 4MB0A 3RVJA 3HBMA 1V43A 3B5IA 1V8DA 5FT9A 3URKA 1POXA 2PCLA 2YMQA 2VSYA 3F46A 3VPCA 4NCJA 5JVDB 2NWQA 2HU7A 1KJ9A 3BMCA 3Q72A 5ERGB 1XHEA 2B94A 3EA5A 3U3MA 3VI4B 3VKVA 3BYZA 3IMGA 1QF7A 2NTEA 3U7EB 3NQ41 2B4AA 5L3VA 1SFRA 1QU3A 3ZNPA 3ZZ1A 4PHFA 3UHAA 3QA3E 3PUZA 4S1PA 2Z3VA 2ADMA 3I73A 4JBGA 1H9CA 5EVCA 3TAUA 5E7IA 3A25A 1NYQA 1V71A 1JN0A 4KPYA 1YS7A 3PHCA 1G4AE 2WFLB 3KB1A 4DJDC 4QTXA 1QH8A 3OESA 1YR3A 4JQZA 4XUDA 1V5GA 3D0KA 2CD7A 2PJUA 2P91A 5ILQA 1FW6A 1Q21A 4IS3A 5A5VA 1YOBA 4Y30A 4QTTB 4OFZA 1CD5A 3TB4A 1LX7A 1M54A 1Y0BA 3VAYA 3RBVA 4K6GA 1QM5A 3PF8A 5IT5A 3IEUA 4IHQA 1TLTA 3MT8A 4RCVA 1OA0A 1QHYA 3Q87B 1UPCA 1T9GS 2BFBA 1X1CA 4FNGA 2VEDA 2DJIA 1FZTA 1Z7EA 3A2LA 2H17A 1L7NA 4K2HA 1Q57A 5EWMB 4BLWA 3LV8A 4UEKA 1QRAA 4ZMRA 3OTQA 4QFBA 4RMNA 3ZWWA 4NMLA 1QB8A 3I8XA 1V9CA 3E8SA 1JS1X 3O94A 3RUAA 4POOA 3G9UA 2EERA 4NK5A 1KI1A 2PGOA 4CG2A 1Y5RA 1PV4A 2F8SA 5AHRA 2F6RA 4G8BA 5K0NA 4R9RA 1X9GA 2EBWA 1RHKA 4IV5A 4AX8A 2TYSB 5KNDD 2HIAA 3AG5A 3HZOA 2V6MA 1K86A 4TXNA 2VHZA 2R6CA 1YDFA 1ZL0A 4Q6WA 3A1UA 2P7HA 5FQNA 4KUGA 1K2WA 4EJSB 4IDFA 3CF6R 4P08A 5LQAA 3EG5A 3NONA 1YNOA 3IHTA 1SC4A 3Q0TA 3WLRA 1B23P 3VDXA 1GGMA 4X8MA 1Z2PX 2WHPA 1ZO8A 4RJJA 4ZEXA 1DTEA 1IUPA 1O6GA 1NVVQ 2PLFA 3JD2A 4UEQA 3SI7A 1A2KC 2CV2A 1L9XA 5J1TB 1QK3A 3O8DA 2C7OA 4RJIA 5HIKA 1VJ0A 2C2YA 2VZEA 1YQWA 2FWAA 4NIMA 4CM1A 5C7OO 3FTNA 3PNSA 1MHTA 1M0WA 2KWIA 3Q3GE 3WK9A 1BJRE 2IPOA 4ERNA 4FX5A 3F8TA 2HFJA 3EGDA 3IIMA 3Q7RA 1YA8A 2O3RA 3HP1A 1YK0A 5AKEA 3EMVA 4B5LA 4BRZA 3ZU2A 1H9BA 1CRZA 4EBFA 1AKNA 2PRJA 5F4BA 1JSXA 3ASUA 1EDOA 1K3FA 4EYQA 2CLHB 4IJKA 5LOVA 3IV9A 3ZK9A 1SB8A 1E9SA 1C0PA 1D8AA 4GKVA 5AW2A 5TPZA 3CGGA 4DDKA 4BLVA 1ZNYA 3P4XA 1XAGA 1PVVA 1IYZA 5GOZA 3MCWA 4DCTA 3R8CA 1XX6A 2YX1A 3U7QB 5MN5A 2Y6UA 3KSMA 1XYGA 2A1UB 3IDSA 4S1TA 4NEGA 2WJ6A 3D3JA 3ULKA 1YQQA 1A8IA 1YSCA 3KE8A 1E3MA 2WAOA 3TW4A 3WK5A 1B16A 3C98A 3ZU6A 2XLBA 4KX5A 3NTRA 1XMQB 2Z5FA 2LW7A 1MAUA 3QGMA 4OATA 4D4GA 3LUPA 3NVDA 2C82A 3QPDA 4ML3A 4RF3A 3F6EX 3G1WA 2E6KA 2BSXA 5IZCA 3GGSA 4FEGA 1N33B 2UUAB 2C1EA 5CA1F 4EG5A 3K6SA 4Q3DA 2P78A 4H27A 2XE8A 4LGVA 4M7RA 2JGKA 4FTWA 1Q50A 1BX1A 1FQOA 3UB2A 4OP1A 2J07A 2J5KA 5AM0A 1CJKC 1VZ2A 4JLVA 3GUYA 1UPTA 4QPCA 2QIOA 1KZHA 1ZG3A 5FTKA 2VT3A 4MWGA 5HMMA 2FSPA 3IE1A 3JQCA 1T9HA 3JYOA 3EYAA 1J2EA 4TWRA 4MSUA 1JLLA 1Q74A 4LJSA 1CDZA 2UZAA 2W6IA 5MHTA 1LVUA 3BWDD 4W7IA 4MW4A 3FCUB 3G2LA 2I2BA 3JALB 3M1IA 4IYJA 4OGWA 4BXOA 4OF4A 4UHEA 2WM3A 1I5RA 2WMDA 1OGJA 1ZWKA 3D4IA 1CFJA 1PE0A 2PVSA 4HB4A 4YRRA 1VP3A 4DXHA 2BIFA 3C3AA 1YKGA 3NPAA 4QJ5A 3SEZA 4II7A 4MJ3A 3F1KA 2J9XB 4UE3S 2QY9A 4YP7A 3L4JA 3HDVA 2YYZA 1XB2A 1RLIA 2CJPA 2VAXA 4C87A 4EDFA 2PGDA 3U6BA 1MMFB 5HK8A 3QHAA 2RCYA 2XV1A 3OZEA 4GYWA 2R6HA 1VLVA 1DCKA 1VE5A 2FPIA 3N0XA 4PYLA 4RA9A 3SLKA 2XZLA 4OAOA 3DD1A 1KK0A 3G0IA 3FYHA 5AK0A 5EZYB 4D3XA 4AQ7A 2OHXA 1U8FO 4C4PA 4GOLD 4WY5A 3MQFA 1Q1EA 1JAHA 3NWPA 4U7TB 2ZYHA 5HF6A 2OYRA 1KKLA 3OOYA 4X6LA 1MPXA 4ZU3A 3A70A 4I9NA 5I51A 4IUDS 4M0EA 4TUYA 1K63A 1HPLA 1CUUA 4B46A 1JA9A 4DZZA 2C9DA 3PQDA 1R9GA 2CNLA 1F7VA 3HEAA 3ZGLA 1DI0A 2ODAA 1UFKA 2I4NA 3A1FA 2BTQA 3DMFA 2FVXA 3IJPA 4IGAA 4P84A 3WRXC 2QWXA 3ZTYA 3HI6A 3AHDA 4LDJA 4Q01A 4DCSA 3AEYA 5C53B 5TF0A 4IFTA 4ZI7F 2YL2A 4B3GA 5IC6A 2GRJA 3RASA 2V6BA 3ZHSA 4MIKA 4CUKA 2PT7A 4BVJA 5A3VA 5C7LO 3VR1A 2CJWB 4TTQA 1X7ZB 5BMVB 1NR5A 1C3OB 2CXRA 2ERCA 2I34A 4JBLA 3M5PA 2VF5X 3U19A 4KJZA 1DKQA 1QKJA 5KOHA 1D1TA 4AJOA 5FULA 4IPTA 1MGPA 1FIUA 4IOJA 2JA2A 4UBKA 4KO4S 2A5YB 4TTIA 1X86B 1XXHB 2LIPA 2VXYA 3L8HA 5EEHA 4EPWA 1UC4B 3FGOA 2PO5A 3LY8A 4BMZA 3C3KA 3QU9A 4WOJA 5DNDA 3FHOA 4DV0B 2DFTA 3NWBA 1Q91A 4HDSB 5AVTA 5AJVB 1EGVB 5K3AA 1PLJA 2ONZA 3K53A 1V6CA 5T3UA 3RUEA 2FH5B 2GD0A 4EENA 4IDOA 4F71A 4PVCA 1A97A 3KM0A 1UJBA 3A3PA 5IMSA 1SQ6A 4DQDA 3SJBA 4Z9YA 2IUTA 3NM6B 4M1EA 4YONB 2VYVD 4ZAXA 4CPDA 3TD9A 4DYHA 3MRTA 4NI5A 1WMFA 3U4MA 1QMGA 3QG5A 1GT6A 3LLVA 5HQTA 3P4UA 2I4LA 2IXDA 2QQEA 1FSFA 9LDTA 1EZ4A 4ZQGA 3F9RA 1U0JA 2DT8A 4LZNA 3QUTA 4LDZA 3BWXA 4RTRA 2VG8A 4R3NA 5KTKA 1HDYA 1U2GA 2VHUA 2AW5A 1A7AA 1C2YA 1Z7BA 4N41A 3PFGA 5BMOA 1IE3A 4HGQA 4Q1VA 1H8EA 1K7EB 4KWIA 5CB6A 3PYLA 7GPBA 1DAIA 1NZDA 2R7KA 2WFMA 5C8YA 3AM1A 4JP1A 1ZKDA 2PDAA 5I01A 1U7HA 1M2OA 1VL1A 3ZIAD 2P27A 3O75A 1XFDA 2BJWA 5KB3A 3NBXX 5ISMA 1AB6A 5JWOA 3A4IA 3EASA 4BRUA 3TF5A 4HMQA 2JFBA 3CRMA 2GSWA 1QIHA 2V6FA 3OX2A 3STXA 2IGBA 1TZJA 5DMHA 5F51A 4QVGA 1I7NA 1SCNE 2IYFA 4FCWA 2G83A 1AKRA 3IXQA 1YCDA 3E1GA 3HLYA 2YIMA 4O02B 4S1WA 5ALIA 4CDNA 2HJRA 2XT0A 3H86A 1QYDA 1MAVA 1V7ZA 1CULC 5F2KA 1U7UA 2JIOA 3EXHA 3WSWA 2C0CA 3TOCA 2CK3D 2WDZA 4XIYA 3OE5A 3OEHA 3O4RA 1H2RS 4PS0A 4RY8A 5G0VA 4JKIA 1TI7A 3LS2A 1LLDA 3CUWA 4KV7A 3SIXA 1SG0A 4EKGA 1ZYUA 4D8TA 3WWPA 4LXXA 621PA 2O2GA 3CLSC 4NYIQ 3IS3A 3V8QA 1X1RA 2I7XA 4A2QA 4BJ5A 3A4VA 3G8DA 1AIPA 1UXJA 2BLLA 3GJ5A 4N5DA 4ZK2A 1M6HA 2XMZA 2VH1A 4M37A 3K8OE 1X3SA 1GYRA 3ND8A 4JLWA 4KQKA 1H1TA 1OOEA 3O92A 4LCBA 3V6LA 3VU9B 1L4KA 4N6OA 4YLGA 3SIWA 4LXHA 2O57A 1CV2A 1OYYA 4IEIA 4UBMA 4QSMA 5GM2A 5ELXA 4WD3A 4BU0A 1NPTO 3VQTA 4HPJB 4J0IA 4TL9A 1UCFA 3K5HA 4TMVA 1DIRA 5BWCA 3CNLA 1NQOA 1SN7A 5DYGA 2F4VB 2DJ5A 1R0BA 4U0KA 4WXYB 4BVHA 4Z53A 2YUTA 1QPGA 2ECPA 1VJGA 2PZJA 4ROTA 1CIJA 3T3DA 4X64B 2NXNA 1M1UA 1AURA 5JXHA 3T9FA 4JYBA 2ON6A 2BZGA 1NYTA 1T2NA 5BOVA 4CM9D 3PJFA 2PX0A 2NZJA 3FVTA 4HFMA 4MI3A 3V9AA 2AN1A 4KUHA 5HS4A 1JXMA 1UODA 3DFKA 3LDFA 1P1JA 1ULUA 3ECSA 1V3UA 1CUGA 1FFSA 2W6JA 3JARB 1KFBB 3TZ6A 3ZWDA 3F9IA 4UFOA 1XZHA 3G0HA 1QMPA 1FLDA 2Z09A 4YMHA 1LFDB 3WZLA 4RHXA 2B83A 2IXFA 5ALMA 3AI7A 1H65A 2H06A 4IMJB 4CLHA 2IYYA 2DKOA 4ZFNA 3R77A 5FLXA 1ICEA 3GBVA 4J0JA 4XQCA 1ML3A 4JDPA 4L4YA 1MEEA 3FTFA 1CK4A 1T4BA 3IODA 4IRUB 4D0LB 2XOKA 3U09A 1ZU4A 3SU8A 3ELYA 2EFEB 3AY0A 1N2CB 2EJVA 4DIOA 2KB0A 4R2WA 4LRTB 1ZC3A 1O5TA 2OZEA 5AUQA 4E46A 1I4OA 1BXKA 4C04A 3H97A 5DOVA 3M1AA 4LC0A 4OG2A 3N2KB 4YASA 2OR3A 3UT5A 1GHTA 3B6KA 4IVQA 2GEKA 4WCVA 2GK4A 4HWSA 5DN9A 1XROA 2DUJA 3TEMA 2B2CA 4ZMSA 5IUKC 1G8HA 3MUFA 1VLHA 2YWJA 1YUMA 2UAGA 2WKWA 3OIDA 4P0QB 4BOYA 1NBWB 3T5MA 3QF4A 1IG0A 4EB0A 2ZZMA 4CKZA 2FUEA 3ZC3A 4IKOA 1ZEMA 5C1IA 3NH9A 1NR7A 2VUUA 3D3QA 3CUUA 4X3PA 1URPA 3BIJA 4LJ4A 2I6SA 1HNNA 3VHXA 1GPYA 1FTYA 3KK0A 2VJNA 4MRVA 3AEQA 4TL8A