The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
143
|
structure length |
131
|
Chain Sequence |
DKVMVVAEVRPSEDVNKVLSAISNFFDFEKMNTGIIDILVLEARTLKSLLKFHRVLRNERILDSARKYLMKGIEGNTIAFMIHKQAAAVGVLSFVAIKFYIEYQNPKEIVDWLAPKTAHGVPLWDNPVPPD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
UPF0201 protein SSO1042
|
publication title |
UPF201 archaeal specific family members reveal structural similarity to RNA-binding proteins but low likelihood for RNA-binding function.
pubmed doi rcsb |
source organism |
Sulfolobus solfataricus
|
total genus |
35
|
structure length |
131
|
sequence length |
143
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2006-11-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01877 | RNA_binding | RNA binding |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | 50s Ribosomal Protein L5; Chain: A, | 50s Ribosomal Protein L5; Chain: A, |
#chains in the Genus database with same CATH superfamily 5H1S H; 4WFN D; 3CCQ D; 1YJ9 D; 3CF5 D; 1KC8 F; 1M1K F; 2ZJQ D; 1W2B D; 1YI2 D; 3CCS D; 5GAE F; 1N8R F; 3I56 D; 3CCR D; 1K73 F; 2NWU A; 2OGK A; 3D7A A; 2NRQ A; 2QA4 D; 1MJI A; 3CCM D; 1Q7Y F; 4WF9 D; 4WCE D; 1QVG D; 2OTJ D; 1VQK D; 3CCV D; 3CME D; 2PZZ A; 3CCE D; 2ZJR D; 3DLL D; 1Q86 F; 1VQP D; 3G4S D; 1NJI F; 2OTL D; 1K9M F; 1VQ4 D; 4WFA D; 1VQ5 D; 2ZJP D; 1YIJ D; 1VQO D; 5DM6 D; 3PIP D; 5GAG F; 3CCJ D; 1YHQ D; 1YJN D; 5HL7 D; 1Q81 F; 1YJW D; 4WFB D; 4IOC D; 5GAH F; 3CCU D; 1IQ4 A; 3PIO D; 3CMA D; 4UY8 F; 1KD1 F; 1VQN D; 3CC4 D; 3G6E D; 1JJ2 D; 2WNY A; 2QEX D; 1VQ9 D; 4IOA D; 3J7Z F; 1VQM D; 5MLC G; 1VQ6 D; 3C9G A; 5DM7 D; 3I55 D; 1M90 F; 4IO9 D; 1VQ7 D; 3CC7 D; 1VQL D; 3CD6 D; 5GAD F; 5JVH D; 1YIT D; 3CCL D; 1QVF D; 3CC2 D; 1Q82 F; 1S72 D; 1KQS D; 1K8A F; 3OW2 D; 1VQ8 D; 3G71 D; 3CPW D; 3CXC D; 4U67 D; 5JVG D; #chains in the Genus database with same CATH topology 5H1S H; 4WFN D; 3CCQ D; 1YJ9 D; 3CF5 D; 1KC8 F; 1M1K F; 2ZJQ D; 1W2B D; 1YI2 D; 3CCS D; 5GAE F; 1N8R F; 3I56 D; 3CCR D; 1K73 F; 2NWU A; 2OGK A; 3D7A A; 2NRQ A; 2QA4 D; 1MJI A; 3CCM D; 1Q7Y F; 4WF9 D; 4WCE D; 1QVG D; 2OTJ D; 1VQK D; 3CCV D; 3CME D; 2PZZ A; 3CCE D; 2ZJR D; 3DLL D; 1Q86 F; 1VQP D; 3G4S D; 1NJI F; 2OTL D; 1K9M F; 1VQ4 D; 4WFA D; 1VQ5 D; 2ZJP D; 1YIJ D; 1VQO D; 5DM6 D; 3PIP D; 5GAG F; 3CCJ D; 1YHQ D; 1YJN D; 5HL7 D; 1Q81 F; 1YJW D; 4WFB D; 4IOC D; 5GAH F; 3CCU D; 1IQ4 A; 3PIO D; 3CMA D; 4UY8 F; 1KD1 F; 1VQN D; 3CC4 D; 3G6E D; 1JJ2 D; 2WNY A; 2QEX D; 1VQ9 D; 4IOA D; 3J7Z F; 1VQM D; 5MLC G; 1VQ6 D; 3C9G A; 5DM7 D; 3I55 D; 1M90 F; 4IO9 D; 1VQ7 D; 3CC7 D; 1VQL D; 3CD6 D; 5GAD F; 5JVH D; 1YIT D; 3CCL D; 1QVF D; 3CC2 D; 1Q82 F; 1S72 D; 1KQS D; 1K8A F; 3OW2 D; 1VQ8 D; 3G71 D; 3CPW D; 3CXC D; 4U67 D; 5JVG D; #chains in the Genus database with same CATH homology 5H1S H; 4WFN D; 3CCQ D; 1YJ9 D; 3CF5 D; 1KC8 F; 1M1K F; 2ZJQ D; 1W2B D; 1YI2 D; 3CCS D; 5GAE F; 1N8R F; 3I56 D; 3CCR D; 1K73 F; 2NWU A; 2OGK A; 3D7A A; 2NRQ A; 2QA4 D; 1MJI A; 3CCM D; 1Q7Y F; 4WF9 D; 4WCE D; 1QVG D; 2OTJ D; 1VQK D; 3CCV D; 3CME D; 2PZZ A; 3CCE D; 2ZJR D; 3DLL D; 1Q86 F; 1VQP D; 3G4S D; 1NJI F; 2OTL D; 1K9M F; 1VQ4 D; 4WFA D; 1VQ5 D; 2ZJP D; 1YIJ D; 1VQO D; 5DM6 D; 3PIP D; 5GAG F; 3CCJ D; 1YHQ D; 1YJN D; 5HL7 D; 1Q81 F; 1YJW D; 4WFB D; 4IOC D; 5GAH F; 3CCU D; 1IQ4 A; 3PIO D; 3CMA D; 4UY8 F; 1KD1 F; 1VQN D; 3CC4 D; 3G6E D; 1JJ2 D; 2WNY A; 2QEX D; 1VQ9 D; 4IOA D; 3J7Z F; 1VQM D; 5MLC G; 1VQ6 D; 3C9G A; 5DM7 D; 3I55 D; 1M90 F; 4IO9 D; 1VQ7 D; 3CC7 D; 1VQL D; 3CD6 D; 5GAD F; 5JVH D; 1YIT D; 3CCL D; 1QVF D; 3CC2 D; 1Q82 F; 1S72 D; 1KQS D; 1K8A F; 3OW2 D; 1VQ8 D; 3G71 D; 3CPW D; 3CXC D; 4U67 D; 5JVG D;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...