2NW7A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferric heme. northeast structural genomics target xcr13
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
264
structure length
259
Chain Sequence
RLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
total genus 93
structure length 259
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw7A00
2NW7A 1YW0A 2NWBA 2NW9A 2V7LA 5ETWA 4PW8A 2D0UA 4PK5A 2V7JA 5EK3A 2X68A 2NW8A 2V7MA 2NOXA 2X67A 3E08A 4U72A 2D0TA 1ZEEA 5EK4A 2V7KA 2X66A 3BK9A 2V7IA 5EK2A 4PK6A 4HKAA 4U74A
chains in the Genus database with same CATH superfamily
3N9QA 1E2AA 3SS1A 2BG9E 2V5DA 5LHIB 2C5KT 2FUPA 2Q9QA 3N5LA 4JI6T 3N9PA 2BVMA 2IDOB 1HNZT 4QWNB 5F5WA 2MYSA 1YKHB 3AAEB 4UV8B 4ZXLA 4HGAA 5HXSA 3L09A 1OEDA 4JV5T 4YSZA 2XAJB 4LMKA 2LLYA 3EDVA 5TAOA 4HWDA 3ZSSA 4KX6A 4H9NC 1WR0A 1XDPA 5C2TA 3ABVA 1HCIA 2W00A 3EAMA 3AE5A 4N78D 4CXXA 3FZLB 4CN6A 3CPZA 1N34T 1XZYA 2NW9A 2JRKA 2IC9A 2XQ6A 4ZI2D 1KNPA 4ZI3D 3TLVA 4X1YE 2CXLA 5IYZE 4OX9T 4QH5A 3ZCIA 3N2GE 4TWHA 2BZBA 5FVKA 3QOFA 1UUSA 5CB4E 2JQ9A 2UUAT 4UVBB 1J5WA 1LRZA 2J4GA 3I9YA 4HFIA 3FXDB 1U5PA 1ZHCA 3HI2A 2M6BA 1LVKA 2XM2A 5LNKA 4HWFA 3AA0B 4AISA 4P1NA 3UU6A 2WWVA 2BDEA 1W9RA 3HKBE 4HWHA 2K9AA 1I94T 3ZLIA 3ZYLA 3AEGA 1VRBA 3PUGA 2IHR1 4YFSA 1BR2A 3NZQA 1WFDA 1YQ3A 2YU2A 3LBXB 4E7SA 3PJAJ 4NPPA 5JDFA 3T8OA 5LXTE 4H9QC 3JAEA 1NAFA 3K1SA 2DWGA 3T1YT 4QH1A 2J1DG 3M3ZB 2Y48B 4JEUB 2I6HA 1XWMA 4QXCB 2BBHA 2GK9A 4U3CA 4JI4T 3RI5A 2X0HA 3QB5A 3UT5E 1IBKT 5ADXL 4AQYT 5AQHB 3DTOA 3ZYMA 4ZZBA 3RQWA 2XQ7A 1KFYA 5KXJA 1FEWA 2IIUA 2SPCA 2KZ7B 3KV9A 1D1AA 2KNDA 4DR7T 1VCTA 5LMNT 3CQCB 1H7CA 4NUVA 4DR2T 4AXPA 3RQUA 4BJMA 4PAGA 2MAWA 3RH3A 3RGLA 1JNRA 1ZOYA 4O4LE 2YK0A 2E9XC 5HYAA 4HFVA 2JJ9A 2ACZA 2IW5B 3EUHA 1I6ZA 4PFPA 3PUVF 1SA0E 3CIRA 4O4IE 3RLFF 5JR9B 2WMOA 4OHFA 2BKPA 2Y6XA 2WS3A 1FJGT 2YEVC 3FZHB 3P4PA 2AXDS 4B3TT 4UR9A 1MNDA 2LRKA 2BS3A 4YTPA 2V7KA 5AQMB 3A7MA 2UXXB 3QUJA 3UTKA 3AA1B 4MHCA 4JI3T 2CM0A 5AQRB 2XQ8A 3PUYF 3L3PA 2CWOA 2X0LB 4A5XA 5E0OA 4UF0A 1X79A 4H63H 4WNKA 3AXJB 5ABGA 1XNQT 1IBMT 1HS7A 5C8YE 3V5UA 2X9YA 1BR0A 3ZT5A 4I55E 3KVBA 4ZI7E 5AQIB 1US7B 2E9XA 3X1DA 3OJAA 3PUQA 3DJBA 4EEDA 2OA5A 5L3FB 4X5TA 1UK5A 5AQLB 3I0OA 4OFZA 5LBQB 5LCYA 2BG9A 3CKDA 2WU5A 3TLWA 2HN2A 3T1HT 2V7JA 2W61A 2LRLA 3RIUC 3LK3B 4ZOLE 1D0XA 1IBLT 2PG8A 3N2KE 4UVCB 2VK9A 2ZMAA 3IF8B 3C51A 2HPJA 3FZFB 2XQ9A 4DV5T 4HFEA 4DR6T 2E2AA 3Q5DA 5JH7E 2DCFA 2XAFB 4ILCA 4QKNA 3FBZA 5AQKB 2XTLA 3UQ7A 2CLYC 3HR0A 2JQQA 4H9OC 3KV4A 2X67A 1X9BA 3RPUA 2CXDA 2DLRA 2ZM2A 5L4EA 4X1KE 4UV9B 3LFMA 4PJJA 4YJ2E 2Q9QB 4TNWA 4CQIA 3S4UA 2N2NA 3NKZA 5DQWA 3JC6C 2WDVA 3QNUA 4WW0A 4DBRA 5KMGP 1XMQT 4U7YA 2WDRA 3VR8A 1OEDB 2BVLA 4LF6T 3O1HA 4LFCT 2LOPA 4DV2T 2B76A 5LGTB 5AFUL 4ANJA 4EXTA 2PJQA 2E9XD 2FJBA 2XY8B 3RYIE 4IE5A 3MXZA 1E1HB 3EABA 4YXDA 2J62A 2WBLA 5DQVA 1V9DA 4DUZT 4X62T 4MLKA 3KDSE 5ABFA 3UU8A 3RC8A 3FBLA 2VASA 3HKCE 3PJAA 3A5XA 4DV7T 1VOMA 2V8SV 2K24A 5JQGE 5HCMA 2VWAA 4YHHT 3P50A 4AQFC 2N9DA 5JDHA 2UUCT 1YW0A 1G8XA 4HE8A 3PE0A 3NVOA 3Q2MA 5H6QB 2IUBA 1UCUA 3ESLA 3ANWA 2LHNA 4JI1T 2EHOC 3A8YC 2F4VT 3ZC0A 1IZNB 3E22E 2WAUA 2IAKA 4QX7B 4AKRB 2CMRA 4EOZB 4HTEA 5JRCB 5HXEA 1MMNA 2LOSA 4LF8T 2LHRA 4L5GA 2XAHB 4QHOA 1NWMX 2JIWA 4PJLA 4TZ4C 3R84B 4ILAA 4E7ZA 3KBUA 5CFBA 3VRAA 5FVLA 2WZIA 2LM2A 5LA6E 3ZMZB 3ETUA 2CPTA 3UUMA 2CBJA 2V26A 4YT0A 3ZYKA 2KINB 2DL1A 4OYJA 4ZS3A 2RP4A 4JBWF 2WCAA 2NOXA 4B3MT 2WU2A 4TWFA 1HNWT 2RA1A 3ZKRA 2A9UA 2WSSV 3N9NA 4ADZA 2KWHA 3O1IA 3SFEA 4IDPA 2UXCT 3AE8A 2WP9A 4DNDA 2QGSA 3PUXF 2JQKA 4EIWA 3Q5XA 1ZP0A 2CE7A 2V7IA 3EDUA 3CWZB 3OKQA 3PUSA 3GWHA 3RIAA 3CMLA 2WQYA 5JDMA 4FI5A 2WB5A 3AE7A 4O4HE 2ZLYA 3CK6A 2V1DB 1IJ5A 3ZCJA 3B5MA 4CZZB 1YQ4A 3AE2A 3K3QC 3Q5WA 4K0KT 5HXCA 3ZMTB 5JRCA 5L2LA 3OTOT 2W67A 3TKLB 5FMNA 3ZT6A 4YJ3E 3ZN1B 2LKHA 4FJOA 5L3GB 4F8HA 3JC6D 4O2BE 3SFDA 3V5SA 3AB3B 3AA6B 2XSAA 4H9PC 1T98A 5JDGA 1OXZA 2NW7A 2ZM0A 3GN5A 4LMJA 1UX4A 1T7SA 1BR1A 4MFRA 2X0YA 5AQQB 5LP6E 2XQAA 2X68A 2XJ7A 1KF6A 2KXPB 5L47A 3P7IA 1LVFA 1M7KA 4QXHB 5FY0A 4U2ZA 3I9WA 1Y01A 3PDYA 4B3RT 2K3WA 3O4XE 3N2OA 3BQKA 4IE4A 4GIWA 2V6YA 2OV9A 4DO0A 5ABEA 1QSDA 2JMHA 3RIFA 4YHJA 5LMUT 4HFHA 2UXBT 4WBNE 3ZC1A 1EZ3A 4DR5T 2QA7A 2BS2A 4IL9A 3I1AA 5AQOB 2UXNB 4ZHQE 3PURA 4DV1T 4UF0B 1KNRA 4UVAB 5LG4A 1XMOT 4P09A 4DR4T 3K3OA 4IE7A 3SWHA 5AQJB 5FNVE 3VRBA 3PTRB 2E9XB 1CHUA 1WRDA 2NTYA 2D0UA 3D0TA 3MKDA 1CUNA 5DJQC 3AE3A 2IC6A 2XPKA 4U33A 3AEDA 4QH4A 5HEOA 2BG9B 4HKAA 2KMFA 1D0ZA 1FMWA 1T8BA 1WCRA 2VKOA 4HFCA 5C3JA 5CA0E 3FB2A 5JVDE 2V5CA 4X66T 4ILBA 4KHPT 1MIYA 3W15B 3JADA 2VVNA 3P4SA 1Y64B 3H3AA 2YKSA 2ZM6T 4OK0A 2VL8A 2QVAA 4UXNB 3SOLA 3B13A 3PUWF 2X9HA 2FBWA 3K8PC 4L9IA 4BJNA 4CI2B 2W63A 5JR9C 5EZYE 2MPKA 4J2CA 2A2FX 2AE9A 3NBXX 3J7Yq 1IJ6A 2Y8DA 4ISTA 5FYMA 4YLHA 4I0UA 4UELA 4NIQA 2L3LA 4PJMA 3MZKB 4C91A 1WYBA 3VKGA 3IEEA 3OYZA 2BKNA 2CBIA 3AAAB 3ZEFB 1HTJF 5HEHA 5FP3A 2VKJA 1D1BA 3NZPA 4GK0E 4H9RC 1HFAA 4TV8E 4I4TE 1W0AA 3ZMVB 2CWYA 4COFA 5BR8T 4X20E 5FXWA 4ISSA 5IHYA 2LJLA 3C4XA 2R6GF 4U72A 3O1JA 5FXZA 1HG5A 3EHZA 2ODVA 3PU3A 3I0QA 4CN4A 2WDQA 4F6RC 2L8KA 3F31A 2M67A 3F57A 4TWDA 4DV0T 1MIVA 2DNXA 3WAKA 3HA4A 1IAPA 2ZM8A 1N33T 3ZN0B 4JI7T 2WY2A 3FZMB 3NRYA 3FZKB 2V7LA 5ABFB 4NUUA 4U31A 3UQ4A 4CN1A 4PK5A 2HPLA 4LF9T 1OWAA 4G63A 4EEBA 3QB5K 2IMLA 2WMNA 4DV4T 5LJNA 3R6NA 4BAYB 2H3RA 2LM9A 2PBIA 1Z0PA 4YY3T 3CQXC 4ZS2A 4ZI2C 1WYCA 5J2UE 3ANWB 4P0BA 4ZI3C 1U4QA 2KT9A 3BK9A 1E7PA 2PTFA 3L39A 5L3CB 2FJAA 3RC3A 2XQ5A 4CI3B 3HKEE 5LBMA 4PJNA 5EK3A 1HF8A 2WWUA 2YN6A 1XNRT 3MJXA 3L8RA 3RKOA 1KEYA 2MOZA 1W09A 3P4RA 5FY1A 3NWIA 3LJCA 3OPCA 2HH7A 4U7IA 5JREA 2J47A 3VU7H 5AQTB 2C5JA 2E5LT 4O4JE 2QYWA 4MBQA 3RIUA 2Q9QC 4V1Av 3JAFA 3QC9A 2LSGA 4JYAT 2XSBA 3ZPOA 3H3MA 1OEDC 5BMVE 2K5BB 2ACXA 2V7MA 3Q9DA 2HN1A 4IREA 3LG7A 2B1EA 4KMCA 1XDOA 3AE9A 2M6IA 3RYFE 5JTGA 4AIUA 2OLTA 3PUZF 3VHLA 1HX8A 3UUBA 3AEAA 5L3DB 5L4HA 3C4ZA 2PFVA 2MTQA 2KWIB 4EZHA 3SRZA 2V6XA 3RYCE 4Q25A 2NR4A 1HX1B 1ZKEA 3RHWA 4KBMB 5LOVE 1VCSA 3KV6A 3K3NA 4CXYA 1KNZA 4DV3T 4TX5A 3KFWX 5JDLA 3ZT7A 1MMDA 1FIOA 4WBOA 4LF7T 2W2UA 2YDRA 2D0TA 4QX8B 2WM9A 3JCFA 5EK2A 1QLBA 1BR4A 2ES0A 3PUAA 2XQ3A 3OVUA 2DI4A 4LF5T 1MIWA 4AKIA 2FJDA 3C50A 2A3DA 5HEGA 2YDQA 2VL0A 4KUMB 3CX6B 3GN5B 1Z8UA 3F2EA 4IDZA 3UFGA 3OYXA 4DIDB 2D2SA 3AECA 1J5ET 3BQLA 1SHZC 2YINA 4IDOA 2MBGA 3LK42 3NRXA 4GK5E 2W4XA 4ZEYA 2V6YB 4AQFA 4DV6T 5ABHA 4M1PA 3J9X1 4P0AA 3E0ZA 3WAJA 4PW8A 5J0ZA 3FXEB 1UURA 1MNEA 4B3ST 4HFDA 3CX7B 3TLSA 4X65T 2EHOA 3AEFA 3RF1A 5HEUA 5L3EB 3ZSTA 5FKYA 3QK6A 4YTNA 2A72A 1L0VA 1WR6A 1UGOA 2UXDT 3C4WA 3UUNA 3N9MA 4UEMA 4GKJT 2NW8A 4QXBB 2VB6A 3RRCA 3AE6A 3LK2B 1SE7A 4PNIA 3ZJ2A 5LGUB 3PU8A 4DMWA 4L0RA 4K0UA 4EGWA 5FY7A 2XAQB 2I59A 2UUBT 2P9BA 3RYHE 2JMKA 2CXFA 2CHOA 2VQFT 3HL6A 4XBFB 2D9DA 1UX5A 5JDNA 5HEJA 3PV0F 3U3IA 1N36T 2Q9QD 2LSJA 4OYKA 4YTMA 4EAHA 5EK4A 4GOUA 3DP7A 4ZZCA 1NEKA 2NP9A 2BKOA 2H7OA 5AQUB 5LGNB 4JUYA 2LE8A 4BA9A 2RPAA 5KX5E 3EVYA 2XHEB 3MACA 2H7VC 2JQHA 4EYYR 4DMVA 3RKGA 2CRBA 4O2AE 1T72A 3UFEA 3M65A 4I43B 5AQNB 4LMLA 2XQ4A 4EB6E 1GQEA 2JPFA 3KV5A 2EHOD 2LKGA 3KINB 1M62A 2X51A 2VKHA 2Z6EA 1D0YA 4O8SA 5GONE 5L3BB 4EZ4A 5F8PA 3Q5EA 4JLEA 4AQGA 1NENA 4EYUA 3U78A 4DUYT 5HCJA 2XQYA 1OEDE 4KP3C 2CCQA 3B57A 1FMVA 4IGUA 2C0SA 4DBQA 3AVSA 4I50E 2W0GA 4TNVA 4LFAT 3AEEA 3C98B 3ZJ1A 4CXWA 1R8IA 2W66A 4IT4A 5CJ5A 5IWAT 4GYSA 1MMGA 4AKHA 3IHRA 4IL4A 2X9WA 5FXXA 2BG9C 3GA8A 4CI1B 4NXNT 3UU3A 4ILUA 5AQSB 4GKKT 3MK7C 4JI8T 2LT3A 4A98A 3LBXA 1YD8G 2CHNA 2XASB 3AAIA 3EI0A 2VQET 5FL1A 4H9SE 5CA1E 5J1GA 5AQGB 4YSYA 2BBJA 1J1JA 5FL0A 4Z8XA 2LSYA 4X64T 2KLQA 3GMIA 1HNXT 2FJEA 1SUMB 3UUXB 4DVDA 4KI0F 3KBTA 3VKHA 2ODUA 4IHJE 4U2YA 3OBVE 5IUXA 4HWCA 1D1CA 2K48A 4B6XA 4AKGA 2BS4A 2D5UA 3P4WA 4C90A 2LSKA 1YKEB 4ASKA 3O9XA 5M4YA 1ZEEA 2KSRA 3LSVA 3N9LA 4UIGA 3CQGB 3AE4A 3ZMSB 2NWBA 1MMAA 3TLTA 3IA3A 1LKXA 3ONJA 1W0BA 2YOEA 4Z90A 3AEBA 5LJMA 5HWXA 2WZHA 4LF4T 3C64A 4PK6A 3ONLC 1S35A 5AQFB 5CGMA 5HXRA 5LHHB 1HR0T 3H37A 4ERRA 5FXVA 5H6RB 2CEAA 4Z91A 5LG3A 2DWKA 4MALA 1B7TA 1O3XA 3UULA 2N1GA 2C5IT 4IDQA 5JR9A 3VR9A 1KK7A 3ONXA 2CLYB 5JDQA 3HKDE 3ETVA 4TUYE 2W62A 1QUUA 5AQPB 4HWIB 4X1IE 3E08A 4IIJE 2LEHA 3UU4A 2G0UA 4WYVA 4TN7B 4YSXA 4HFBA 5KDMC 4TV9E 3IBPA 4JI5T 3P4QA 4KHZF 5ETWA 5LB7B 4XAXB 1YXRA 5F3JA 4HEAA 3G06A 2E8IA 2H89A 3AA7B 2XM1A 2HHHT 3WI3A 3FHNA 3AXJA 4A97A 4JEHB 4IE0A 4EV6A 2NTXA 3BQIA 5A1LA 3N9OA 4JI0T 2H88A 4AI6A 5LHGB 2E5VA 2LSIA 3CVRA 3P8CD 1N32T 3RX6A 3TLUA 4GYRA 3UU5A 4AKLA 4DR1T 2L9QA 1G73A 4H63V 3ZMUB 5HXHA 2VVSA 1DU2A 2XAGB 4JI2T 1ZV4X 3MA9A 4G2AA 4LFBT 5J2TE 3RRWA 1S94A 4A56A 2CA5A 1JNZA 2I0MA 1AJ3A 5HAXA 2EHOB 2DHRA 4DR3T 4PFOA 4NXMT 2VURA 2XZEA 5LYJE 2X9XA 4HN9A 4U74A 1HG2A 3CX8B 2QRXA 2XUEA 3AVRA 5HWYA 2VKDA 2YU1A 1WLXA 3KVAA 5DABA 2YDSA 4IE6A 3AE1A 5AQVB 4IDNA 4PK4A 2X66A 4XZCA 2UU9T 4WZXA 3LDQB
chains in the Genus database with same CATH topology
3H3AA 3N9QA 1UX5A 4QKNA 5JDNA 3FBZA 4OK0A 3SS1A 3U3IA 2XTLA 2CLYC 3HR0A 2VL8A 2JQQA 5LHIB 2C5KT 2Q9QD 4UXNB 4H9OC 3KV4A 2LSJA 4OYKA 2Q9QA 2X67A 3RPUA 3SOLA 3B13A 3N5LA 2CXDA 2X9HA 4EAHA 2DLRA 2ZM2A 5EK4A 4GOUA 3K8PC 3N9PA 4L9IA 4BJNA 2BVMA 3DP7A 4CI2B 2W63A 5JR9C 5EZYE 4X1KE 4QWNB 4UV9B 4J2CA 2A2FX 3NBXX 3LFMA 4PJJA 2NP9A 3J7Yq 1IJ6A 2H7OA 2MYSA 2Y8DA 4YJ2E 1YKHB 5LGNB 3AAEB 4ISTA 2Q9QB 2LE8A 4JUYA 4UV8B 4HGAA 4YLHA 5FYMA 4BA9A 3L09A 4CQIA 5HXSA 4UELA 3S4UA 2N2NA 5KX5E 5DQWA 2L3LA 4PJMA 3MZKB 3EVYA 4C91A 1WYBA 3VKGA 3IEEA 3JC6C 3OYZA 2XAJB 2XHEB 3MACA 3AAAB 4WW0A 3ZEFB 2H7VC 4DBRA 1HTJF 4EYYR 5FP3A 3EDVA 2VKJA 5KMGP 4DMVA 1D1BA 5TAOA 3NZPA 4GK0E 2BVLA 4H9RC 1HFAA 3O1HA 4O2AE 4TV8E 2LOPA 3UFEA 3M65A 4H9NC 5LGTB 4I4TE 4I43B 5AFUL 3ZMVB 2CWYA 1HCIA 2W00A 4ANJA 4X20E 5FXWA 4EXTA 4ISSA 2PJQA 5IHYA 2LJLA 2E9XD 3C4XA 4EB6E 4U72A 3O1JA 2JPFA 4N78D 3KV5A 2EHOD 5FXZA 3KINB 4CXXA 1HG5A 3RYIE 2X51A 2VKHA 2ODVA 2Z6EA 3CPZA 3I0QA 3PU3A 4IE5A 3MXZA 1E1HB 1D0YA 4F6RC 2WBLA 4O8SA 5DQVA 5GONE 4EZ4A 5F8PA 2NW9A 5L3BB 1V9DA 4JLEA 2L8KA 4AQGA 2JRKA 4MLKA 2IC9A 3F31A 2M67A 3U78A 4EYUA 4ZI2D 3F57A 3KDSE 2XQYA 1MIVA 3RC8A 2DNXA 2VASA 3FBLA 3HKCE 3HA4A 3A5XA 3WAKA 1IAPA 2ZM8A 4ZI3D 4KP3C 1VOMA 3ZN0B 2K24A 4X1YE 2CXLA 2CCQA 5IYZE 3B57A 5JQGE 1FMVA 4IGUA 2VWAA 3ZCIA 3N2GE 2C0SA 2BZBA 4DBQA 3AVSA 4AQFC 5JDHA 2N9DA 4I50E 2W0GA 1YW0A 1G8XA 3NRYA 3ZJ1A 3C98B 2V7LA 4CXWA 5CB4E 4HE8A 4NUUA 3PE0A 4PK5A 2HPLA 3Q2MA 5H6QB 4UVBB 1UCUA 1OWAA 3ESLA 4G63A 1LRZA 3ANWA 2WMNA 2LHNA 3I9YA 2EHOC 4GYSA 1MMGA 4AKHA 3FXDB 3IHRA 1U5PA 5LJNA 1ZHCA 3R6NA 3ZC0A 3HI2A 2X9WA 5FXXA 1LVKA 2H3RA 2LM9A 4BAYB 1IZNB 2PBIA 1Z0PA 3GA8A 5LNKA 3E22E 4CI1B 3AA0B 3CQXC 4ZS2A 4ZI2C 4ILUA 2WAUA 1WYCA 5J2UE 3ANWB 2IAKA 3MK7C 2BDEA 4QX7B 3HKBE 2CMRA 4AKRB 4EOZB 4HTEA 2K9AA 4P0BA 2LT3A 4ZI3C 1U4QA 2KT9A 3LBXA 3ZLIA 5JRCB 3BK9A 3ZYLA 1YD8G 5HXEA 1VRBA 2XASB 3PUGA 3AAIA 4YFSA 1MMNA 2LOSA 5L3CB 1BR2A 3NZQA 4H9SE 3RC3A 2LHRA 4L5GA 2XAHB 4CI3B 3HKEE 4QHOA 5CA1E 5J1GA 1NWMX 4PJLA 2YU2A 4TZ4C 4PJNA 5LBMA 3R84B 3LBXB 5EK3A 1HF8A 4E7SA 2WWUA 5JDFA 3MJXA 3KBUA 4E7ZA 3T8OA 5LXTE 4H9QC 3RKOA 4Z8XA 1NAFA 2LSYA 2MOZA 5FY1A 2DWGA 2J1DG 2KLQA 3GMIA 3LJCA 2HH7A 2Y48B 4JEUB 3UUXB 4DVDA 3KBTA 3VKHA 2ODUA 4IHJE 5JREA 3OBVE 5LA6E 3VU7H 4QXCB 3ZMZB 3ETUA 1D1CA 2K48A 2C5JA 3UUMA 4B6XA 4AKGA 2V26A 3ZYKA 2D5UA 2KINB 4OYJA 4C90A 2LSKA 4O4JE 4ZS3A 2GK9A 4MBQA 2RP4A 1YKEB 4ASKA 2NOXA 2Q9QC 2RA1A 3O9XA 5M4YA 4V1Av 1ZEEA 3N9LA 2WSSV 3N9NA 3QC9A 4UIGA 3CQGB 4ADZA 2KWHA 3O1IA 3UT5E 5ADXL 2LSGA 3ZMSB 2NWBA 3DTOA 1MMAA 3ZYMA 1LKXA 1FEWA 2SPCA 2KZ7B 3ZPOA 4DNDA 5BMVE 2QGSA 2K5BB 3KV9A 2ACXA 1D1AA 2KNDA 2V7MA 3Q9DA 3LG7A 4EIWA 3Q5XA 2B1EA 5LJMA 5HWXA 2CE7A 2V7IA 4KMCA 3RYFE 3C64A 3EDUA 4PK6A 3CQCB 1S35A 1H7CA 3CWZB 4NUVA 3VHLA 3OKQA 4AXPA 1HX8A 4BJMA 5HXRA 5LHHB 3PUSA 3GWHA 3CMLA 4PAGA 5L3DB 3H37A 3RH3A 3C4ZA 4ERRA 5JDMA 4FI5A 5FXVA 5H6RB 2CEAA 2PFVA 2MTQA 4O4HE 2KWIB 2ZLYA 4EZHA 2V1DB 1IJ5A 4O4LE 3ZCJA 2DWKA 3SRZA 4CZZB 4MALA 3RYCE 1B7TA 2YK0A 2E9XC 3K3QC 1O3XA 3UULA 2N1GA 5HYAA 4HFVA 2C5IT 2JJ9A 3Q5WA 5JR9A 1ZKEA 2IW5B 1KK7A 3EUHA 5HXCA 3ONXA 4KBMB 3ZMTB 2CLYB 5LOVE 5JRCA 4PFPA 5L2LA 1SA0E 5JDQA 4O4IE 3KV6A 3TKLB 3HKDE 3K3NA 5FMNA 4CXYA 1KNZA 3ETVA 4TUYE 2W62A 1QUUA 4YJ3E 3ZN1B 4TX5A 3KFWX 4FJOA 5L3GB 3JC6D 4X1IE 5JDLA 1MMDA 4O2BE 3V5SA 5JR9B 3E08A 4IIJE 2LEHA 2WMOA 3AB3B 1FIOA 4WBOA 4OHFA 2G0UA 2D0TA 3AA6B 4QX8B 2WM9A 4TN7B 2Y6XA 5EK2A 4H9PC 5KDMC 1T98A 1BR4A 2ES0A 3PUAA 4TV9E 5JDGA 1OXZA 2DI4A 3IBPA 2NW7A 2ZM0A 1MIWA 3GN5A 4AKIA 1UX4A 1BR1A 2YEVC 4MFRA 5ETWA 3C50A 2A3DA 5LP6E 1MNDA 4XAXB 2X68A 5F3JA 2KXPB 4HEAA 2E8IA 3P7IA 2V7KA 4KUMB 1LVFA 2UXXB 3CX6B 4QXHB 3GN5B 5FY0A 3QUJA 3I9WA 3UTKA 3AA7B 3F2EA 3PDYA 4IDZA 3AA1B 3WI3A 3FHNA 4MHCA 3O4XE 3OYXA 2CM0A 4JEHB 4IE0A 3N2OA 3BQKA 4IE4A 4GIWA 2D2SA 4DO0A 2NTXA 3BQIA 3BQLA 3L3PA 5A1LA 1SHZC 1QSDA 2JMHA 2CWOA 2X0LB 3N9OA 4YHJA 2YINA 4WBNE 3ZC1A 1EZ3A 4UF0A 5E0OA 4AI6A 1X79A 2QA7A 4H63H 4WNKA 2MBGA 5LHGB 1HS7A 3LK42 3NRXA 4GK5E 2LSIA 3CVRA 5C8YE 4AQFA 3P8CD 3V5UA 3I1AA 2X9YA 4M1PA 3J9X1 3RX6A 1BR0A 4P0AA 2UXNB 4ZHQE 3PURA 4GYRA 3E0ZA 4AKLA 4I55E 3WAJA 4PW8A 4UF0B 2L9QA 3FXEB 1G73A 4H63V 3KVBA 4UVAB 3ZMUB 5HXHA 1MNEA 4ZI7E 5LG4A 1US7B 2XAGB 4P09A 2E9XA 1ZV4X 3OJAA 3PUQA 3MA9A 3DJBA 3K3OA 3CX7B 4G2AA 4IE7A 2EHOA 2OA5A 3SWHA 5L3FB 5FNVE 5L3EB 3QK6A 3I0OA 2A72A 5J2TE 1WR6A 3RRWA 4OFZA 1S94A 5LBQB 3C4WA 5LCYA 4A56A 2CA5A 3UUNA 3CKDA 3PTRB 2E9XB 1WRDA 2NTYA 3N9MA 2D0UA 4UEMA 1AJ3A 2V7JA 5HAXA 2W61A 2EHOB 2NW8A 2DHRA 3D0TA 3MKDA 1CUNA 5DJQC 4PFOA 4QXBB 2VB6A 3RRCA 3LK3B 2IC6A 3LK2B 4PNIA 5LYJE 2X9XA 4ZOLE 1D0XA 4HN9A 3ZJ2A 5LGUB 3PU8A 4HKAA 2KMFA 1D0ZA 4DMWA 1FMWA 4U74A 2PG8A 3N2KE 4L0RA 2VKOA 4K0UA 1HG2A 2VK9A 3CX8B 4UVCB 2ZMAA 5FY7A 2XAQB 3IF8B 2I59A 5CA0E 3FB2A 3C51A 2HPJA 2XUEA 2P9BA 5JVDE 3AVRA 5HWYA 2VKDA 2YU1A 3RYHE 1WLXA 3KVAA 5DABA 4IE6A 2JMKA 2CXFA 1MIYA 3W15B 4PK4A 2X66A 5JH7E 2DCFA 4XZCA 1Y64B 2XAFB 3HL6A 4XBFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NW7 A;  1YW0 A;  2NWB A;  2NW9 A;  2V7L A;  5ETW A;  4PW8 A;  2D0U A;  4PK5 A;  2V7J A;  5EK3 A;  2X68 A;  2NW8 A;  2V7M A;  2NOX A;  2X67 A;  3E08 A;  4U72 A;  2D0T A;  1ZEE A;  5EK4 A;  2V7K A;  2X66 A;  3BK9 A;  2V7I A;  5EK2 A;  4PK6 A;  4HKA A;  4U74 A; 
#chains in the Genus database with same CATH topology
 3N9Q A;  1E2A A;  3SS1 A;  2BG9 E;  2V5D A;  5LHI B;  2C5K T;  2FUP A;  2Q9Q A;  3N5L A;  4JI6 T;  3N9P A;  2BVM A;  2IDO B;  1HNZ T;  4QWN B;  5F5W A;  2MYS A;  1YKH B;  3AAE B;  4UV8 B;  4ZXL A;  4HGA A;  5HXS A;  3L09 A;  1OED A;  4JV5 T;  4YSZ A;  2XAJ B;  4LMK A;  2LLY A;  3EDV A;  5TAO A;  4HWD A;  3ZSS A;  4KX6 A;  4H9N C;  1WR0 A;  1XDP A;  5C2T A;  3ABV A;  1HCI A;  2W00 A;  3EAM A;  3AE5 A;  4N78 D;  4CXX A;  3FZL B;  4CN6 A;  3CPZ A;  1N34 T;  1XZY A;  2NW9 A;  2JRK A;  2IC9 A;  2XQ6 A;  4ZI2 D;  1KNP A;  4ZI3 D;  3TLV A;  4X1Y E;  2CXL A;  5IYZ E;  4OX9 T;  4QH5 A;  3ZCI A;  3N2G E;  4TWH A;  2BZB A;  5FVK A;  3QOF A;  1UUS A;  5CB4 E;  2JQ9 A;  2UUA T;  4UVB B;  1J5W A;  1LRZ A;  2J4G A;  3I9Y A;  4HFI A;  3FXD B;  1U5P A;  1ZHC A;  3HI2 A;  2M6B A;  1LVK A;  2XM2 A;  5LNK A;  4HWF A;  3AA0 B;  4AIS A;  4P1N A;  3UU6 A;  2WWV A;  2BDE A;  1W9R A;  3HKB E;  4HWH A;  2K9A A;  1I94 T;  3ZLI A;  3ZYL A;  3AEG A;  1VRB A;  3PUG A;  2IHR 1;  4YFS A;  1BR2 A;  3NZQ A;  1WFD A;  1YQ3 A;  2YU2 A;  3LBX B;  4E7S A;  3PJA J;  4NPP A;  5JDF A;  3T8O A;  5LXT E;  4H9Q C;  3JAE A;  1NAF A;  3K1S A;  2DWG A;  3T1Y T;  4QH1 A;  2J1D G;  3M3Z B;  2Y48 B;  4JEU B;  2I6H A;  1XWM A;  4QXC B;  2BBH A;  2GK9 A;  4U3C A;  4JI4 T;  3RI5 A;  2X0H A;  3QB5 A;  3UT5 E;  1IBK T;  5ADX L;  4AQY T;  5AQH B;  3DTO A;  3ZYM A;  4ZZB A;  3RQW A;  2XQ7 A;  1KFY A;  5KXJ A;  1FEW A;  2IIU A;  2SPC A;  2KZ7 B;  3KV9 A;  1D1A A;  2KND A;  4DR7 T;  1VCT A;  5LMN T;  3CQC B;  1H7C A;  4NUV A;  4DR2 T;  4AXP A;  3RQU A;  4BJM A;  4PAG A;  2MAW A;  3RH3 A;  3RGL A;  1JNR A;  1ZOY A;  4O4L E;  2YK0 A;  2E9X C;  5HYA A;  4HFV A;  2JJ9 A;  2ACZ A;  2IW5 B;  3EUH A;  1I6Z A;  4PFP A;  3PUV F;  1SA0 E;  3CIR A;  4O4I E;  3RLF F;  5JR9 B;  2WMO A;  4OHF A;  2BKP A;  2Y6X A;  2WS3 A;  1FJG T;  2YEV C;  3FZH B;  3P4P A;  2AXD S;  4B3T T;  4UR9 A;  1MND A;  2LRK A;  2BS3 A;  4YTP A;  2V7K A;  5AQM B;  3A7M A;  2UXX B;  3QUJ A;  3UTK A;  3AA1 B;  4MHC A;  4JI3 T;  2CM0 A;  5AQR B;  2XQ8 A;  3PUY F;  3L3P A;  2CWO A;  2X0L B;  4A5X A;  5E0O A;  4UF0 A;  1X79 A;  4H63 H;  4WNK A;  3AXJ B;  5ABG A;  1XNQ T;  1IBM T;  1HS7 A;  5C8Y E;  3V5U A;  2X9Y A;  1BR0 A;  3ZT5 A;  4I55 E;  3KVB A;  4ZI7 E;  5AQI B;  1US7 B;  2E9X A;  3X1D A;  3OJA A;  3PUQ A;  3DJB A;  4EED A;  2OA5 A;  5L3F B;  4X5T A;  1UK5 A;  5AQL B;  3I0O A;  4OFZ A;  5LBQ B;  5LCY A;  2BG9 A;  3CKD A;  2WU5 A;  3TLW A;  2HN2 A;  3T1H T;  2V7J A;  2W61 A;  2LRL A;  3RIU C;  3LK3 B;  4ZOL E;  1D0X A;  1IBL T;  2PG8 A;  3N2K E;  4UVC B;  2VK9 A;  2ZMA A;  3IF8 B;  3C51 A;  2HPJ A;  3FZF B;  2XQ9 A;  4DV5 T;  4HFE A;  4DR6 T;  2E2A A;  3Q5D A;  5JH7 E;  2DCF A;  2XAF B;  4ILC A;  4QKN A;  3FBZ A;  5AQK B;  2XTL A;  3UQ7 A;  2CLY C;  3HR0 A;  2JQQ A;  4H9O C;  3KV4 A;  2X67 A;  1X9B A;  3RPU A;  2CXD A;  2DLR A;  2ZM2 A;  5L4E A;  4X1K E;  4UV9 B;  3LFM A;  4PJJ A;  4YJ2 E;  2Q9Q B;  4TNW A;  4CQI A;  3S4U A;  2N2N A;  3NKZ A;  5DQW A;  3JC6 C;  2WDV A;  3QNU A;  4WW0 A;  4DBR A;  5KMG P;  1XMQ T;  4U7Y A;  2WDR A;  3VR8 A;  1OED B;  2BVL A;  4LF6 T;  3O1H A;  4LFC T;  2LOP A;  4DV2 T;  2B76 A;  5LGT B;  5AFU L;  4ANJ A;  4EXT A;  2PJQ A;  2E9X D;  2FJB A;  2XY8 B;  3RYI E;  4IE5 A;  3MXZ A;  1E1H B;  3EAB A;  4YXD A;  2J62 A;  2WBL A;  5DQV A;  1V9D A;  4DUZ T;  4X62 T;  4MLK A;  3KDS E;  5ABF A;  3UU8 A;  3RC8 A;  3FBL A;  2VAS A;  3HKC E;  3PJA A;  3A5X A;  4DV7 T;  1VOM A;  2V8S V;  2K24 A;  5JQG E;  5HCM A;  2VWA A;  4YHH T;  3P50 A;  4AQF C;  2N9D A;  5JDH A;  2UUC T;  1YW0 A;  1G8X A;  4HE8 A;  3PE0 A;  3NVO A;  3Q2M A;  5H6Q B;  2IUB A;  1UCU A;  3ESL A;  3ANW A;  2LHN A;  4JI1 T;  2EHO C;  3A8Y C;  2F4V T;  3ZC0 A;  1IZN B;  3E22 E;  2WAU A;  2IAK A;  4QX7 B;  4AKR B;  2CMR A;  4EOZ B;  4HTE A;  5JRC B;  5HXE A;  1MMN A;  2LOS A;  4LF8 T;  2LHR A;  4L5G A;  2XAH B;  4QHO A;  1NWM X;  2JIW A;  4PJL A;  4TZ4 C;  3R84 B;  4ILA A;  4E7Z A;  3KBU A;  5CFB A;  3VRA A;  5FVL A;  2WZI A;  2LM2 A;  5LA6 E;  3ZMZ B;  3ETU A;  2CPT A;  3UUM A;  2CBJ A;  2V26 A;  4YT0 A;  3ZYK A;  2KIN B;  2DL1 A;  4OYJ A;  4ZS3 A;  2RP4 A;  4JBW F;  2WCA A;  2NOX A;  4B3M T;  2WU2 A;  4TWF A;  1HNW T;  2RA1 A;  3ZKR A;  2A9U A;  2WSS V;  3N9N A;  4ADZ A;  2KWH A;  3O1I A;  3SFE A;  4IDP A;  2UXC T;  3AE8 A;  2WP9 A;  4DND A;  2QGS A;  3PUX F;  2JQK A;  4EIW A;  3Q5X A;  1ZP0 A;  2CE7 A;  2V7I A;  3EDU A;  3CWZ B;  3OKQ A;  3PUS A;  3GWH A;  3RIA A;  3CML A;  2WQY A;  5JDM A;  4FI5 A;  2WB5 A;  3AE7 A;  4O4H E;  2ZLY A;  3CK6 A;  2V1D B;  1IJ5 A;  3ZCJ A;  3B5M A;  4CZZ B;  1YQ4 A;  3AE2 A;  3K3Q C;  3Q5W A;  4K0K T;  5HXC A;  3ZMT B;  5JRC A;  5L2L A;  3OTO T;  2W67 A;  3TKL B;  5FMN A;  3ZT6 A;  4YJ3 E;  3ZN1 B;  2LKH A;  4FJO A;  5L3G B;  4F8H A;  3JC6 D;  4O2B E;  3SFD A;  3V5S A;  3AB3 B;  3AA6 B;  2XSA A;  4H9P C;  1T98 A;  5JDG A;  1OXZ A;  2NW7 A;  2ZM0 A;  3GN5 A;  4LMJ A;  1UX4 A;  1T7S A;  1BR1 A;  4MFR A;  2X0Y A;  5AQQ B;  5LP6 E;  2XQA A;  2X68 A;  2XJ7 A;  1KF6 A;  2KXP B;  5L47 A;  3P7I A;  1LVF A;  1M7K A;  4QXH B;  5FY0 A;  4U2Z A;  3I9W A;  1Y01 A;  3PDY A;  4B3R T;  2K3W A;  3O4X E;  3N2O A;  3BQK A;  4IE4 A;  4GIW A;  2V6Y A;  2OV9 A;  4DO0 A;  5ABE A;  1QSD A;  2JMH A;  3RIF A;  4YHJ A;  5LMU T;  4HFH A;  2UXB T;  4WBN E;  3ZC1 A;  1EZ3 A;  4DR5 T;  2QA7 A;  2BS2 A;  4IL9 A;  3I1A A;  5AQO B;  2UXN B;  4ZHQ E;  3PUR A;  4DV1 T;  4UF0 B;  1KNR A;  4UVA B;  5LG4 A;  1XMO T;  4P09 A;  4DR4 T;  3K3O A;  4IE7 A;  3SWH A;  5AQJ B;  5FNV E;  3VRB A;  3PTR B;  2E9X B;  1CHU A;  1WRD A;  2NTY A;  2D0U A;  3D0T A;  3MKD A;  1CUN A;  5DJQ C;  3AE3 A;  2IC6 A;  2XPK A;  4U33 A;  3AED A;  4QH4 A;  5HEO A;  2BG9 B;  4HKA A;  2KMF A;  1D0Z A;  1FMW A;  1T8B A;  1WCR A;  2VKO A;  4HFC A;  5C3J A;  5CA0 E;  3FB2 A;  5JVD E;  2V5C A;  4X66 T;  4ILB A;  4KHP T;  1MIY A;  3W15 B;  3JAD A;  2VVN A;  3P4S A;  1Y64 B;  3H3A A;  2YKS A;  2ZM6 T;  4OK0 A;  2VL8 A;  2QVA A;  4UXN B;  3SOL A;  3B13 A;  3PUW F;  2X9H A;  2FBW A;  3K8P C;  4L9I A;  4BJN A;  4CI2 B;  2W63 A;  5JR9 C;  5EZY E;  2MPK A;  4J2C A;  2A2F X;  2AE9 A;  3NBX X;  3J7Y q;  1IJ6 A;  2Y8D A;  4IST A;  5FYM A;  4YLH A;  4I0U A;  4UEL A;  4NIQ A;  2L3L A;  4PJM A;  3MZK B;  4C91 A;  1WYB A;  3VKG A;  3IEE A;  3OYZ A;  2BKN A;  2CBI A;  3AAA B;  3ZEF B;  1HTJ F;  5HEH A;  5FP3 A;  2VKJ A;  1D1B A;  3NZP A;  4GK0 E;  4H9R C;  1HFA A;  4TV8 E;  4I4T E;  1W0A A;  3ZMV B;  2CWY A;  4COF A;  5BR8 T;  4X20 E;  5FXW A;  4ISS A;  5IHY A;  2LJL A;  3C4X A;  2R6G F;  4U72 A;  3O1J A;  5FXZ A;  1HG5 A;  3EHZ A;  2ODV A;  3PU3 A;  3I0Q A;  4CN4 A;  2WDQ A;  4F6R C;  2L8K A;  3F31 A;  2M67 A;  3F57 A;  4TWD A;  4DV0 T;  1MIV A;  2DNX A;  3WAK A;  3HA4 A;  1IAP A;  2ZM8 A;  1N33 T;  3ZN0 B;  4JI7 T;  2WY2 A;  3FZM B;  3NRY A;  3FZK B;  2V7L A;  5ABF B;  4NUU A;  4U31 A;  3UQ4 A;  4CN1 A;  4PK5 A;  2HPL A;  4LF9 T;  1OWA A;  4G63 A;  4EEB A;  3QB5 K;  2IML A;  2WMN A;  4DV4 T;  5LJN A;  3R6N A;  4BAY B;  2H3R A;  2LM9 A;  2PBI A;  1Z0P A;  4YY3 T;  3CQX C;  4ZS2 A;  4ZI2 C;  1WYC A;  5J2U E;  3ANW B;  4P0B A;  4ZI3 C;  1U4Q A;  2KT9 A;  3BK9 A;  1E7P A;  2PTF A;  3L39 A;  5L3C B;  2FJA A;  3RC3 A;  2XQ5 A;  4CI3 B;  3HKE E;  5LBM A;  4PJN A;  5EK3 A;  1HF8 A;  2WWU A;  2YN6 A;  1XNR T;  3MJX A;  3L8R A;  3RKO A;  1KEY A;  2MOZ A;  1W09 A;  3P4R A;  5FY1 A;  3NWI A;  3LJC A;  3OPC A;  2HH7 A;  4U7I A;  5JRE A;  2J47 A;  3VU7 H;  5AQT B;  2C5J A;  2E5L T;  4O4J E;  2QYW A;  4MBQ A;  3RIU A;  2Q9Q C;  4V1A v;  3JAF A;  3QC9 A;  2LSG A;  4JYA T;  2XSB A;  3ZPO A;  3H3M A;  1OED C;  5BMV E;  2K5B B;  2ACX A;  2V7M A;  3Q9D A;  2HN1 A;  4IRE A;  3LG7 A;  2B1E A;  4KMC A;  1XDO A;  3AE9 A;  2M6I A;  3RYF E;  5JTG A;  4AIU A;  2OLT A;  3PUZ F;  3VHL A;  1HX8 A;  3UUB A;  3AEA A;  5L3D B;  5L4H A;  3C4Z A;  2PFV A;  2MTQ A;  2KWI B;  4EZH A;  3SRZ A;  2V6X A;  3RYC E;  4Q25 A;  2NR4 A;  1HX1 B;  1ZKE A;  3RHW A;  4KBM B;  5LOV E;  1VCS A;  3KV6 A;  3K3N A;  4CXY A;  1KNZ A;  4DV3 T;  4TX5 A;  3KFW X;  5JDL A;  3ZT7 A;  1MMD A;  1FIO A;  4WBO A;  4LF7 T;  2W2U A;  2YDR A;  2D0T A;  4QX8 B;  2WM9 A;  3JCF A;  5EK2 A;  1QLB A;  1BR4 A;  2ES0 A;  3PUA A;  2XQ3 A;  3OVU A;  2DI4 A;  4LF5 T;  1MIW A;  4AKI A;  2FJD A;  3C50 A;  2A3D A;  5HEG A;  2YDQ A;  2VL0 A;  4KUM B;  3CX6 B;  3GN5 B;  1Z8U A;  3F2E A;  4IDZ A;  3UFG A;  3OYX A;  4DID B;  2D2S A;  3AEC A;  1J5E T;  3BQL A;  1SHZ C;  2YIN A;  4IDO A;  2MBG A;  3LK4 2;  3NRX A;  4GK5 E;  2W4X A;  4ZEY A;  2V6Y B;  4AQF A;  4DV6 T;  5ABH A;  4M1P A;  3J9X 1;  4P0A A;  3E0Z A;  3WAJ A;  4PW8 A;  5J0Z A;  3FXE B;  1UUR A;  1MNE A;  4B3S T;  4HFD A;  3CX7 B;  3TLS A;  4X65 T;  2EHO A;  3AEF A;  3RF1 A;  5HEU A;  5L3E B;  3ZST A;  5FKY A;  3QK6 A;  4YTN A;  2A72 A;  1L0V A;  1WR6 A;  1UGO A;  2UXD T;  3C4W A;  3UUN A;  3N9M A;  4UEM A;  4GKJ T;  2NW8 A;  4QXB B;  2VB6 A;  3RRC A;  3AE6 A;  3LK2 B;  1SE7 A;  4PNI A;  3ZJ2 A;  5LGU B;  3PU8 A;  4DMW A;  4L0R A;  4K0U A;  4EGW A;  5FY7 A;  2XAQ B;  2I59 A;  2UUB T;  2P9B A;  3RYH E;  2JMK A;  2CXF A;  2CHO A;  2VQF T;  3HL6 A;  4XBF B;  2D9D A;  1UX5 A;  5JDN A;  5HEJ A;  3PV0 F;  3U3I A;  1N36 T;  2Q9Q D;  2LSJ A;  4OYK A;  4YTM A;  4EAH A;  5EK4 A;  4GOU A;  3DP7 A;  4ZZC A;  1NEK A;  2NP9 A;  2BKO A;  2H7O A;  5AQU B;  5LGN B;  4JUY A;  2LE8 A;  4BA9 A;  2RPA A;  5KX5 E;  3EVY A;  2XHE B;  3MAC A;  2H7V C;  2JQH A;  4EYY R;  4DMV A;  3RKG A;  2CRB A;  4O2A E;  1T72 A;  3UFE A;  3M65 A;  4I43 B;  5AQN B;  4LML A;  2XQ4 A;  4EB6 E;  1GQE A;  2JPF A;  3KV5 A;  2EHO D;  2LKG A;  3KIN B;  1M62 A;  2X51 A;  2VKH A;  2Z6E A;  1D0Y A;  4O8S A;  5GON E;  5L3B B;  4EZ4 A;  5F8P A;  3Q5E A;  4JLE A;  4AQG A;  1NEN A;  4EYU A;  3U78 A;  4DUY T;  5HCJ A;  2XQY A;  1OED E;  4KP3 C;  2CCQ A;  3B57 A;  1FMV A;  4IGU A;  2C0S A;  4DBQ A;  3AVS A;  4I50 E;  2W0G A;  4TNV A;  4LFA T;  3AEE A;  3C98 B;  3ZJ1 A;  4CXW A;  1R8I A;  2W66 A;  4IT4 A;  5CJ5 A;  5IWA T;  4GYS A;  1MMG A;  4AKH A;  3IHR A;  4IL4 A;  2X9W A;  5FXX A;  2BG9 C;  3GA8 A;  4CI1 B;  4NXN T;  3UU3 A;  4ILU A;  5AQS B;  4GKK T;  3MK7 C;  4JI8 T;  2LT3 A;  4A98 A;  3LBX A;  1YD8 G;  2CHN A;  2XAS B;  3AAI A;  3EI0 A;  2VQE T;  5FL1 A;  4H9S E;  5CA1 E;  5J1G A;  5AQG B;  4YSY A;  2BBJ A;  1J1J A;  5FL0 A;  4Z8X A;  2LSY A;  4X64 T;  2KLQ A;  3GMI A;  1HNX T;  2FJE A;  1SUM B;  3UUX B;  4DVD A;  4KI0 F;  3KBT A;  3VKH A;  2ODU A;  4IHJ E;  4U2Y A;  3OBV E;  5IUX A;  4HWC A;  1D1C A;  2K48 A;  4B6X A;  4AKG A;  2BS4 A;  2D5U A;  3P4W A;  4C90 A;  2LSK A;  1YKE B;  4ASK A;  3O9X A;  5M4Y A;  1ZEE A;  2KSR A;  3LSV A;  3N9L A;  4UIG A;  3CQG B;  3AE4 A;  3ZMS B;  2NWB A;  1MMA A;  3TLT A;  3IA3 A;  1LKX A;  3ONJ A;  1W0B A;  2YOE A;  4Z90 A;  3AEB A;  5LJM A;  5HWX A;  2WZH A;  4LF4 T;  3C64 A;  4PK6 A;  3ONL C;  1S35 A;  5AQF B;  5CGM A;  5HXR A;  5LHH B;  1HR0 T;  3H37 A;  4ERR A;  5FXV A;  5H6R B;  2CEA A;  4Z91 A;  5LG3 A;  2DWK A;  4MAL A;  1B7T A;  1O3X A;  3UUL A;  2N1G A;  2C5I T;  4IDQ A;  5JR9 A;  3VR9 A;  1KK7 A;  3ONX A;  2CLY B;  5JDQ A;  3HKD E;  3ETV A;  4TUY E;  2W62 A;  1QUU A;  5AQP B;  4HWI B;  4X1I E;  3E08 A;  4IIJ E;  2LEH A;  3UU4 A;  2G0U A;  4WYV A;  4TN7 B;  4YSX A;  4HFB A;  5KDM C;  4TV9 E;  3IBP A;  4JI5 T;  3P4Q A;  4KHZ F;  5ETW A;  5LB7 B;  4XAX B;  1YXR A;  5F3J A;  4HEA A;  3G06 A;  2E8I A;  2H89 A;  3AA7 B;  2XM1 A;  2HHH T;  3WI3 A;  3FHN A;  3AXJ A;  4A97 A;  4JEH B;  4IE0 A;  4EV6 A;  2NTX A;  3BQI A;  5A1L A;  3N9O A;  4JI0 T;  2H88 A;  4AI6 A;  5LHG B;  2E5V A;  2LSI A;  3CVR A;  3P8C D;  1N32 T;  3RX6 A;  3TLU A;  4GYR A;  3UU5 A;  4AKL A;  4DR1 T;  2L9Q A;  1G73 A;  4H63 V;  3ZMU B;  5HXH A;  2VVS A;  1DU2 A;  2XAG B;  4JI2 T;  1ZV4 X;  3MA9 A;  4G2A A;  4LFB T;  5J2T E;  3RRW A;  1S94 A;  4A56 A;  2CA5 A;  1JNZ A;  2I0M A;  1AJ3 A;  5HAX A;  2EHO B;  2DHR A;  4DR3 T;  4PFO A;  4NXM T;  2VUR A;  2XZE A;  5LYJ E;  2X9X A;  4HN9 A;  4U74 A;  1HG2 A;  3CX8 B;  2QRX A;  2XUE A;  3AVR A;  5HWY A;  2VKD A;  2YU1 A;  1WLX A;  3KVA A;  5DAB A;  2YDS A;  4IE6 A;  3AE1 A;  5AQV B;  4IDN A;  4PK4 A;  2X66 A;  4XZC A;  2UU9 T;  4WZX A;  3LDQ B; 
#chains in the Genus database with same CATH homology
 3H3A A;  3N9Q A;  1UX5 A;  4QKN A;  5JDN A;  3FBZ A;  4OK0 A;  3SS1 A;  3U3I A;  2XTL A;  2CLY C;  3HR0 A;  2VL8 A;  2JQQ A;  5LHI B;  2C5K T;  2Q9Q D;  4UXN B;  4H9O C;  3KV4 A;  2LSJ A;  4OYK A;  2Q9Q A;  2X67 A;  3RPU A;  3SOL A;  3B13 A;  3N5L A;  2CXD A;  2X9H A;  4EAH A;  2DLR A;  2ZM2 A;  5EK4 A;  4GOU A;  3K8P C;  3N9P A;  4L9I A;  4BJN A;  2BVM A;  3DP7 A;  4CI2 B;  2W63 A;  5JR9 C;  5EZY E;  4X1K E;  4QWN B;  4UV9 B;  4J2C A;  2A2F X;  3NBX X;  3LFM A;  4PJJ A;  2NP9 A;  3J7Y q;  1IJ6 A;  2H7O A;  2MYS A;  2Y8D A;  4YJ2 E;  1YKH B;  5LGN B;  3AAE B;  4IST A;  2Q9Q B;  2LE8 A;  4JUY A;  4UV8 B;  4HGA A;  4YLH A;  5FYM A;  4BA9 A;  3L09 A;  4CQI A;  5HXS A;  4UEL A;  3S4U A;  2N2N A;  5KX5 E;  5DQW A;  2L3L A;  4PJM A;  3MZK B;  3EVY A;  4C91 A;  1WYB A;  3VKG A;  3IEE A;  3JC6 C;  3OYZ A;  2XAJ B;  2XHE B;  3MAC A;  3AAA B;  4WW0 A;  3ZEF B;  2H7V C;  4DBR A;  1HTJ F;  4EYY R;  5FP3 A;  3EDV A;  2VKJ A;  5KMG P;  4DMV A;  1D1B A;  5TAO A;  3NZP A;  4GK0 E;  2BVL A;  4H9R C;  1HFA A;  3O1H A;  4O2A E;  4TV8 E;  2LOP A;  3UFE A;  3M65 A;  4H9N C;  5LGT B;  4I4T E;  4I43 B;  5AFU L;  3ZMV B;  2CWY A;  1HCI A;  2W00 A;  4ANJ A;  4X20 E;  5FXW A;  4EXT A;  4ISS A;  2PJQ A;  5IHY A;  2LJL A;  2E9X D;  3C4X A;  4EB6 E;  4U72 A;  3O1J A;  2JPF A;  4N78 D;  3KV5 A;  2EHO D;  5FXZ A;  3KIN B;  4CXX A;  1HG5 A;  3RYI E;  2X51 A;  2VKH A;  2ODV A;  2Z6E A;  3CPZ A;  3I0Q A;  3PU3 A;  4IE5 A;  3MXZ A;  1E1H B;  1D0Y A;  4F6R C;  2WBL A;  4O8S A;  5DQV A;  5GON E;  4EZ4 A;  5F8P A;  2NW9 A;  5L3B B;  1V9D A;  4JLE A;  2L8K A;  4AQG A;  2JRK A;  4MLK A;  2IC9 A;  3F31 A;  2M67 A;  3U78 A;  4EYU A;  4ZI2 D;  3F57 A;  3KDS E;  2XQY A;  1MIV A;  3RC8 A;  2DNX A;  2VAS A;  3FBL A;  3HKC E;  3HA4 A;  3A5X A;  3WAK A;  1IAP A;  2ZM8 A;  4ZI3 D;  4KP3 C;  1VOM A;  3ZN0 B;  2K24 A;  4X1Y E;  2CXL A;  2CCQ A;  5IYZ E;  3B57 A;  5JQG E;  1FMV A;  4IGU A;  2VWA A;  3ZCI A;  3N2G E;  2C0S A;  2BZB A;  4DBQ A;  3AVS A;  4AQF C;  5JDH A;  2N9D A;  4I50 E;  2W0G A;  1YW0 A;  1G8X A;  3NRY A;  3ZJ1 A;  3C98 B;  2V7L A;  4CXW A;  5CB4 E;  4HE8 A;  4NUU A;  3PE0 A;  4PK5 A;  2HPL A;  3Q2M A;  5H6Q B;  4UVB B;  1UCU A;  1OWA A;  3ESL A;  4G63 A;  1LRZ A;  3ANW A;  2WMN A;  2LHN A;  3I9Y A;  2EHO C;  4GYS A;  1MMG A;  4AKH A;  3FXD B;  3IHR A;  1U5P A;  5LJN A;  1ZHC A;  3R6N A;  3ZC0 A;  3HI2 A;  2X9W A;  5FXX A;  1LVK A;  2H3R A;  2LM9 A;  4BAY B;  1IZN B;  2PBI A;  1Z0P A;  3GA8 A;  5LNK A;  3E22 E;  4CI1 B;  3AA0 B;  3CQX C;  4ZS2 A;  4ZI2 C;  4ILU A;  2WAU A;  1WYC A;  5J2U E;  3ANW B;  2IAK A;  3MK7 C;  2BDE A;  4QX7 B;  3HKB E;  2CMR A;  4AKR B;  4EOZ B;  4HTE A;  2K9A A;  4P0B A;  2LT3 A;  4ZI3 C;  1U4Q A;  2KT9 A;  3LBX A;  3ZLI A;  5JRC B;  3BK9 A;  3ZYL A;  1YD8 G;  5HXE A;  1VRB A;  2XAS B;  3PUG A;  3AAI A;  4YFS A;  1MMN A;  2LOS A;  5L3C B;  1BR2 A;  3NZQ A;  4H9S E;  3RC3 A;  2LHR A;  4L5G A;  2XAH B;  4CI3 B;  3HKE E;  4QHO A;  5CA1 E;  5J1G A;  1NWM X;  4PJL A;  2YU2 A;  4TZ4 C;  4PJN A;  5LBM A;  3R84 B;  3LBX B;  5EK3 A;  1HF8 A;  4E7S A;  2WWU A;  5JDF A;  3MJX A;  3KBU A;  4E7Z A;  3T8O A;  5LXT E;  4H9Q C;  3RKO A;  4Z8X A;  1NAF A;  2LSY A;  2MOZ A;  5FY1 A;  2DWG A;  2J1D G;  2KLQ A;  3GMI A;  3LJC A;  2HH7 A;  2Y48 B;  4JEU B;  3UUX B;  4DVD A;  3KBT A;  3VKH A;  2ODU A;  4IHJ E;  5JRE A;  3OBV E;  5LA6 E;  3VU7 H;  4QXC B;  3ZMZ B;  3ETU A;  1D1C A;  2K48 A;  2C5J A;  3UUM A;  4B6X A;  4AKG A;  2V26 A;  3ZYK A;  2D5U A;  2KIN B;  4OYJ A;  4C90 A;  2LSK A;  4O4J E;  4ZS3 A;  2GK9 A;  4MBQ A;  2RP4 A;  1YKE B;  4ASK A;  2NOX A;  2Q9Q C;  2RA1 A;  3O9X A;  5M4Y A;  4V1A v;  1ZEE A;  3N9L A;  2WSS V;  3N9N A;  3QC9 A;  4UIG A;  3CQG B;  4ADZ A;  2KWH A;  3O1I A;  3UT5 E;  5ADX L;  2LSG A;  3ZMS B;  2NWB A;  3DTO A;  1MMA A;  3ZYM A;  1LKX A;  1FEW A;  2SPC A;  2KZ7 B;  3ZPO A;  4DND A;  5BMV E;  2QGS A;  2K5B B;  3KV9 A;  2ACX A;  1D1A A;  2KND A;  2V7M A;  3Q9D A;  3LG7 A;  4EIW A;  3Q5X A;  2B1E A;  5LJM A;  5HWX A;  2CE7 A;  2V7I A;  4KMC A;  3RYF E;  3C64 A;  3EDU A;  4PK6 A;  3CQC B;  1S35 A;  1H7C A;  3CWZ B;  4NUV A;  3VHL A;  3OKQ A;  4AXP A;  1HX8 A;  4BJM A;  5HXR A;  5LHH B;  3PUS A;  3GWH A;  3CML A;  4PAG A;  5L3D B;  3H37 A;  3RH3 A;  3C4Z A;  4ERR A;  5JDM A;  4FI5 A;  5FXV A;  5H6R B;  2CEA A;  2PFV A;  2MTQ A;  4O4H E;  2KWI B;  2ZLY A;  4EZH A;  2V1D B;  1IJ5 A;  4O4L E;  3ZCJ A;  2DWK A;  3SRZ A;  4CZZ B;  4MAL A;  3RYC E;  1B7T A;  2YK0 A;  2E9X C;  3K3Q C;  1O3X A;  3UUL A;  2N1G A;  5HYA A;  4HFV A;  2C5I T;  2JJ9 A;  3Q5W A;  5JR9 A;  1ZKE A;  2IW5 B;  1KK7 A;  3EUH A;  5HXC A;  3ONX A;  4KBM B;  3ZMT B;  2CLY B;  5LOV E;  5JRC A;  4PFP A;  5L2L A;  1SA0 E;  5JDQ A;  4O4I E;  3KV6 A;  3TKL B;  3HKD E;  3K3N A;  5FMN A;  4CXY A;  1KNZ A;  3ETV A;  4TUY E;  2W62 A;  1QUU A;  4YJ3 E;  3ZN1 B;  4TX5 A;  3KFW X;  4FJO A;  5L3G B;  3JC6 D;  4X1I E;  5JDL A;  1MMD A;  4O2B E;  3V5S A;  5JR9 B;  3E08 A;  4IIJ E;  2LEH A;  2WMO A;  3AB3 B;  1FIO A;  4WBO A;  4OHF A;  2G0U A;  2D0T A;  3AA6 B;  4QX8 B;  2WM9 A;  4TN7 B;  2Y6X A;  5EK2 A;  4H9P C;  5KDM C;  1T98 A;  1BR4 A;  2ES0 A;  3PUA A;  4TV9 E;  5JDG A;  1OXZ A;  2DI4 A;  3IBP A;  2NW7 A;  2ZM0 A;  1MIW A;  3GN5 A;  4AKI A;  1UX4 A;  1BR1 A;  2YEV C;  4MFR A;  5ETW A;  3C50 A;  2A3D A;  5LP6 E;  1MND A;  4XAX B;  2X68 A;  5F3J A;  2KXP B;  4HEA A;  2E8I A;  3P7I A;  2V7K A;  4KUM B;  1LVF A;  2UXX B;  3CX6 B;  4QXH B;  3GN5 B;  5FY0 A;  3QUJ A;  3I9W A;  3UTK A;  3AA7 B;  3F2E A;  3PDY A;  4IDZ A;  3AA1 B;  3WI3 A;  3FHN A;  4MHC A;  3O4X E;  3OYX A;  2CM0 A;  4JEH B;  4IE0 A;  3N2O A;  3BQK A;  4IE4 A;  4GIW A;  2D2S A;  4DO0 A;  2NTX A;  3BQI A;  3BQL A;  3L3P A;  5A1L A;  1SHZ C;  1QSD A;  2JMH A;  2CWO A;  2X0L B;  3N9O A;  4YHJ A;  2YIN A;  4WBN E;  3ZC1 A;  1EZ3 A;  4UF0 A;  5E0O A;  4AI6 A;  1X79 A;  2QA7 A;  4H63 H;  4WNK A;  2MBG A;  5LHG B;  1HS7 A;  3LK4 2;  3NRX A;  4GK5 E;  2LSI A;  3CVR A;  5C8Y E;  4AQF A;  3P8C D;  3V5U A;  3I1A A;  2X9Y A;  4M1P A;  3J9X 1;  3RX6 A;  1BR0 A;  4P0A A;  2UXN B;  4ZHQ E;  3PUR A;  4GYR A;  3E0Z A;  4AKL A;  4I55 E;  3WAJ A;  4PW8 A;  4UF0 B;  2L9Q A;  3FXE B;  1G73 A;  4H63 V;  3KVB A;  4UVA B;  3ZMU B;  5HXH A;  1MNE A;  4ZI7 E;  5LG4 A;  1US7 B;  2XAG B;  4P09 A;  2E9X A;  1ZV4 X;  3OJA A;  3PUQ A;  3MA9 A;  3DJB A;  3K3O A;  3CX7 B;  4G2A A;  4IE7 A;  2EHO A;  2OA5 A;  3SWH A;  5L3F B;  5FNV E;  5L3E B;  3QK6 A;  3I0O A;  2A72 A;  5J2T E;  1WR6 A;  3RRW A;  4OFZ A;  1S94 A;  5LBQ B;  3C4W A;  5LCY A;  4A56 A;  2CA5 A;  3UUN A;  3CKD A;  3PTR B;  2E9X B;  1WRD A;  2NTY A;  3N9M A;  2D0U A;  4UEM A;  1AJ3 A;  2V7J A;  5HAX A;  2W61 A;  2EHO B;  2NW8 A;  2DHR A;  3D0T A;  3MKD A;  1CUN A;  5DJQ C;  4PFO A;  4QXB B;  2VB6 A;  3RRC A;  3LK3 B;  2IC6 A;  3LK2 B;  4PNI A;  5LYJ E;  2X9X A;  4ZOL E;  1D0X A;  4HN9 A;  3ZJ2 A;  5LGU B;  3PU8 A;  4HKA A;  2KMF A;  1D0Z A;  4DMW A;  1FMW A;  4U74 A;  2PG8 A;  3N2K E;  4L0R A;  2VKO A;  4K0U A;  1HG2 A;  2VK9 A;  3CX8 B;  4UVC B;  2ZMA A;  5FY7 A;  2XAQ B;  3IF8 B;  2I59 A;  5CA0 E;  3FB2 A;  3C51 A;  2HPJ A;  2XUE A;  2P9B A;  5JVD E;  3AVR A;  5HWY A;  2VKD A;  2YU1 A;  3RYH E;  1WLX A;  3KVA A;  5DAB A;  4IE6 A;  2JMK A;  2CXF A;  1MIY A;  3W15 B;  4PK4 A;  2X66 A;  5JH7 E;  2DCF A;  4XZC A;  1Y64 B;  2XAF B;  3HL6 A;  4XBF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...