2NWQA

Short chain dehydrogenase from pseudomonas aeruginosa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
249
structure length
229
Chain Sequence
SSTLFITGATSGFGEACARRFAEAGWSLVLTGRREERLQALAGELSAKTRVLPLTLDVRDRAAMSAAVDNLPEEFATLRGLINNAGLALGTDPAQSCDLDDWDTMVDTNIKGLLYSTRLLLPRLIAHGAGASIVNLGSVAGKWPYPGSHVYGGTKAFVEQFSLNLRCDLQGTGVRVTNLEPGLCEGAHPIQPEDIAETIFWIMNQPAHLNINSLEIMPVSQSWAGFAIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short chain dehydrogenase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Probable short-chain dehydrogenase
total genus 77
structure length 229
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nwqA01
2WSBA 2BKAA 5KKCA 1XR3A 1H9AA 2AQIA 1NHGA 4XEHA 3VZPA 3WWZA 5U9CA 3UH1A 4J2HA 3JQGB 4WLUA 2JL1A 1EUDA 1CEQA 3H9UA 3IAHA 1EVYA 3WYCA 2UVDA 3D5TA 2G5CA 3PFWO 1Q0LA 2VCYA 5L3ZA 4U0KA 4HNHA 4GVLA 2EERA 4UEKA 4DA9A 1VKOA 3WIEA 1A7KA 1XHLA 1GD1O 4UUNA 1I3NA 1GY8A 3QVSA 1XCBA 1ZMTA 1NQTA 4CM5A 1C1XA 1R0SA 3TZ6A 1C0LA 2J3JA 1Y9EA 3ON5A 1N7GA 1O94A 3FNGA 4R51A 4G81A 1B8VA 3OHSX 5KOIA 2C20A 3ANMA 1E0DA 2FPGA 1PJ3A 4ESOA 3O8QA 3UF0A 5U1PA 5C7LO 4EITA 2O3QA 3P7MA 1PX0A 3GGGA 3W8FA 4WECA 1X0VA 4XGIA 1I3KA 3ORFA 2HSDA 5EESA 2Y66A 3NV9A 5F1PA 1NPTO 1WVGA 1Z73A 1YDWA 4WNIA 4BNUA 3K2BA 4Q3NA 1NWCA 3AY6A 4TWRA 3GK3A 2Y1EA 4BO2A 2VT3A 4CUKA 2Q50A 2DTEA 1U2GA 3OJEA 4E6PA 3H6KA 1Y6JA 3FWZA 3UOGA 2C82A 1A5ZA 5EL0A 5A3JA 2EWMA 3ZW8A 2HKIA 3NJ4A 1BHSA 1WMAA 4WNCA 2WD8A 3EGOA 2AW5A 1JTVA 2CDBA 3E1KA 1WAMA 3VH3A 4JK3A 5HRUA 1PZGA 3TJRA 5JCJD 1VI2A 4J1NA 4HFJA 1LDYA 3WR5A 1GPDG 4PRKA 3O03A 3K31A 1HE2A 2EIHA 1LLCA 3D3WA 3FR7A 4JBHA 4XB1A 5EINA 4ND5A 5CEEA 2RBEA 4CM3A 2AXQA 1BW9A 4I08A 4RPHA 1DAOA 3OMLA 4QUKA 4CR6A 3U4DA 3UCEA 1H5QA 3BXXA 1LQTA 1E6UA 3E9QA 1WPQA 1GPJA 4B3IA 3LVFO 4PG7A 1OFGA 1UDBA 1XKQA 4FIZA 1LSSA 1X13A 4G5HA 4ILKA 4XKJA 4ALLA 3A9WA 1DDOA 1H2HA 4O63O 4E33A 4RVDA 4GAEA 1ZJYA 3JQ8A 1U1IA 4UREA 4ZU3A 2V6GA 3PJDA 4I5FA 4J2OA 4IIUA 4BKRA 5TC4A 4JX8A 1E3IA 5I7EA 4LK3A 4CQLA 3DZFA 4KUHA 2YHIA 2QHXA 4D0RA 3AW9A 3GPDG 4UUMA 3TSCA 3KYBA 2CY0A 1EVJA 1NNUA 3DQPA 3QIVA 4BO8A 4D43A 3RSHA 4PLWA 3GAFA 3V5NA 2JD2A 4N5MA 4XX0A 5DBIA 1I01A 3HE3A 5BSHA 3HHPA 2C59A 3FNEA 1LDGA 4PVDA 3L6DA 3ZN2A 1Z7EA 3ETEA 3JD3A 5JBIA 3GUYA 1NQAO 4NU6A 1FDTA 3ZZNA 2CVQA 4HFNA 2X9GA 2GR9A 2PH3A 3I9OA 3O26A 3G79A 5GY7A 4R68A 3K5PA 3QP9A 5ITVA 3AUSA 2WMDA 1K89A 4IY1A 3ZWMA 2CF6A 2PKQO 2JFGA 5DP1A 8LDHA 4FFRA 1H2BA 4TKLA 4EUHA 1H6AA 2G82A 3CSDA 2O3RA 2I5PO 2IRWA 4YT4A 3WICA 3FBTA 4XQCA 4D3SA 1V8BA 4H15A 2H63A 3JTMA 2IZ0A 2HMSA 1K6JA 5HWSA 3UN1A 3PP8A 4FOOA 4EBFA 4F45A 1YE3A 5A9SA 4BNYA 5COQA 2J3KA 2C5EA 4QFCA 4QQRA 3DOJA 1UJMA 1P1HA 5AXBA 3TRIA 1LLDA 1MFZA 2R6JA 4DPMA 4JLWA 4TROA 3H5AA 4CLOB 3U09A 1SOWA 3IP3A 4M54A 2IODA 2I6TA 3JD1A 3ROPA 4B3JA 3RU7A 3OA2A 2PV7A 5L51A 3WNVA 3TOZA 3DZBA 2GYYA 3FCOA 4J90A 3V2HA 2J8ZA 5CDUA 2CDCA 4QTZA 4N54A 2WE7A 1PGPA 5JY6A 3PYLA 4OJNA 2V7PA 3PZBA 1R16A 5L40A 2PD4A 2O3SA 1NTOA 5JO0A 1NVMB 1NAIA 2A35A 2B5WA 3JQEA 4YA6A 5HBRA 2JD1A 4ZICA 5GZ1A 3T4EA 5I7VA 4J4HA 3LLVA 1GYRA 4PLZA 1VPDA 3WGOA 2G76A 1E6EA 2AE2A 3EY4A 2DBRA 1N92A 3U62A 3ZU3A 3TF5A 5DN9A 4CLXA 1GCOA 1EQ2A 1YO6A 4MO2A 1E3WA 1GQQA 3PLRA 1N8KA 3NRCA 1ISGA 4H16A 5T67A 1GUFA 2NU6A 5KWEA 1AE1A 1P9LA 3BMOB 2B0JA 4WEOA 3UUWA 4RVUA 3S2IA 1V0JA 3DBHA 5IDWA 4FGSA 3WGZA 4FD3A 4J7CA 2X7HA 3X2FA 5HM8A 1KC3A 4H7PA 5JO9A 4I9NA 3BMNB 3VDRA 2IE0A 1QYDA 4HWKA 1A7AA 3G49A 4E4YA 6ADHA 5EN4A 3RUEA 1PGQA 4KUGA 4XR4A 4IDBA 2ZB7A 3RFXA 4K1LA 1UUFA 3OBBA 3RC9A 1ML3A 2BHLA 3KYCA 1H6BA 1E7WA 2ZQYA 3FSRA 3JQCA 4I5EA 3JQ9A 3O38A 1HDZA 4AJIA 3GNTA 2BLLA 1CRWG 1U2DA 4LSWA 5A06A 1EBFA 2DUUA 3EC7A 3VH4A 4OO3A 2GN4A 4E12A 2Y1OA 3NTOA 1GTMA 3HQ4O 4B7UA 4U6QA 1IUKA 3C3XA 4C7JA 4RZIA 4KDFA 3F3SA 3SLGA 2DFDA 2AE1A 3INGA 4FCCA 5BT9A 1UDAA 3OECA 3VZRA 2YJZA 1K3TA 2P4QA 4MKRA 2J3IA 1MP0A 4CM8B 1HF3A 1LSOA 1YL5A 2FSSA 3QVOA 4HBGA 4YT2A 2DU8A 5TJ9A 2VNAA 3GF4A 3U4IA 3V1TC 3Q3CA 3W8DA 4CQMA 2X23A 1JQBA 1PQWA 1OBFO 3DZGA 3EZYA 3KETA 1G0NA 3ADPA 5G4KA 4NQZA 4RPKA 1YONA 4CLOA 3GZNB 3UW3A 1EMDA 3WGTA 1U5CA 4MVJA 4FBGA 1SBYA 3N74A 4IDAA 1TT5A 3ZV6A 4R1NA 5TGDA 3JV7A 1O5IA 5DOZA 2IYPA 1PS0A 1CERA 1WP4A 3WX0A 4W9NA 4FFLA 1BXZA 3ETDA 3VKVA 1X0XA 4BIIA 4XDYA 3GHHA 3DTTA 2NVWA 2PGDA 2C7GA 4ZQBA 4OQYA 1DIRA 4DLAA 1GADO 4R5MA 5C7IO 1E7YA 2V65A 4IMPA 3PJEA 3CMCO 4J0FA 4KQWA 4O1MA 4DTIA 3A1NA 3GEMA 4FFNA 3KSZO 4AJ2A 3RWBA 4CR7A 3TZHA 1OMOA 5MGBA 3ST7A 3UVEA 3RUAA 3CEAA 2NACA 4MVJE 2C0CA 1J6UA 2WD7A 3QHAA 5THQA 4YAKA 5A4DA 5JDIA 1N1GA 1XDWA 1DIBA 2HJRA 3T7CA 1VSUA 3ABIA 3BHJA 1Q7CA 4Q3DA 2HU2A 3GAZA 1AUPA 3H4VA 3LT1A 3NKLA 1V3VA 3V2UA 3ZNNA 3UGKA 5AYVA 1V3UA 4RVHA 2PR2A 3Q9UA 3VPHA 1TB4A 2PZMA 3QE3A 4WK6A 1JKIA 2DTDA 2HMTA 3E5RA 2D4AA 1Z7BA 3U3XA 1U4SA 1W6UA 2QRKA 4CPDA 4ZJUA 1E1LA 2OGUA 4NDNE 1FDUA 2GZ3A 2X0NA 1K6XA 1A9YA 2BF7A 3ENKA 3GOHA 3RJ9A 2E4AA 4J0EA 3RJ5A 5EQFA 5HS6A 3KO8A 1GL3A 4B4OA 4BO9A 3Q2IA 3OFSA 7MDHA 4MOWA 3KLMX 1EDZA 2W2KA 1QXSA 5FWNA 2EXXA 1ZSNA 5COAA 1B15A 4M1QA 1ORRA 2QZZA 2D3TA 2DQ4A 3RBVA 4ALNA 1GU7A 2B35A 4B79A 1T2DA 5U4QA 4O6VA 3ZWWA 1QYXA 5COBA 1BW9B 1A27A 2O3TA 2ZTVA 3FNHA 3AM5A 3PJGA 2EV9A 1P1KA 4JIGA 2EJVA 2BD0A 3D1LA 5ICSA 2POQX 1DJQA 2PWZA 4XZ3A 1EDOA 3ASVA 3E48A 2FZEA 3ZHXA 4TZTA 2HRBA 4OHUA 3TDKA 3C24A 4AJ4A 3WGIA 4NPCA 4DUPA 4CQMD 2J5KA 5DBFA 1JWAB 1I8TA 3B6ZA 4YJHA 3IKTA 1B3BA 3TWOA 1JDJA 3UAGA 1IL0A 1X7DA 2G0TA 3W8EA 6LDHA 2Y93A 3OIGA 5JAQA 1R6DA 5LC1A 4BNVA 4F46A 1YB1A 3PK0A 4CUZA 1O95A 4M8SA 5LDGA 1ISFA 1KBZA 4OYRA 1SB8A 4FQ8A 4NBWA 4XDZA 3WMXA 2X0RA 3AOEA 3CZMA 3VAZA 4HFRA 4Q3EA 4D41A 5B1YA 2OP0A 1U5AA 3GN2A 1H6CA 2EKPA 4DRYA 2ET6A 1PGJA 2BI7A 2XOXA 3BYZA 1NM5A 4ND1A 2EW2A 4BNHA 3ONDA 4KUEA 3I9LA 4WPGA 3JYQA 5KTKA 2CDAA 1CIVA 1LSUA 3DEYX 5KKAA 7ADHA 3BMQA 3GDGA 2I9PA 3C1TA 1FDWA 2D59A 3UKOA 2Q3EA 4J49A 4YJGB 1NR1A 1JU9A 1O89A 1SB9A 1BVRA 3H2ZA 4RQUA 4GX0A 1BXGB 2Y0DA 1H9BA 1E92A 1PJBA 3HDYA 3ZWPA 1HDXA 3I9NA 1VLLA 3WQSB 5CEFA 3ZWYA 4D44A 4BB6A 1HDGO 1QG6A 1C1DB 2F00A 4CM6A 1VJTA 2ZCUA 1HE4A 3L9WA 2DBQA 3G0OA 4CM4A 5A9SB 1IOLA 3WTBA 1H94A 1X7GA 4J1SA 1QR6A 3JQ8B 2PH5A 4JJFA 1IPFA 3DBLA 4DMMA 2QRJA 3SX2A 3ZWBA 3M1LA 1HEUA 4W4TA 3W1VA 1FK8A 2JFFA 2VUUA 5CP8A 3V2GA 4CQLB 2GZ2A 4TZKA 3V1UA 1HTBA 1KVUA 3KRTA 3QV1A 5ER9A 3WTCA 2PA3A 1HDRA 4MIEA 4Y98A 2ZYDA 5G0TA 2HMWA 3H8VA 4UVDA 4WEQA 5DNAA 3A28A 3D4PA 5KVQA 5IXYA 1LRKA 4ZQEA 1ISHA 1YDEA 4BS9A 1GFSA 4PLGA 5B4VA 2VTEA 1Y8QA 1I10A 4GLLA 1P77A 3WDSA 4NJMA 3ZU4A 1Q0HA 3RUFA 1CQJA 5AXCA 5HTOA 3OQ6A 1KVSA 4JBIA 2YYYA 2YV1A 4FFMA 5I8ZA 5ILGA 1YVEI 4NIMA 4IZHA 2XF8A 1PJCA 3K9QO 4MP8A 2GN6A 1C14A 1P0FA 3ANLA 4FPXA 3IUPA 3LK7A 3OEYA 5TJHA 2R00A 3DBHB 3I5MA 1YWGO 1SO8A 5BNIA 4N5LA 1U4OA 1TLTA 4BKOA 1NPYA 4YRDA 2AQKA 4WOJA 3PRJA 3AU8A 3KHUA 3QLJA 5A1TA 3WGYA 1MV8A 3QWHA 3F5SA 4LVCA 4N5NA 1Y5RA 2OHXA 2X22A 4N18A 2NVUB 5JW6A 2YDXA 3QWAA 3TZKA 1M6WA 2VWGA 4FW8A 3TZQA 1WLYA 4EEXA 3E82A 4PLFA 1NASA 2P9GA 1YB5A 4YAGA 2C54A 4EYEA 4ID9A 2QYTA 5JSFA 5DDIP 4GX5A 3RI3A 1ZEMA 3S2FA 3GR6A 1I33A 4YJFB 1DRVA 2E6UX 1ZSYA 4A7PA 4C7KA 4HADA 4Z0PA 2YDYA 2D5CA 3MTJA 3CUKA 3IC5A 3DZHA 4CMIA 1S7CA 3PWSA 4JBGA 3WBFA 4MINA 4PG4A 4U7WA 3TZCA 3ZNOA 1IULA 3ITKA 1IZ9A 4BB5A 4IGEA 1ZSVA 4ITUA 1LDMA 1FDSA 2GERA 1R12A 1PZEA 4CM1A 4CV1A 2NTJA 1E3WB 5L9AA 4L8VA 5TT1A 4ZN6A 3Q0EA 4L73A 5JC8A 1U7TA 3JCZA 4RF2A 4Z3DA 5HA5A 4BQRA 1HSOA 3QWFA 1U28A 3PYMA 3WB9A 2HAEA 2ZJ0A 3L6EA 5JC1A 5GMOA 4G65A 3WQRA 5KJCA 3OICA 2JCXA 3K8ZA 3KVOA 3A06A 4BOYA 4K6FA 3H3FA 5DULA 4BNKA 1LI4A 2UYYA 3TN7A 1PJTA 5KJFA 5L53A 3KV3O 2VHXA 3PI7A 2D8AA 2YQ5A 4E5YA 1UXKA 3ZI0A 3VTZA 5C7OO 1P44A 3PIIA 3TNLA 3VH1A 1MUUA 2WYVA 3BTVA 2W8ZA 5A05A 1NVTA 4MVJI 4AICA 3M1AA 1YBAA 4MVJD 2XXBA 4TRJA 1LXCA 3GC6A 3MZ0A 3CPSA 1HRDA 4P22A 1CF2O 3LC2O 1HYHA 4BNGA 1U3UA 1J49A 2ZYGA 1F8GA 4Z6KA 1HT0A 2QW8A 2ZTMA 1UZLA 4IXWA 1H0KA 4BNNA 4Y9DA 4EJ0A 4AJEA 1WW8A 1ZEJA 3ZGYA 4CV0A 5IXSA 4Y6PA 3GVIA 3DONA 1TT7A 3I1JA 3LDHA 4RORA 3CIFA 1ONNA 4PGFA 4BO6A 3ITDA 4DBVO 2VHWA 4DQVA 4D3FA 3UHAA 2B36A 3G3EA 4M55A 1YL7A 9LDBA 4A73A 3SJUA 1Z6ZA 1PWXA 1SC6A 5IN4A 2PKQP 3C7CB 1WWKA 2C2YA 5ENDA 4BO4A 4NFSA 2YFQA 4LN1A 3I4FA 4II2A 5K6AC 3CINA 2VWHA 4ZGWA 1D1SA 2HK8A 3VZSA 5THKA 2CZCA 2ZTLA 4PLTA 1IHXA 1GZ4A 1MC5A 4RGBA 1MA0A 3IDSA 5CDTA 2WTBA 2W2KB 1HLDA 3RUDA 3ZWAA 2HQ1A 1YRLA 2JAHA 2YZ7A 4IDGA 4LCJA 5EPOA 1ISIA 2B5VA 2X58A 3FD8A 3INTA 1R15A 4R5HA 1OZAA 1CDOA 5G0WA 3RC2A 1RJWA 3PEFA 4YAIA 2TMDA 1LQUA 1B8UA 2FSVA 1KY5A 4S1VA 1BDBA 3BHIA 2ZJ1A 3ETGA 3ICCA 3I23A 1N1EA 1YOVB 3I6IA 3NDJA 4C4OA 1PJ4A 1SAYA 3EW7A 4GX1A 1O8CA 1I2BA 4L76A 4IQGA 2YFHA 1CQIA 3H9QA 4MIOA 4GKBA 5G0UA 1KEUA 3WOHA 2ZQZA 2EP5A 1LC3A 1PU2A 1XEAA 1JW9B 2ZB8A 2GD1O 4CLDA 4BGVA 5ENVA 3V8BA 3M6IA 4K26A 5F21A 4GGOA 1ARZA 1RKXA 3PLNA 4HX5A 4KDEA 5CHEA 3GRPA 4WUVA 3NT5A 3AY3A 1LEHA 4J1TA 1Y8RB 1N9GB 1DRWA 4F6LA 4I9HA 4A10A 1ZK1A 1L1FA 3D64A 1P1RA 4XQEA 4E5KA 4E0BA 4BNFA 1BXGA 4XGNA 2B4QA 5KNLA 5IZCA 3DMTC 5CEJA 4JN6B 1E77A 5I7FA 4J91A 4WCFB 5G2OA 4ALKA 2VRCA 1SEVA 1C1DA 3AFMA 3WJ7A 4E2WA 3AI1A 3VTFA 1E3SA 3HB5X 1HXHA 5TT0A 1NX6A 3NDIA 4INAA 4FFPA 4CLEA 4XJSA 4JP3A 4M89A 3ZNQA 1FMCA 1UR5A 1JWBB 3RC7A 2IEDA 3PQEA 1SNYA 3MTGA 3MWDB 4RL6A 4OQZA 2BI8A 3L4BC 3MCVA 3H9EO 3AI3A 2QZ9A 2DTXA 1QYCA 3NDRA 4BO5A 4PLHA 1DXYA 2V6BA 4RVSA 2NVBA 1HZJA 4TSKA 2VOEA 3NEPX 4XYGA 1LRJA 2PGJA 1JVBA 3DBRA 3MOIA 4DGSA 2C29D 4BHTA 3QY9A 1B7GO 1LJ8A 4MVJH 1GV0A 2FPPA 3PQDA 3W4KA 4NBTA 4E31A 2O23A 1XU9A 2WWRA 2AG5A 2AQHA 2A9FA 3LT4A 1IZ0A 3JQFA 1R37A 2JCYA 2EG9A 3ZH2A 1BXKA 2Z1NA 1C0IA 2NSDA 1WDLA 4JJIA 1ZXBA 2GDZA 3F1LA 4E21A 1R4MA 3QVTA 1GCUA 3DFZA 1KVRA 5KJ1A 4HXYA 1GUZA 4Q9NA 4R69A 3LZ6A 4FC7A 1IB6A 1ZVMA 3QWBA 5AXDA 1UH5A 1F8FA 4G2NA 1F14A 2GCGA 4Z9YA 1Y1PA 5F1OA 5KCZA 4KWIA 1UDCA 4D45A 5FFFA 2CVZA 1PTJA 1Y8RA 2RHCA 4FFOA 3JYOA 4IJKA 2G17A 4YAJA 5AOVA 5C37A 4QXMA 4TRNA 4XA8A 1ENZA 4CMAA 5EIOA 4BGUA 4AJPA 2FPIA 2Y1GA 2X5OA 1ZK3A 3FWNA 4EUEA 1JLLA 3U5TA 1DHTA 1RYDA 2Y0CA 5JCJA 1A4IA 5T5QA 2OO5A 4CV3A 4D7AA 2VHYA 2IXBA 3I6QA 4OXKA 4XD2A 4BV9A 4TMFA 4UVEA 4O0LA 4GMGA 3IMFA 4MP6A 1DBVO 3P2OA 3KYDA 5G0VA 3STHA 2EKQA 3NTRA 2NM0A 4K28A 3W6UA 5L4SA 1ZFNA 3GT0A 1NQ5A 5L7TA 4LRTB 2VTDA 3O9ZA 2Z5LA 3ASUA 1B14A 2Y68A 2IEBA 5IFLA 1W4ZA 1T1SA 5ILOA 2O2SA 4XWYA 4AVYA 2XAAA 1J0XO 2AA3A 1PJ2A 1TVEA 3D5QA 4WLVA 5IJZA 3QVWA 1C0KA 1N2SA 1Y8QB 2PTGA 1DRUA 4D42A 4E30A 1M6HA 1QP8A 5ER6A 1QORA 3HG7A 5AXAA 3ZCXA 1HSZA 2PZJA 2NU7A 1DPGA 1DC5A 4AJ1A 1XLTA 1ZW1A 3HFGA 3JSAA 3VPGA 2JAPA 1V3TA 1D7OA 3D7LA 3ZU2A 2EHDA 4CM7A 3HZZA 2V6FA 3KEQA 2IYOA 5A03A 5B37A 2UUPA 4BV8A 4J43A 3X2EA 3IQDB 4AJLA 1PL6A 1EUZA 2Q49A 2FR8A 1BDMA 4JGBA 2JKVA 1AGNA 2B37A 2VYVD 4GX2A 5B12A 3HWRA 3Q9NA 2E82A 2WDZA 1E5QA 2P9CA 5K0ZA 3BMQB 3JQAB 2BMAA 3VH2A 2VHVA 1P0CA 3DZKA 3PZRA 5GZ3A 3IS3A 3MWEB 1SOVA 2J3HA 5T8KC 3ZU5A 4DWVA 5J23A 4MVJF 1E1NA 1Y7TA 4FB5A 5CFZA 2X5JO 2R00C 3C1OA 4L4RA 3DXFA 1ZIDA 1T2CA 1LX6A 3ENNA 9LDTA 3I3OA 4AJOA 3I52A 5FEUA 1O0SA 1P31A 2NV6A 3C1AA 4XYEA 1KETA 2VWPA 3C7AA 2RAFA 4ND3A 1ULSA 5JLAA 3AUUA 3DB2A 4QO7A 1UP4A 4LCEA 3LYLA 5FYDA 1F12A 1Q2XA 1LSJA 4CMIB 3QW2A 3NTQA 3ZWOA 1GAEO 2EJWA 4WE3A 1SCUA 2X5KO 3NGXA 3WMWA 2OXIA 3WSWA 1LLQA 4CMEA 4HV4A 3R1IA 4NI5A 4TKMA 4BNXA 4BGIA 1MXHA 1QV6A 1ADGA 3WNQA 2VYND 3AU9A 1FF9A 2FR0A 1DC3A 4QEDA 2I76A 5CPBA 4I1IA 1VJ1A 3ONFA 1QSGA 3DAGA 4YTEA 2B4TO 3E9NA 5KVCA 3EUWA 2OL4A 1YL6A 2OP1A 4FJ2A 2D2IA 3WYBA 4P8RA 5BR7A 3FBGA 1PJLA 3ZV4A 3HSKA 4YJDA 1IPEA 4HNGA 3TL2A 5AQ1A 4E32A 1QKIA 5JDIC 2GNAA 4WLEA 2BELA 5HS4A 1E1KA 4FS3A 1GQ2A 1RYEA 4XR9A 4A0SA 4B8ZA 3GNQA 3MOGA 4W7IA 2VZ8A 2DM6A 1DIHA 3QA9A 3LSYA 5JYEA 4RPGA 3PFFA 3PTZA 4N7RA 1FDVA 4B7XA 1OC4A 2HMVA 1DIGA 4OIMA 2DPHA 2YV2A 4LRSB 3ZNPA 3RIHA 2Y1CA 1X15A 1ZCJA 3GEDA 3E9MA 4H3VA 4AJNA 1Z75A 1JKJA 2Q1TA 3F6YA 2J6IA 2NVUA 2PNFA 3IP1A 3RD5A 1YXMA 2W2LA 4X54A 5I9NA 2GUGA 3EAGA 1KVQA 3DHNA 3GMDA 5I9LA 2O2YA 1BG6A 3F9IA 4GLOA 5TF4A 3H5NA 1Y5MA 1KS9A 1LLUA 3DDNA 5L45A 2C7VA 2JD0A 1D4FA 4R3NA 2ZTUA 4IJUA 4CJXA 2X86A 4YR9A 1E3EA 2D0IA 3MJVA 1J5PA 1MXFA 2P5UA 4F3YA 1GUYA 2W90A 4D46A 4L75A 1ZZEA 4LSMA 4UEJA 4LW8A 1ZXLA 1QYVA 1C1XB 4NR0A 1O6ZA 2NQTA 3GPIA 2B69A 3RU9A 3FF4A 1LUAA 1N5DA 2I3GA 3AK4A 2P68A 2Q1WA 1CETA 2YUTA 4W99A 1QRRA 4MDHA 3JD0A 2X9NA 2ZATA 5CDSA 4UULA 1ISJA 2RIRA 4FOSA 3IOYA 2Z95A 5G0SA 1SZJG 1Q0QA 5I8WA 2BGKA 4L4SA 4JROA 4L9RA 1GZ3A 1B8PA 3OJLA 4E2XA 1I3LA 3FN4A 3LQFA 3FPCA 1A72A 2VYVA 2EP7A 4CLRB 3COSA 1M67A 2DPGA 4BMSA 3E18A 4Z9XA 1XIVA 3F4LA 4XB2A 4CL8A 4P4LA 1W0CA 4TVOA 4CR8A 2OBYA 4NBVA 4B3HA 2B4RO 2CSUA 1ULUA 4ZRNA 1ADBA 1VC2A 1CJCA 1P33A 2GF2A 3DOCA 4CL3A 3D0OA 3DHYA 3KUXA 1UXJA 3H65A 4ZA2A 3DZIA 4KP7A 3OIFA 2IZZA 4UVHA 1U8FO 5JMWA 2I99A 3RUIA 2VOJA 4J6FA 4DIFA 1LBEA 1EE2A 2E37A 3JYLA 4RVFA 3BMNA 5JE8A 4AG3A 3B1JA 2YHUA 3EK2A 5T8KA 2BH9A 2HJSA 3PJFA 3OEWA 1MB4A 4S3MA 2NU9A 4DYDA 4J4BA 5H83A 2NUAA 3ZW9A 4J7XA 5A3VA 1JN0A 1T4BA 4E5PA 2H5LA 4NU5A 1B16A 3LU1A 4D0SA 4W6ZA 3QVXA 3W4JA 1EK5A 1JA9A 4II3A 2NADA 1NBOA 4BGEA 4NK4A 4HKTA 3KEOA 3DBVO 3SXPA 3UICA 1XU7A 5LCXA 4IDDA 5TQVA 3PDUA 1AXGA 1EVZA 2WEKA 4W9NC 2ZKLA 2A4KA 5B4TA 2FHSA 3S8MA 3PHGA 4PIVA 3KLPX 4RLSA 1Q7GA 4DIOA 3OQBA 1LDEA 1B2LA 2NU8A 3JYNA 5BQFA 4OM8A 4LGVA 4KWHA 2LDBA 2PKRA 3AFNA 1EK6A 4GPD1 5AVOA 3G1TA 2AEMA 1E7MA 2H6EA 2VUTA 1PIWA 1G1AA 3GFBA 4QECA 1QYWA 3RASA 2NQ8A 1QV7A 3GZ4A 4BO1A 1E6WA 3GMSA 1P1IA 2FZWA 3ZHYA 3DFUA 2PD6A 1KOLA 2DUWA 3S55A 3E5MA 5BNTA 1DIAA 1GV1A 4YRAA 1UAGA 5ES3A 5L95A 2H9IA 4PZCA 4GL4A 4WGGA 1WDMA 2OMEA 2VHZA 4IJVA 4J16A 1U9JA 4J4TA 5EERA 3BHMA 4CM9A 1M66A 3ONEA 4PG6A 3KBOA 3GGOA 5DCUA 4DBZA 3UFXA 1ADCA 4BNTA 3ANNA 3FTPA 3H9GA 4QT0A 2I67A 1GR0A 5F5LA 2DT5A 3M2PA 3KYDB 5TSDA 5KJ6A 4LVUA 3HDJA 1V35A 3INRA 1PJQA 3NYWA 3TQHA 3CTMA 4JQCA 1PZHA 3WG9A 2GZ1A 4Z9FA 3AY7A 3PQFA 3UCXA 1YB4A 4B4UA 1RPNA 4EJ6A 1RM5A 1X7HA 5ITWA 3MJTA 4YDRA 1FXSA 1H6DA 3OIDA 4XIJA 1EFKA 3L9XA 4PZEA 1YH3A 2Y99A 3K92A 4WCFC 3E8XA 3ROMA 4TRMA 1P1JA 2GLXA 1JKFA 3BZUA 4GWGA 3Q1LA 4IDCA 1UZMA 2QG4A 4Z0TA 3UCFA 3TPCA 2X9VA 3F47A 3T4XA 4YXFA 2X8LA 1AN9A 1U7HA 2NWQA 2GASA 1KC1A 2P9EA 1MFPA 1E5LA 4IDEA 3K6JA 5CG2A 1YQGA 2W98A 2ZB4A 1ZMOA 2E49A 4CMEC 4P4NA 1T4DA 5I7SA 5JYDA 4JJGA 4OXNA 3NT2A 5BNFA 1F17A 5G4LA 1AXEA 4YJHB 2ILTA 2VZ9A 4R4JA 1ZBQA 4IXTA 4HUJA 1RM0A 3TFOA 2X6TA 1DFHA 2EKLA 4XCVA 4XRRA 2V6MA 3BMCA 4NK5A 1T1RA 3IKVA 3N58A 3G17A 4KTVE 4W7HA 4BMNA 3QWIA 4WJZA 4BNLA 4MPDA 4MJLA 4GWKA 3JQDA 3CMMA 3B1KA 4E13A 2C5AA 2X4GA 1I0ZA 1R0KA 3N7UA 1B3RA 5A02A 1KEPA 1ENPA 5B4UA 1KYQA 2YY7A 2X1HA 3HN2A 4YVFA 4FJ1A 2AG8A 3F46A 4D79A 4O5OA 4CM4B 2C07A 2PY6A 2A92A 1SMKA 3LT2A 3U9LA 3MEQA 2O4UX 4GBJA 3JQAD 4NG5A 3L6OO 1DLJA 1LRLA 4AJJA 1EZ4A 3C7DB 3F5QA 3ROQA 4AJHA 1J4AA 3PWKA 1DHRA 4IM7A 5A9TA 2I65A 4BQPA 4JP2A 3GUCA 2CNBA 3OJFA 2UDPA 5EQDA 4ALJA 1I36A 4YCAA 4A26A 3HB4X 4PN3A 4GH5A 2GO1A 3RUCA 1HE3A 2HLPA 3BMOA 5L4LA 3PHJA 3C8MA 3DBLB 1OOEA 4QX6A 5F1KA 4DIBA 1NR7A 2G1UA 5FI3A 5ICMA 4DYVA 3OM9A 2QQ5A 2AHRA 4BKQA 4BNIA 1S6YA 4IQ0A 3SLKA 3WFJA 4WOKA 3UXYA 2BFMA 3WLFA 1R66A 3GVCA 2B83A 3KOUA 1F0YA 1NFRA 1DC6A 2BGMA 4MKZA 4QFDA 3L77A 4RZHA 5IDYA 3T7EA 4NNJA 4A2CA 1NPDA 1F06A 4FR5A 1T24A 4XJTA 1MGOA 5IZ4A 5TS3A 1TI7A 4L74A 1HL3A 4P4GA 1VL8A 1R4NB 2HMUA 1P74A 3WBBA 4YBZA 2WYUA 1OI7A 3KM0A 5MDHA 4IUYA 1IE3A 4KQXA 4NJOA 3LLSA 1U3WA 4RF4A 4U6SA 1WDKA 5JAIA 1PGOA 4R9RA 4PG8A 1I32A 4QO8A 2Q46A 3PGXA 3S2GA 5IF3A 1ZUD1 2CVOA 1WZIA 4RQTA 2IXAA 4EDFA 2GN8A 3QJ5A 4XGKA 1NYTA 3AM3A 3D4NA 5JAZA 3JD2A 4MIYA 2D1YA 1BGVA 4FC6A 5EMHA 2HK7A 4CODB 4EJMA 1VM6A 3KB6A 4IMRA 4ND4A 3K96A 1VL6A 3NUGA 3GVHA 2NLOA 5CDGA 3EZLA 2HDHA 4R1TA 5G4KB 4RCVA 3FPLA 1NVGA 4OH1A 3R3SA 1KIFA 1ZK4A 1I30A 1PSDA 2FWMX 3H7AA 3PHIA 4OOEA 1L7DA 2DBZA 3GN1A 2BGLA 4CMGA 3VPFA 3AUTA 5F5NA 1X1EA 3K73O 2O50A 2FN7A 3BIOA 4FDAA 4DXHA 1O9BA 1AHHA 4OMUA 4GSLA 4YACA 5JMPA 2PK3A 4DPKA 1EQUA 1E7SA 4PLPA 4GQAA 2LDXA 1CYDA 1VL0A 5TX7A 1I3MA 3RUHA 3I9JA 3Q11A 4AL4A 4UUPA 1P45A 2H1SA 1UP7A 4Q3AA 4NFHA 3RCBA 1XQ6A 3TOXA 1LA2A 3SC6A 2EW8A 5JPIA 5DCWA 3CH6A 1HWYA 1NHWA 3ZV3A 2DBVO 2VQ3A 4ZD6A 4JNKA 5A5FA 1UAYA 4BL5A 3NX4A 2QYSA 4PLCA 3CXRA 1VKNA 1E3JA 1HDOA 5JAMA 4TQGA 4EI2A 4Y67A 3R0IA 4J9VA 3RAJA 4AFNA 4EZBA 1QLJA 1GDHA 4E2YA 3RROA 3ADOA 3KSUA 4HY3A 5JDCA 3AOGA 3A14A 2RCYA 1D3AA 3KTDA 4YYZA 4KMSA 1C0PA 2PZKA 3WJAA 1NFFA 4Y6SA 4ND2A 1PR9A 2FR1A 1WMBA 1HYGA 4Y6RA 3OQ1A 1R4NA 3RFVA 4XQGA 3AI2A 3DOOA 2YQ4A 4BNWA 1MG5A 4WLOA 1YGYA 3NGLA 5IDXA 5CAEA 3WGGA 2W4QA 4L4XA 2QX7A 3HDHA 1YS4A 4EGFA 2GPTA 1H93A 4NHEA 1A9ZA 1HZZA 2WM3A 3D3EA 3DMTA 2RH4A 1PZFA 3F1KA 3FI9A 4IS3A 1PJSA 4OKNA 1YJQA 2E48A 5TRTA 3WIDA 3H9JA 3B20A 4UEOA 5F3RA 4NFYA 1IYZA 3JQ7A 4UVIA 3ZWVA 1WNTA 3QSGA 3WYEA 4B8WA 3OH8A 2J5RA 4L0QA 3MJ4A 2VWQA 5IN5A 2AQ8A 5KVSA 3SVTA 1HE5A 3EYWA 3NT4A 3ZHBA 4Z0HO 1YQDA 1QMGA 3NJ8A 3P5SA 4YJFA 3O4RA 2BRUA 4CM9D 3GH3A 4XIYA 3SBOA 3SJ7A 2Q45A 3I4CA 4CLHA 4ZQFA 2FMUA 2O3UA 3DHEA 4YPOA 3GEGA 3ZDFA 2JJYA 4MP3A 3SEFA 3VKUA 1NFQA 2PD3A 5TNXA 4YWJA 5A04A 2OOSA 3GDOA 1T25A 1XG5A 1X1TA 2GRAA 5EJ2A 2FRDA 3MJEA 5ADHA 4BO3A 1ENOA 4DPLA 4FJ0A 2ZCVA 1HLPA 2F1KA 3BTSA 4OXYA 1PL7A 3WGHA 4BKPA 3GQVA 4ALIA 1LU9A 3AM4A 3BTOA 4IZIA 4J3FA 2C2XA 4GKVA 4YB8A 4F6CA 4WLFA 3PVZA 4TVBA 3OJOA 4DQUA 4DVJA 4RVGA 4Q3BA 4R3WA 1RM4A 5FF9A 5T57A 3TL3A 1I5RA 5LDHA 2Q4EA 1GZ6A 1Q7BA 5H82A 3KXDA 4YEDA 2VUSA 4D3DA 5K6AA 5L4NA 5JS6A 1YOVA 5DCYA 4ZRMA 4R41A 4E2ZA 5DP2A 3JQFC 1RM3A 1BWSA 3JQBA 3GRKA 3I83A 4OOFA 1Q1NA 2YW9A 2DKNA 1AHIA 2JCVA 4PLYA 3CE6A 4PCVA 4UAGA 4EUFA 2CF5A 2RHRA 1K2WA 2OBNA 4IQ8A 2Q2VA 4TRRA 3RKUA 3VVBA 3EMKA 1LNQA 1N7HA 4MVJM 4K9DA 3EDMA 4E3ZA 2QRLA 4I5DA 3I9KA 1R0LA 1K5HA 4IIVA 5FI5A 4IS2A 3OETA 3QRWA 4ALMA 3BA1A 2GN9A 3P19A 3GVXA 3W6ZA 3F4BA 2O7QA 4IGFA 1D1TA 1Y9AA 1B0AA 5BSFA 3AOEC 2QIOA 1DAPA 2DLDA 4RO0A 3R6DA 3FRJA 3RC1A 4E5NA 1T26A 1K0UA 1NP3A 1T2EA 1LDBA 3PXXA 3ZWNA 1XWFA 3LF1A 5IZCC 1NAHA 4E5MA 2BFAA 1KERA 1EEHA 3BAZA 5L7WA 1M76A 1P1FA 4Q3CA 5BSEA 3AJRA 3IJRA 5K9ZA 1UXIA 5C5IA 2VN8A 5I9MA 5JXWA 2I66A 3RQSA 4CMHA 3P2YA 2Y1FA 4I8XA 1I2ZA 1BVUA 3HDQA 2VNSA 4OL9A 2PFGA 1WXDA 3PYXA 5T64A 4Z3KA 2BFOA 3U4CA 3HFSA 4CMCA 1KEWA 3GG9A 4Q39A 3IL2A 1UZNA 3DBRB 1U3TA 3FHLA 3L4SO 1XA0A 4RJTA 1R4MB 2DC1A 4NJMB 4MVJG 3WSVA 3DAFA 3GA0A 3U49A 3WLEA 4KTTE 2FP4A 3W4IA 1JAXA 3GGPA 5TLSA 4HP8A 1GEGA 1ZO8A 1XSEA 4B7CA 4B4VA 3BMCB 2FOIA 3IIEA 5TIIA 2WE8A 1Z82A 2EGGA 1MG0A 1PQUA 3WFIA 4GI2A 1SPXA 2Y0EA 1YQXA 2Q4BA 2FY8A 4XYLA 5CG1A 1X14A 3DTYA 3L07A 5T6BA 2GSDA 4YAEA 1ZKMA 3G1UA 2PGLA 4J9UE 3WWYA 4NBUA 1EE9A 1ONOA 2VRBA 1HETA 4YQYA 4YT5A 1YJ8A 4QSMA 1B26A 1FJHA 5DBGA 2UV8A 3JQBC 2HUNA 2XPCA 3DO5A 1MLDA 5A5EA 4I5GA 3GY0A 3IJPA 1L7EA 1UXGA 1OC2A 1U8XX 1ADFA 2R2GA 3Q6IA 2Q1UA 4RPLA 4W82A 4HFMA 1HKUA 4CV2A 3KSDO 5IAAA 4DL9A 1YBMA 1LTHR 1DSSG 1I24A 3WS7A 1ISMA 4XRGA 3U4HA 3GFGA 3AWDA 4DC1A 4ZHSA 4YRBA 3WQQA 3PWZA 4Y8VA 4MKXA 1BRMA 2P5YA 1V9LA 4RV9A 2J5QA 4OGWA 4CMBA 2RH8A 3U0BA 4OKIA 5DF1A 2NTVA 4UVGA 3EHEA 1M75A 3VDQA 3DWFA 3OA0A 4DQXA 4CMKA 4BNJA 3FNFA 2D5AA 2YHIB 1DLIA 1ID1A 4R1SA 4RF3A 3PGJA 3VPSA 1U3VA 1BSVA 1TA4A 1EUCA 2Z1MA 5IG2A 3L0DA 3VZQA 2Q1SA 2VYNA 4YQZA 1HDCA 2EF1A 1EBUA 2DAPA 4OSOA 1DFGA 1UP6A 4CUJA 1P3DA 2P4HX 3GHYA 4BNZA 4M86A 4BUCA 1ZNQO 2HRZA 1EFLA 4ZVVA 4CMJA 3K30A 2JFHA 2OZPA 1NWHA 1DOHA 3JQAA 2ZB3A 1N9GA 1OAAA 2Y1DA 3FTNA 4PLVA 1PS8A 1ZK0A 3A4VA 4MVJP 2OORA 4NZ9A 5L7YA 1PEDA 1DFIA 2DVMA 1NXQA 3KYCB 2DFVA 2WYWA 1G6KA 4GMFA 2HK9A 1Y81A 2NTNA 2O4CA 1T2AA 2Q2QA 1E1MA 2CFCA 3DMYA 1PWZA 3HADA 4IBOA 3L4BA 3JQ9C 1XGKA 4DMLA 1W73A 4KOAA 4M49A 3MJCA 4R9SA 1DC4A 1PS9A 2BFPA 4GSKA 3S2EA 1MX3A 1IY8A 3D3WB 4FGWA 4CM8A 4A5OA 5A9RA 1DB3A 3JD4A 4RDHA 4U0JA 5JDCC 3RBZA 4DREA 1VE9A 1E7RA 3E03A 1KY4A 3LF2A 4LISA 2SCUA 4XYBA 4U5QA 1VSVA 4WKGA 3CZRA 3GZNA 1G0OA 2CD9A 1Z74A 4PRLA 3K2EA 1E3LA 4B4WA 2YV3A 1SEPA 2A94A 1TT5B 1TXGA 1DEHA 4XYMA 1ZJZA 3VOSA 1NQOA 4RF5A 4WASA 3I9MA 4PG5A 1A4UA 3HJAA 5DT9A 1GYQA 5KVVA 3B70A 5KJEA 3ULKA 3ZV5A 3NAQA 2JHFA 2X0JA 3ZWCA 1D8AA 2P2SA 2AEJA 4J7UA 4J1QA 1YBVA 1LC0A 3E6AA 4PFJA 4OSPA 1MC4A 2VZ0A 3JYPA 3PDJA 4WLNA 2EGHA 4URFA 2ZIZA 1E7QA 3C85A 5BSGA 4NMHA 1I2CA 1IHYA 4JCOA 4RLHA 5C3MA 3HN7A 3VC7A 2WD7B 4LMPA 2VRCD 4DC0A 5DZSA 1GQYA 4YT8A 1ONPA 4GVXA 4KZPA 4BMVA 1JAYA 3EVNA 5H81A 1HDYA 4I9UA 4WCDA 1GYPA 3ICPA 3OP4A 2Q2WA 3PHHA 2JHGA 3S1LA 3OJ0A 5CDYA 4O59O 2P91A 2XXJA 3DZJA 3FR8A 3EVTA 3H5RA 4FSHA 2AMFA 4U8GA 3ZHZA 3Q2KA 1CWUA 4BKUA 3DAPA 2Y05A 4LMRA 3JQ7B 1XQ1A 5GZ6A 5JFOA 1LDNA 1VRWA 1ZH8A 1HYEA 5JY1A 4R1UA 3AUAA 4XQ9A 2UAGA 4OAQA 4WCFA 3B1FA 4NBRA 4DLBA 3JQGA 3H2SA 3PPIA 1RWBA 1XELA 4GGPA 3D4OA 4ROSA 4IDFA 3GNSA 1PL8A 2O7SA 5CPFA 2TMGA 3MJSA 4R01A 1A71A 3LC7O 1M2WA 3OSUA 5DOVA 1BMDA 2NNLD 1GEEA 3WXBA 4CQMB 1ENYA 1DJNA 4R54A 4UUOA 1XYGA 1V6AA 2CUKA 1WZEA 2X0IA 4RDIA 2PLAA 8ADHA 3GDFA 3GVPA 2ZK7A 4EEZA 3DL2A 4DLLA 4RPJA 1UXHA 2W2LD 2CMDA 1KEVA 3O8QB 3OF2A 3BTUA 5KIAA 3SC4A 4ONEA 2IZ1A 2OFPA 2Q99A 2HCTA 3ROKA 1VJ0A 2AEFA 3PIDA 2IDZA 4JXKA 4AJKA 1Z45A 1PGNA 1EVIA 1KVTA 1PR3A 2I3AA 2EEZA 3RVDA 3M2TA 3KZVA 1T2FA 1YKFA 1DO8A 4K6CA 4FN4A 4IJWA 1C3VA 1JVSA 3RBXA 4BNMA 2WJPA 3V1YA 4IPTA 4A27A 3DR3A 4NH4A 4R16A 3WGQA 3VPXA 3ZWXA 4PZDA 4BVAA 4EW6A 5JNLA 3IUSA 4M87A 3HNPA 5JCXA 3HUDA 4ZQHA 1PQPA 2UUOA 2VT2A 2O3JA 3RKRA 1BTOA 3QQPA 3GLQA 2PZLA 2HO5A 3RFTA 4BO0A 3VHRA 5IDQA 3LC1O 3PHLA 4CLRA 3VVCA 2GGSA 1W8DA 1TEHA 4PVCA 3H3JA 3CKYA 3JQ6A 3LT0A 2ZYAA 1K6IA 1ZK2A 4IINA 2O48X 3GG2A 4BO7A 2Y67A 1QLHA 4YJGA 4A03A 4ZQGA 3TFQA 4P38A 3DC2A 2OUIA 3R3JA
chains in the Genus database with same CATH superfamily
3ZGXA 1Y1KE 1KAQA 3V3KA 1XZHA 4HWSA 1MAVA 4KL8S 4MWDA 4BEJA 2BFFA 5KKCA 5LB2A 1Z8FA 2WIJA 1EINA 3FOBA 4FR0A 2JF0A 3IUEA 4XEHA 4ZOBA 3RM3A 3WWZA 1KU6A 4FYYA 4UFNA 2JZOA 3M9WA 1XJ5A 3GBSA 2QL7A 1ECFA 1CEQA 2W7TA 3I2GA 1RZRD 5GONA 5JH7B 2JARA 2YWCA 2UVDA 1EJ6A 1Z3IX 1Z06A 2WTMA 3PFWO 1F0NA 3WYCA 5LD2B 2I7TA 2OAP1 1UF9A 4MTLA 4DA9A 1NW3A 1KOFA 3UYLA 4GMHA 4BLQA 1LI5A 4HUQB 2FQWA 4NZPA 3HUFA 4UUNA 2V0GA 1F1JA 1GY8A 1ZMTA 5DYWA 2ID9A 1JMVA 1R0SA 2RHBA 1N0VC 1VLVA 1C0LA 1NKTA 2V59A 3ROTA 3WMFA 3ZWKA 4CT5A 3FPFA 1GTRA 1JQJC 1OLXA 2XNDA 5ECYA 3EEYA 2QP4A 1N7GA 1O94A 3OZUA 2WC1A 4JBXA 4XUEA 3SJAA 2ZSIA 1B8VA 3QE2A 4L9SA 2DR0A 1GKKA 3U60B 1WBDA 1CX9B 3HBLA 1ECJA 1T9KA 2H1IA 2WJIA 4L3OA 5K3FA 5LKRA 4AY4A 1O08A 4YCJA 3UF0A 2FPSA 2HIAA 4FHEA 3EEQA 4MHSA 3EPHA 1Y9ZA 2GBGA 4L02A 2BMEA 3Q7PA 3W8FA 4LDZA 4WECA 1Y4ZA 1X0VA 4XGIA 5A62A 2O8BB 3L41A 4HQNA 1GTZA 2HSDA 3AHCA 2R6CA 2Y66A 1EESA 5DYGA 1Z73A 4WNIA 3MXOA 2FDCA 2IEIA 3O4FA 4LVNA 4E94A 3H11A 4CUKA 4HB0A 1B43A 1JLSA 3OJEA 1U2GA 2VJAA 1Z0DA 1K3UB 5GJCA 2FDRA 4UBIA 3CIOA 5A3JA 3ZW8A 1BHSA 1EK0A 5KYYB 4HNAA 4BATA 3ZJUA 1QO0D 5K03A 4HGPA 1WMAA 1M0EA 1OSNA 5JCPA 1JHZA 2WF6A 1FU8A 2CDBA 1WAMA 3DC7A 1KK3A 5BV8A 3IEIA 4OMFG 2HSEA 4ZI7B 4P7BA 4UZFA 3LUBA 1MO2A 4NEHB 1Y6GA 3I2YX 3CZAA 4J1NA 1ZGCA 1S4QA 3I42A 1GPDG 2ZSEA 1USIA 4O08A 4HVTA 4P4SA 3OESA 1BNCA 1X8XA 3AKYA 3K31A 2QMOA 5EINA 1Y3BE 3EOZA 2GRJA 1XPUA 4J0IA 4GYYA 1Z6TA 3KVRA 2VH5R 4MUYA 3IVAA 3AR9A 4R1QA 1BW9A 2CHVA 3LYHA 1NBIA 5KAPA 4CR6A 1PYDA 2ZANA 5KTMA 4UJ3A 3D54D 2IHYA 1LQTA 4KYIB 5F3WB 2AJBA 1WPQA 3E3NA 2Z8YA 3T9DA 3LVFO 4PG7A 1OFGA 1KYVA 1XKQA 1X13A 5KSWB 1G8HA 2GAOA 3DMRA 2BUAA 4P98A 4ZYVA 5BVHB 3ZGOA 3KX2A 1UBKS 3RSLA 2WV7A 3GLFA 1Z38A 1ZJYA 2I80A 1U1IA 4UREA 1CUWA 3I62A 4BKRA 4Q4JB 2KLHA 1E5TA 1BMTA 4YRTA 4JX8A 2X9LA 5I7EA 2K7FA 1CF4A 5HR5A 5DMHA 1Z0SA 1MT0A 3NEAA 2FPXA 3EDYA 2JJ8A 4MW0A 3CJRA 3K4QA 2XDAA 4G84A 1O4WA 1A8HA 2BE9A 2DSNA 2E1PA 2Z98A 3C7TA 5KHAA 4BFCA 2YHIA 2YVQA 3OQJA 5E6UB 3AW9A 3GUVA 4YMIA 1QNLA 2R97A 2BSQA 1XEXA 1QRTA 1B0UA 3PQCA 3KYBA 1FP6A 2CY0A 4GHWA 4UDXX 3CNNA 1ZVVA 1TQDA 3AB7A 2MR6A 2WWGA 2W8BB 3B3FA 2NPFA 5TMBA 1JFRA 3DQPA 3AR3A 3JW8A 4QOSA 1PR2A 4WVFA 2NZ2A 1Y5NA 1UMDB 3P96A 2M6LA 1RWOA 3C3BA 4BO8A 1Z28A 4PLWA 2JD2A 4XX0A 5DBIA 4Z49A 4BRWA 2RHWA 3BFVA 3HE3A 3LPAA 4QQNA 4IFBA 4NFLA 5EWMB 3FNEA 4NRDA 3T1YB 4PVDA 4ZZIA 1TO2E 3L6DA 2QYOA 1L5YA 2RB4A 3ZN2A 3JD3A 1U99A 4JLNA 2G71A 2XB8A 1W6RA 2CVQA 2O2XA 3VO2A 5AM3A 5C4IA 1WP9A 3I37X 3JASB 3P0HA 3RVRA 5JXGA 1S3IA 1U31A 2R8BA 4BWGA 3I9OA 1V2HE 3O26A 3O31A 4YUYA 5IKEA 4GU5A 2AFHB 1A9OA 3TNJA 3QP9A 2WF9A 4MA0A 3RYHB 3U48A 1K89A 2FWBA 3R40A 4IY1A 2D8MA 2I91A 2JFGA 3QFSA 1V7CA 3TUJC 4Q3OA 1ZL0A 3V9AA 3CSDA 4OFXA 3AKZA 4O4LB 2H4JA 2HZ7A 2IRWA 3WO0A 3WICA 4D3SA 2A59A 2NNWB 5BWBA 3Q88A 4MA4A 2ZBFA 3TO5A 3CG0A 2FEKA 1HG1A 1Y8CA 2A4MA 4C78A 4DRZA 4EBFA 3CSUA 1FRVA 2LWIA 4X7BA 1Y63A 3L4EA 3U44B 5AXBA 2J87A 4ZEXA 4CKXA 3TRIA 5LZ9A 1G41A 3W1EA 1LLDA 5FHQA 1MFZA 2I22A 2R6JA 2Y1LA 4C6SA 3AB8A 1L4BA 3CF6R 4OQXA 5CGZA 4BCDA 3U09A 3IP3A 4G1MB 4PAGA 2XLCA 2R751 1Z5GA 2LV8A 1TKBA 4QYXA 4DLVA 2OHFA 1ZD2P 3L0BA 2NP6A 1PUJA 2D00A 5KU7A 1K8QA 3K35A 2UZ3A 3HMKA 2WE7A 3WL4A 1PGPA 2RC5A 3BC1A 1HNNA 3PYLA 4EI8A 2VDVE 3ECSA 5CK5A 1NTOA 4RY2A 1NVMB 1NAIA 2B5WA 1L7RA 5MGBA 2JD1A 3BPSA 3MXTA 4Y6GB 4DZZA 3ZQKA 3TLXA 2Q4OA 4YMGA 3ZD9A 5AFSA 3TXYA 3R2JA 4XLZA 3SVZA 1Z8HA 1XTIA 2LBPA 4DCPA 4KIWA 3Q2OA 4PLZA 3H86A 1ZAYA 4AMZA 4RE6A 5ARDA 1CQJB 4EW1A 1GGEA 2J6HA 3OIUA 1NRIA 3F6SA 2HREA 2IVFA 3U62A 3ZU3A 2C99A 3WNBA 2GYWA 2KQUA 4G0QA 4MO2A 1E3WA 1ZM9A 1LV7A 1CCWA 1SU8A 3PLRA 3QHPA 4QOJA 2ZULA 1ISGA 4NHOA 3T52A 1V8ZA 1GUFA 3X1JA 3VAYA 1AE1A 1P9LA 1IY9A 3L0YA 1ZCZA 1NY6A 3EZGA 4CTOA 3ELUA 5J5CA 3ZK7A 1VBNA 2RKWA 3ZEIA 2GILA 2ORVA 1FLVA 1QHHA 1YVUA 2X7HA 4H7PA 4B35A 2ZWAA 4XOUA 2V4MA 2E6KA 4WBNB 3I76A 3T3MB 1ILEA 1Y4UA 1JIVA 4FT4A 1MJGA 1Y1RA 2UZ1B 4DLPA 1YBHA 5GQSA 4HWKA 4ZKDA 1TNDA 4P2GA 1WXFA 2FZKA 3DT9A 3B9RA 3FKJA 3IBYA 3IEUA 4ES6A 4OLJA 2MSCB 5B64A 3P5BA 4XUCA 4ZHQB 1O97D 2BHLA 5LA6F 2B3TA 2IHNA 3WYNA 5EP2A 4NBSA 1H6BA 2H9AA 1IWOA 4TZ0A 4PSDA 2FQQA 2Q5IA 2ZKIA 6GPBA 1U8CB 1VZ2A 3GNTA 3CB2A 3PUIA 3ILXA 1CRWG 2ZP1A 3KLNA 3VSBA 3TOVA 1GCIA 2P9ZA 3HVKA 5HG0A 4AY5A 2Y1OA 3NTOA 1GTMA 4AF7A 4U6QA 1RHUA 1DC8A 4AM8A 1GLNA 4XAQA 1G6HA 2DFDA 4CG0A 2AE1A 2FUNB 3EN0A 1JG1A 1H05A 1SG9A 2M98A 5BT9A 1Z0ZA 2CHFA 3ZUGA 2VP6A 1Z2OX 2C9ZA 2UYQA 3UT5A 5A5DA 2IH4A 3EVFA 1BXRA 3EXFB 3I09A 4H59A 5AR1A 1DAMA 3RS0A 1AQYA 5AIAA 2A3RA 1OXBB 3T0IA 2IHTA 3TTTA 1P2VA 4H1UA 1JR3A 1SXJB 1GNSA 1S2NA 2VKQA 3A7EA 3QUSA 5E9JA 1MORA 2WFZA 3JZDA 3RVJA 1ZAKA 3T15A 3UW3A 3K1TA 3RHZA 3R8XA 4C7BA 1OI4A 1JHYA 3N0WA 1CUHA 4FBGA 4LX8A 4N39A 4UHHA 5JSZA 2GZSA 5AJVB 5KTSA 3R09A 4GG1A 2DCMA 4MV6A 4G4GA 4X5OA 5EHGA 2KHZA 4G2TA 3Q0IA 1PS0A 3WX0A 2YCBA 4W9NA 3K70C 2C7OA 4E5UA 1JHRA 3RJZA 4A92A 3ND7A 1RI1A 2AN4A 3K53A 1WXWA 2ZYTX 4YP5A 3THXA 4XDYA 2O20A 3EQ7A 1MPTA 1QX4A 3LO5A 4M0KA 1U4NA 3W8NA 3T1TA 4DLAA 3CWZA 1IXKA 3G6KA 3ANXA 4BRSA 2FX3A 3P45A 4IMPA 1CIJA 3MRXA 5IMSA 4DTIA 3M83A 2OVFA 1D2CA 1FSGA 1L1RA 4HXFB 4M9RA 4UHKA 1WHTA 3KSZO 4YP9A 3RWBA 2LGJA 3TZHA 4AJ2A 2I8CA 3O8DA 4IF6A 4C0AC 2QSUA 3CEAA 2FP3A 3CRMA 5F4BA 2C0CA 5L3SA 1J6UA 4LHVA 1JV2B 5CW1A 2Q6TA 5ABPA 5JJLA 4R1OA 4XFJA 1N1GA 5I48A 1DAEA 1DO0A 2HJRA 4ZAZA 2J59A 3BHJA 3VSEA 1LGYA 2QLBA 2QM3A 2QUJA 2XCUA 2YZNA 3NKLA 3V2UA 3ETCA 1DAKA 2CFTA 2P0EA 5BYAA 4GF5A 2CDRA 6Q21A 2W4IA 1OTHA 1YR8A 3UGKA 2RI1A 3ZS8A 4CTJA 3UUEA 1V3UA 3OI7A 3QVUA 3LUAA 2L18A 2IIQA 3MTQA 4P7GA 3HCOA 3W2IA 4LGCA 3X1KA 4F4HA 2HMTA 4P81A 1VB3A 1FP1D 2W48A 4TTPA 3UWPA 1TL7C 1GGMA 221PA 2XI4A 1B1CA 1E6LA 1I7SB 2GZ3A 2FYTA 5EC8A 3R3VA 1PG0A 2OV3A 1QP7A 5LMZA 1USUA 3Q15C 1GL3A 1QV9A 2PS9A 2XYHA 1XJ0A 2P2DA 2XCSB 3SYMA 3AG5A 3AVQA 3KLMX 2DETA 3C3KA 1IN1A 2EXXA 3FUCA 4M1QA 3RBVA 3OKAA 2DQ4A 4WY2A 1MN6A 1GAQA 1RAHA 2IDKA 3WE7A 1NMZA 4O6VA 2OD7A 4WXYB 3ZWWA 2HLNA 2ZVPX 2HWKA 5AVJA 1BW9B 1Z68A 2O3TA 2VDUE 2CLSA 1L5HB 3B82A 3HLYA 5IBCA 3DE4X 2P41A 4ODIA 4CLOA 4H9GA 3PJGA 4KE6A 2A9OA 1M0WA 2FPOA 2GM5A 2IHJA 1TAGA 4JIGA 2OB2A 3ND9A 3IQZA 4RTSA 1USGA 4RXTA 5IUNC 1A8UA 3KJXA 1KK0A 1T8WA 1UZUA 3T5MA 1ZVKA 2Q5HA 2ZFUA 1R8QA 4LYJA 2HWUA 5KOJB 2VSOA 3OF3A 3Q3JB 4X8MA 4KLNA 2JG3A 4DRXB 2B8TA 4CQMD 5DBFA 4RCZA 4DLKA 1CQIB 3P4XA 2RHMA 4FE3A 4AMBA 2ZWMA 4FMCF 2FPPB 1B3BA 4GR5A 1JDJA 2WTUA 1M34A 4MK4A 3UAGA 2I2AA 5AVWA 4BMOB 3W8EA 2FDXA 3PRKE 1IBRA 2PZ8A 1WSAA 2GJAA 4QBKA 2LKCA 2ZRQA 5IHXA 2JK1A 3T4UA 5LC1A 3WLRA 4F46A 3SICE 4BP1A 3S7TA 3DMHA 3FTDA 4CUZA 2FLWA 1O97C 1O95A 4NCXA 4BFTA 4ZP1A 3CS3A 1SB8A 1KU0A 2H8GA 4PEVA 2QMUA 4UAVA 4D41A 3CZMA 4O1HA 4HFRA 5IBPA 5K0EA 1Z2DA 1UANA 2OP0A 4LWZA 3GL9A 1JFTA 1OFUX 1S8OA 3GN2A 4R71A 5IP5A 4HRYA 4YRIA 5MN5A 5F9HA 5L3SB 4EGAA 2BI7A 3WA7A 2ZIGA 1W25A 4G8CA 5DJ5A 1NM5A 4A1OA 1GU0A 2LTAA 1DBWA 3ESBA 4ND1A 2JANA 3CLKA 4KUEA 1E1CB 1P4SA 2H0AA 2OYSA 3TQRA 3JYQA 4FWTA 4R0VA 4JYZA 1CIVA 5SYMA 2PRKA 3DEYX 4LXYA 5JEEA 3BMQA 1AH2A 4P5EA 1ONSA 3NBZC 4FX5A 2I9PA 3C1TA 4GS5A 3TBHA 3GCZA 1FDWA 1GG5A 4MB0A 3EA0A 1RPZA 5AW7A 3OTIA 1BC5A 3KPYA 2BEUB 3U3DA 2Y0DA 1VPLA 4GKKB 2BDEA 3ZWPA 2HDNB 5FPSA 3WQSB 2EZ9A 3GT4A 2VRWA 4JSYA 5CEFA 1GZDA 4EHKA 3ZLJA 3BQNB 3NBXX 1N8SA 3ZWYA 4CM6A 2F00A 3FYSA 1XO1A 1Q0RA 4L85A 1IOVA 2ZT5A 4CM4A 5A9SB 2I6XA 9ABPA 1I0LA 4NMXB 2W0SA 3KE8A 4J1SA 2RAPA 3BK1A 3NBYC 2PH5A 3A4LA 4R8KA 2BFBA 4DIKA 4PQFA 3BWDD 1L7XA 2DLNA 3LQQA 3OBIA 4ZVOA 5ITSA 3RT7A 4AP6A 5JI2E 1ID8A 1GIAA 1HTBA 1YZLA 4C5BA 4I19A 5GGXA 2JFZA 2YWDA 3LDUA 3T8YA 4Y98A 5CBPB 4ARIA 1BCRA 2IHVA 5A71A 1Y6FA 1UK6A 4HB4A 1FS6A 5DNAA 2B94A 5KVQA 1ISHA 3HCAA 1UBSB 3AHJA 2R8ZA 3OJWA 5C3UA 3P9IA 4D92A 1F8UA 4Q3LA 2YXLA 5LZ2A 2J0SA 3DMGA 2VTEA 1WB4A 1Y8QA 3RT9A 3LKVA 1OYWA 1P77A 1PVOA 3ZW9A 1FYVA 1Q0HA 1P80A 1D9XA 1ZOOA 3IELA 3MTIA 4D4HA 1GQSA 1V96A 1Z7YA 5B3LA 4WRRA 4IP0A 2F90A 2Y0BA 4NY1A 5K8CA 4OJYA 2E4YA 3EVAA 1RD4A 2G6TA 3R20A 3DE5X 1RXCA 2VZLA 1QHSA 2DUMA 3DE2X 1RLOA 2ORED 4UM7A 3WRYA 1P72A 2ONJA 2R1TA 3RVLA 4NIMA 2GHIA 1WU7A 1HMPA 1PJCA 4R0NA 4JYAB 3K9QO 1DBIA 3OF5A 4JJZA 1P0FA 4FPXA 5TJHA 3IUPA 4NOMA 2A2ZA 1XXLA 2XBMA 4EHLA 4MSUA 3V8VA 4JD5A 1ESNA 3K0FA 1ZM3A 2OCXA 1MO5A 1K7YA 1JHXA 3OUTA 4BE4A 5BNIA 1TD9A 1U4OA 4N5LA 2NYRA 4ASUD 4DIMA 3U7QB 4II7A 4BKOA 5MN6A 2R84A 2JLUA 2XSZA 2ZR0A 2JLRA 5THXA 2GAJA 1SOMA 3EIUA 4X8HA 4ER7A 5PNTA 3KHUA 5A1TA 2GVNA 1XZNA 4LVCA 3QFTA 4N5NA 3KQNA 1GZHB 2JRCA 2X22A 2OHXA 2AOUA 2WW8A 4KBFA 4N18A 2YDXA 5KOYA 1EI9A 2QXTA 2VWGA 4TMTA 3UC5A 4EENA 2ZDQA 3TZQA 3O93A 1BCSB 1UC8A 3E82A 4QHSA 4H7EA 1KARA 1NJ6A 4GQIA 4ARBA 3CZ9A 1RCFA 2GPNA 2WICA 4DYHA 3PUKA 3COYA 3FDXA 4JVMA 3ZC3A 3OQOA 1ZEMA 4QXAA 3LWBA 4DLYA 4TV9B 2HEIA 4ZARA 4HATA 1ZSYA 3AF3A 4A7PA 1HMYA 1YZVA 5BWOA 4CEJB 3VXKA 1P0IA 2HU7A 3B6KA 3M0EA 5EZYB 1ZUNA 3DEIA 3GJTA 3NHJA 3C4QA 2YVLA 3DZHA 3HKDA 2AUMA 4CMIA 2D5LA 1IY2A 4KPFC 4JBGA 2JA2A 1C3LA 3WBFA 1F2UB 1JPJA 1IM5A 3L46A 2ZE8A 3R7LA 3F5MA 1EU1A 4BB5A 2FSVC 4QPCA 4F6RA 1ZSVA 3N0TA 1J22A 1L6RA 4DKJA 4OP3A 4TKVA 1J56A 1K8YB 1Y3DE 3DBOB 4CM1A 3N39C 2ODTX 4D4LA 2NTJA 2HHCA 2Z8YM 4KSYA 1GPWB 3P71T 4L8VA 2PCJA 1U7TA 1W59A 2GBLC 3JCZA 4M8LA 5HA5A 5LLSA 1V7ZA 4IVRA 4BQRA 1J70A 1U28A 1B6TA 4IJ5A 2HAEA 3WB9A 5BW4A 4QTYA 5GMOA 4HPJB 1Q7EA 5C51B 1D2HA 2BJWA 4JEMA 1XTRA 2C3YA 3KOYA 3A06A 3V97A 4GPTA 1UC9A 4K6FA 3ONVA 3VOBA 4ZZ0A 1FIUA 1JECA 1LI4A 3CF4G 5L53A 2VHXA 4B0PA 1FFCA 2D8AA 2YQ5A 1F8XA 4E5YA 5C7OO 3AF0A 3PIIA 1ELOA 3WV4A 2QU7A 3VH1A 3FPBA 4W5JA 2V8BA 1MDBA 1M33A 4X44A 1RQLA 3ROZA 3SZMA 3EQ9A 4A0HA 4URVR 3W34A 3M1AA 4MVJD 1D6NA 4TRJA 4HMOA 2LUOA 1MO3A 2OYCA 4GDFA 3HHEA 4ZQCB 3ACBA 3CPSA 1E62A 3RYFA 4U7HA 1K5GA 4F9GA 3BX1A 3LC2O 2NZVG 1HYHA 2NAPA 2Q6VA 2ZQ5A 4LXQA 4KFCA 2MDTA 2BGGA 3WB1A 1J49A 2ZYGA 1KKMA 1PTJC 4PXSA 2B99A 2QW8A 1RMTA 5CITA 3UC9A 1CU1A 1EQAA 3HVJA 4A2PA 3AIKA 1C7IA 1ZHFA 1Q3KA 3EEFA 4BPRA 4D9NA 3ZGYA 4EJ0A 3UJ9A 4M1MA 2Z2KA 1SUSA 3DONA 4JNCA 1TT7A 3LDHA 4JB8A 3IOMA 5BN4B 5B6IA 1WMSA 1ZD4A 3ZCTA 1RMYA 4X00A 5AKHA 2H2WA 1PKEA 1SBIA 3JZAA 3T38A 5IXJA 4RK6A 4CIDA 4IEFB 4EPXA 3GEEA 3IBCA 3L79A 1EX6A 3ICWA 1CJBA 3G3EA 3CRZA 1YMQA 1JH8A 1YL7A 1H65A 3SJUA 4NJEA 4WN3A 2KJQA 5LP1A 3WOVA 1SC6A 2C7RA 3NIBA 2QMQA 4HWTA 4C07A 2C2YA 4BO4A 4QFBA 1LPOA 1U7DA 1DKOA 4OPMA 4LN1A 3FRIA 3UMGA 3DUFB 3I4FA 5F33A 3CINA 1U2ZA 4FFVA 4ZGWA 1DCKA 2HK8A 4IO0A 3VZSA 5THKA 3FJYA 3H3XA 5ILQA 5EOVA 1MC5A 5CDTA 2MIIA 2W2KB 3A7DA 3ET4A 3E58A 1DG3A 2FW1A 3BN3A 1CEEA 1HLDA 1YRLA 2YZ7A 2VYFA 4IDGA 3X1XA 1E4EB 1EX9A 4J0CA 3LY5A 4WDRA 1N0HA 1RACA 2D2EA 4R5HA 3TR0A 4B3DA 2B7BA 4DR7B 3UPUA 3O6VA 2Y9MB 1I4WA 4FDMA 5HGXA 2Q3HA 2X6RA 4GXNA 4AIRA 2OXTA 1GSOA 4RWEA 5EWLA 4HZUB 3OO0A 3AR5A 5DTQA 3P0IA 2YOGA 2V55B 3H83A 3WB2A 1ML4A 4XLLA 2QTRA 2PBZA 3NDJA 4WW0A 2OHGA 1SAYA 2VF4X 1K7SN 3EW7A 4GX1A 5AK5A 3IHWA 3MINB 1Y9DA 3UK2A 3AM1A 1CQIA 3UM9A 1E6KA 4TOIA 2J1LA 2JBWA 1U90A 3IBTA 4EARA 1QYRA 2BFNA 1XEAA 3F7NA 2A33A 4INJA 4LGMA 3RDPA 4BB0A 2WIKA 1AGRA 1RWQA 1ND5A 1BHO1 2GX6A 1YMVA 3M6IA 4K26A 5F21A 1ARZA 2FJUA 3WLLA 3BJMA 1PUIA 5KCMA 3GRPA 3IGFA 3DYBA 3A1DA 4QD3A 2GBFA 1UIMA 1UBCA 3BB4A 3A27A 3GLVA 4ZI3A 3AY3A 3HN6A 5IVHA 4U9HS 4HEHA 5LFAA 3OLXA 1Y8RB 2FG7C 3F9RA 4BECA 1DRWA 4V2UA 3QMWA 3E7DA 4F6LA 2Q0QA 1ZK1A 2PX4A 1ZC4A 5FWDA 3D64A 1PSZA 2X76A 1P1RA 1FYXA 1SKYB 3EE6A 2XCIA 4PS0A 1JTFA 4C0LA 1ZINA 2E5WA 4E0BA 5ELLA 4NVRA 1WVIA 2ODEA 3AJ8A 4G37A 4OYLA 4QXOA 5IS2A 1NU6A 5KNLA 4P92A 3DMTC 2FF7A 4ME6A 5REQB 1W52X 2VF8A 3WFZA 1E77A 5I7FA 1RYBA 2GCNA 2ZSUA 1OCEA 1AKWA 2Q5EA 4ALKA 4B48A 3P9YA 3AFMA 5A0TA 3MBKA 5CR9A 3Q5EA 4KBGA 5HFNA 2A9JA 2FTKE 1E1RA 1ZRSA 1N2CA 1TF5A 1NX6A 2O7NA 1PT5A 3NDIA 4H4EA 4KO1S 2F1OA 1KO1A 2G1KA 4MQBA 4M89A 1LCIA 1JWBB 1RQ7A 4GECA 4MW9A 2IEDA 3PC6A 1JHDA 4BEBA 4WNAA 2DT8A 2XWPA 3MWDB 1W76A 3AUKA 1L2TA 3L4BC 2AFIA 1XZMA 2QZ9A 1V8OA 2DTXA 2WUVA 3IOBA 4M36A 3AMVA 3L04A 3GLGA 1DXYA 4I55A 2Z6QA 4AX8A 1TPZA 2NVBA 4RY8A 4TSKA 5FI0B 4U3JA 2PMFA 1IZ8A 1X70A 2GVDC 4X6UA 1VQ1A 2O8NA 4XYGA 2X1MA 1JVBA 1ODTC 3MOIA 2M2IA 2OORC 4UUQA 4BHTA 3A9TA 3M4XA 3QY9A 3BA6A 4ND8B 4HGNA 4QJBA 4MVJH 5D00A 4XH9B 1EYZA 3HL4A 3I8SA 4FI3F 3CR8A 1Z62A 2PWYA 3C70A 3P9KA 3TM4A 3ZCVA 2RI6A 2R2AA 5C1IA 4WAUA 2AQHA 1AV7A 1BYUA 1XK7A 2A9FA 3LT4A 1IZ0A 3EOAI 4RMNA 3D6TB 2IPNA 2WDPA 5BORA 4FZ3A 3PJRA 2EG9A 2CE7A 1BXKA 2XUDA 3P97A 3ZH2A 2Z1NA 1C0IA 4PPNA 1RJEA 1JQLB 4N3GA 4PPYA 5F7XA 4AQYB 4MV5A 3AV3A 4QUHA 5A6SB 2GDZA 4NATA 3F1LA 2DLCX 1ZLYA 4K9MA 1Z6GA 3FWYA 4ER6A 2GVZC 1GL7A 1GUZA 1KGSA 4Q9NA 3UAWA 4LJRA 5FAKA 4N1AA 2AX3A 3O92A 5H9VA 1RWXA 4D99A 1RC0A 4D6YA 5MF6A 1F14A 3CH4B 2JZCA 4JJKA 1W35A 3QKTA 4WWHA 1RLUA 3BM5A 4HOYA 2H2DA 4JEHA 3U1VA 2J4FA 1DMRA 3PQ5A 4GDMA 1COZA 1E3QA 1Z36A 2CVZA 2AJLI 3E9RA 3OZEA 4IDOA 1BGWA 1Y8RA 1Y5IA 121PA 1MPXA 2IXGA 3JYOA 2XECA 3AVPA 2G17A 1NV9A 1EFVB 4KQKA 3NVAA 3R7WB 4RIEA 1ZNWA 1K98A 1FP2A 1QPBA 4CMAA 1LPNA 4L50A 3K05A 4BGUA 1E61A 2GPSA 4HHEA 4QA9A 4UAJA 2EP8A 2O2CA 1DHTA 1RYDA 4GRAA 1LTQA 3DV0B 4OUKX 4X3PA 5AOBA 1E99A 2PJZA 2RGGA 2WZQA 1PW7A 2Q7XA 4D7AA 3I6QA 2IXBA 4BV9A 3BRWA 1LPSA 1YS6A 2DHRA 2YRFA 5EMJA 1T35A 1IZ7A 1F2TB 2QRMA 3MUEA 3IMFA 4MRRA 4O0LA 4O0MA 1X1SA 4RVCA 5EVJA 1DBVO 4BTLA 1M8KA 4GPIB 4EAQA 2RH9B 4EB6A 3ME5A 3HO8A 3KYDA 2OQRA 1UXOA 4QEKA 5GWXA 1TYAE 4CKEA 4LEIA 1FSZA 2WHQA 3WRXA 3NTRA 2NM0A 4DWOA 3W6UA 5TQJA 4EFKA 1ZFNA 5JJ5A 3GT0A 1O4VA 3CJQA 4RZ3A 4LRTB 1ZN2A 2F4NA 3H17A 3OPVA 4PHTA 3N7AA 1JDZA 4KO4S 4LPKA 2GT1A 5FO0A 3OX1A 3ASUA 1N6PA 5CFPA 3LX6A 4PYRA 1IG0A 4ZMSA 1ZJWA 3MFQA 3MLBA 2PX0A 1OY1A 3DO6A 4XWYA 5ALPA 4N3AA 3D8NA 2JNWA 3HXKA 2PRZA 1QM5A 1IWPB 4YCCA 2QY6A 1C0KA 2OY0A 3CNOA 5C4GB 4E30A 2PTGA 4J75A 1QP8A 4P53A 2CBXA 3HG7A 3ZCXA 4E1BA 1HSZA 2A7XA 5HF9A 2NU7A 4JJ6A 3I8OA 1J2TA 3C4JA 5GP1A 1GT91 2WVAA 4AJ1A 3MMNA 4JMPA 1U9ZA 2Y2UA 3VPGA 3EF0A 3UKDA 3UBMA 2UYGA 5E6SA 1D7OA 4RTOA 3PXCX 3HZZA 3TDMA 1JR3E 5KSZA 1XHEA 2G40A 3B5EA 1TKRA 2VJPA 2IJGX 3E23A 1IQPA 2WAOA 4Y6QA 4Y9TA 4PYJA 2UUPA 4LE0A 1HX7A 3HKBB 1USWA 3KG2A 3RSQA 4BV8A 3X2EA 3C6KA 4M0FA 4O3FA 5EGNA 2UUBB 1IFXA 4K46A 3DQQA 5HGJA 4AJLA 1EUZA 1NY5A 2P6NA 2FR8A 2Q49A 4JZYA 1OXTA 3JRXA 5TMEA 2OA0A 4ZYYA 2QAGA 4R2MA 2OWDA 3M4ZA 4EWLA 3IPLA 4B3MB 1TM2A 5DNDA 2WDZA 3PFBA 4B09A 2WPDA 1MIOB 1NBHA 1MJGM 3MMPA 1IBKB 4N7JA 2PXAA 4R1MA 2A5FA 3OPQA 2RHGB 4B6SA 1OXSC 4KI7A 5LQDA 3PZRA 4NE2A 3KSRA 4LQDA 1BCSA 2AZTA 3RYFB 2WMOB 2J3HA 3RH0A 2QZSA 4DNFA 6CHYA 4CF7A 5J23A 3GP3A 4MVJF 4P4SB 2HR1A 1E1NA 1LPPA 2BM8A 2FI1A 1ECGA 2P9YA 2X5JO 1ZIDA 1T2CA 3ENNA 3HP1A 4AJOA 3I52A 4ZCPA 1IHOA 1O0SA 3C1AA 4XYEA 4L0CA 5KYNA 1T9CA 2VWPA 4CIVA 2X5NA 4QNMA 4YLEA 4AO7A 3A1EA 2PUGA 3KZXA 1BMFD 1C7QA 3BEDA 1UP4A 2F17A 3PC3A 4KXUA 2PS1A 2ZT7A 3EGIA 3LYLA 2I6UA 2IXFA 3NTQA 3ZWOA 4GFDA 4IDNA 3G1WA 5BRNA 1F2UA 2EJWA 4JYPA 4ZT6A 5C31A 1SCUA 2GCOB 3NGXA 4MI6A 1J7JA 4M7RA 5FO1A 5GM2A 5GV7A 1JDPA 1LLQA 1L6IA 4N49A 2XRZA 3HKCB 2V97A 3L1UA 3KFVA 4NI5A 3WDMA 4GL2A 3JRNA 4KAFA 1OXMA 1HI9A 4A0GA 1CQWA 1FF9A 2GEUA 1DC3A 2OV6A 2D5IA 5AVVA 1M72A 2WWTA 4L5BA 2UXBB 5CPBA 4YTEA 4N0MA 3ONFA 5I7AA 1E4OA 2XZTA 3E9NA 5KVCA 1TK2A 3EUWA 3E22B 4TTQA 2OL4A 2P4EA 1WUTA 2H85A 1VE1A 3IIJA 3L2OB 4GZ6A 4G97A 1II8A 4KMOA 5D6NA 4XWKA 1HE8B 2GEKA 1P75A 1ZQ9A 4FJ2A 1A9RA 5JD3A 1J8FA 3R41A 3DD5A 3HSKA 4KXFB 2TECE 4QUGA 4RABA 3ZV4A 5GIOE 4OV6B 2BHRA 4O4IA 4UMDA 3TL2A 3FMGA 1WXQA 2WNIA 4E32A 2R9VA 1YA8A 5JDIC 2GNAA 1D6MA 2D2XA 2IX9A 1ISRA 1TK3A 1UT5A 1R7RA 3S70A 4FS3A 4P1ZA 4KR6A 2OT3B 3SIWA 2QK4A 4ZT7A 3B9BA 3KAPA 1RBYA 2PANA 2FJ0A 2VZ8A 2XE6A 5EJIA 1C81A 1G7TA 1CRQA 4QQFA 1DIHA 3ITEA 3KEFA 2EQ5A 2F6RA 4FLEA 2A58A 2C4MA 3G89A 5EKDA 4C3VA 5JYEA 2OR3A 3CNEA 4Z53A 2NMVA 1NV8A 1LJUA 5GM1A 4Y6LA 4B7XA 1QU2A 4YALA 5HQJA 1MRNA 1X38A 4OIMA 4HYTA 2CC2A 4KPYA 2F1HA 3GLHE 1V39A 3DDUA 2DOKA 1JHMA 3RIHA 3RTGA 1RLIA 1X15A 1ZCJA 1CNEA 2ADMA 2XQGA 4CG2A 1U5BB 2XCQA 3VR0A 2AMLA 2OD9A 5H7XA 1KFCB 1JKJA 2J4DA 2P6OA 2YUIA 4EHAA 3P0RA 2J6IA 2I03A 4WJLA 1EGVB 5A4KA 3W5DA 1VA5A 1HTWA 3G02A 4RC9A 4U63A 4JT8A 4F60A 4UM5A 4UXIA 3CURA 3LUHA 4LOLA 4BVFA 5I9NA 1OAOA 5INTA 2VSNA 3FDZA 3R0VA 1NI4B 4LHSA 3FVQA 3VVLA 5F77A 5K3EA 1YI0A 3GI1A 4TUYF 5I9LA 5BUZA 2FH5B 2ZPUA 4GLOA 2RGNA 3ZIDA 1XALA 2QTMA 1FYEA 5IG2A 5GIPE 2EL7A 1D1PA 2XW6A 4CTMA 1WHSA 2C7VA 4OGKA 4B4KA 3U5ZB 2FAXA 3KKLA 4A6EA 4R3NA 3DDSA 4CKCA 4FKBA 4E4RA 2FMHA 4F06A 4YRMA 5J40A 1Y1QA 4FYKA 1YASA 3FCAA 2D0IA 1MXFA 2G8NA 4NZZA 1FFHA 1KI9A 5BNWA 4CTNA 1DG1G 1NOKA 1HDEA 4D46A 3V1NA 2IT1A 3L05A 1ZZEA 1FP4A 1HE1C 4LSMA 7ABPA 4LXXA 4OVKA 4BXOA 2O5RA 1ZXLA 3OCZA 2NXNA 1SIUA 2I34A 4D9JA 2OCPA 1V9SA 3GO4A 2C57A 3OUZA 2AJTA 1PQYA 1IVYA 2Q1WA 4YMHA 4RZQA 5BURA 2N42A 1QIFA 1PK8A 2KSQA 2X9NA 1B00A 3OQHA 1WM1A 3PPWA 5KUTA 5JSQA 2XWBF 4NOKA 4PXYA 2VEOA 4EYOA 2INGX 2HXGA 2RKOA 4CBVA 4QVIA 3V8MA 1SZJG 4KH0A 1R9NA 4BWFB 3J7TA 5FP0A 1WE2A 1NOIA 1T9GS 1KK1A 1QOZA 1TVCA 4MV7A 4ZVPA 1PFWA 3TOCA 2O0HA 3TTYA 2CZQA 1CY4A 5SV2A 2E4XA 1RR6A 4DA6A 2PUBA 2IS6A 5GPBA 2YZ2A 2WV9A 3EB9A 2OBYA 2JLYA 3O4GA 4X91A 2A0WA 2H17A 2MMCA 3A6JA 2CSUA 3C2QA 1DAFA 1LLFA 3NNNA 1RBMA 1YQWA 2AV6A 1YE8A 3TLEA 1RPTA 3T7RA 2D3WA 1CJCA 3NIDB 4OXRA 2RBGA 4OMDA 1PJ8A 3STWA 3D0OA 1CHDA 1JIUA 3IO5A 1EFVA 4LDNA 1ZJ5A 3HWSA 4XASA 4ZA2A 2ESRA 4DAOA 2RHHA 1NI3A 2IZZA 2L19A 3RAPR 1P61B 3CH5A 4UVHA 3RARA 5JSHA 2VOJA 2HBQA 1QFMA 3D6HA 4ED9A 3PA6A 3G7UA 4JLKA 4H7JA 3CT4A 4W1QA 1WUYA 2E37A 5A2GA 1O96B 1NG9A 2YHUA 3P9RA 821PA 3FGPA 2HJSA 3IMGA 5DBOA 3UY4A 2AUTA 3PJFA 4M99A 3ZV7A 5IJ0A 1HK7A 5HZGA 4MRSA 2D2FA 1MO4A 4HDNA 4ETMA 1M0SA 1QCCA 4DYDA 1BXRB 2FVXA 4J4BA 4RELA 3HJFA 2NUAA 2QZJA 3CEMA 4XCXA 3FFBA 1LFDB 3DBIA 4KH1A 5IYZF 3S2SA 1H2FA 2OZEA 4HNQA 4YRSA 5JISA 4F9TA 1QRUA 2XD4A 2QYHA 4P4TA 5BYKA 1IN7A 2IYLD 1L8AA 4UFOA 1VYVA 2O6HA 4TMVA 5K3AA 4BFYA 4EKIA 3UJPA 4KXWA 3U31A 4ZOCA 1RE1A 1JG3A 2GYVA 5K3DA 5G53C 4PCUA 1M1NA 4UZEA 4Y18A 5EY5B 1YR1A 3UICA 1C30A 2IEYA 3MMZA 5LCXA 5TQVA 2VPZA 3UT5B 2WF8A 3NBUA 1P1BA 4DZRA 1S1CA 1XPRA 1EXDA 5ENZA 1BS9A 4D9MA 1VP9A 3TIFA 2WEKA 1NE2A 5ALHA 3UMSA 3DM9B 4ILEA 2A4KA 1QE3A 2FHSA 2F3QA 2CKDA 2D0OB 2QS9A 3IOEA 5KMGB 3IBSA 5ICEA 2CL5A 4LXGA 1A5SB 4G56A 3ZE9A 3DE6X 1L7AA 3N2ZB 1AMOA 2BCGY 4D8WA 1JZTA 4KIGA 4MYCA 2BIFA 5IT4A 3FUWA 3UOWA 1RXWA 4B3GA 3IODA 2LDBA 2PKRA 3PNMA 2V3CC 1NQVA 1NTRA 1QH1A 1LBTA 4RIFA 1EK6A 3CU5A 2LPMA 3LA6A 4US0R 5AOCA 5AVOA 3C41J 3M33A 4JDPA 4KQGA 3MT7A 1RU3A 3LDGA 4GUDA 1WKVA 4QECA 5DFAA 2ABWA 3UK7A 2NQ8A 3G2LA 3BXGA 2EJTA 4UTPA 4ZEMA 3UA3A 2FZWA 1I4EB 2HYDA 2CNDA 3IXMA 4Y2JA 5D86A 2PD6A 3S55A 1L4EA 5EPUA 2ICAA 2J7KA 2AD5A 4F5WA 1U94A 3HZRA 1GV1A 3FB1A 5TB5A 1QUEA 2C2OA 5ES3A 2PUAA 4B34A 4U7FA 5L95A 3SQNA 4GL4A 2VHZA 3D31A 3IR6A 1XTTA 2VUHB 2F48A 2A0XA 1I14A 1Z17A 4K9RA 4J4TA 5DLPA 2QAGB 5EERA 3OY2A 4Q47A 2FETA 3TQOA 4CM9A 5KOHB 3OQMA 3TOSA 3GGOA 3VAAA 2O9JA 3B1VA 4WHMA 5DCUA 4Z54A 2QVGA 2CJXA 1RHMA 3IP5A 3UFXA 1XUOA 3L0ZA 4R8RA 4EAAA 4F4FA 4BNTA 1RKQA 2A84A 3FTPA 3H9GA 2DBYA 3RRBA 4TUYB 2XY4A 5J2TB 5DEOA 5ALGA 3L7OA 2ZRJA 3M2PA 3SQXA 5HJ2A 1OPXA 3KYDB 5KJ6A 1UWCA 3QX7A 1OFVA 1EFHA 1UMKA 1VFPA 2ZRIA 4GI5A 4HDSB 3QU4A 3U3OA 1G20B 2W6QA 1A8SA 3PNKA 3TQHA 5KHLB 3CTMA 2NGRA 4RGVA 1XTJA 3WG9A 4D25A 2GZ1A 1J20A 1Q22A 4HNTA 4B80A 3CZ5A 3TECE 3PQFA 3I01A 2O5VA 4OQQA 1JXMA 5JSZB 1A77A 1H8HA 1S02A