2NXFA

Crystal structure of a dimetal phosphatase from danio rerio loc 393393
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
320
structure length
314
Chain Sequence
DPVFTFGLIADVQYADIEDGENYLRTRRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRRDASDRALDTVMAELDACSVDVHHVWGNHEFYNFSRPSLLSSRLNSAQGSDLIGDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEESEKHTHSWRILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVLSVLRSHQSVLCFIAGHDHDGGRCTDSSGAQHITLEGVIETPPHSHAFATAYLYEDRMVMKGRGRVEDLTITYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a dimetal phosphatase from Danio rerio LOC 393393
rcsb
source organism Danio rerio
molecule tags Metal binding protein
molecule keywords Putative dimetal phosphatase
total genus 119
structure length 314
sequence length 320
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nxfA01
3QFOA 2NYLC 2O8AA 2BDXA 4H1YP 1NNWA 1HPUA 4Q7FA 4V0WA 2Z1AA 2WDDA 4H1SA 5JPFA 2AHDA 3H62B 4IL1A 5C1VA 2ZBMA 3AUZA 2XMOA 4FBWA 2NXFA 1II7A 2QFRA 2CV9A 4M0VA 1WARA 1OI8A 1XM7A 5IOHA 2IE4C 2Z72A 3K7WC 3T1IA 3IVEA 1AUIA 4JA9A 1Z2XA 3DSCA 4I5LC 3RL4A 1QHWA 3EGHA 3JYFA 3H66A 2WDCA 2NYMC 2QJCA 1T70A 1Z2WA 3C9FA 1U32A 4KKZA 5INBA 5JPEA 5DNYA 2IAEC 3K7VC 3THNA 2Q8UA 3LL8A 2HYPA 1UF3A 2JOGA 1UTEA 3QFKA 2WDFA 3TGHA 3RL3A 2HY1A 5JJTA 4LU9A 4ZVZA 3IVDA 3H60A 4MOYA 4TUIA 1G5BA 1OIDA 2NPPC 3H67A 2BCDA 4O43A 1IT6A 5GTUA 1W24A 4H2BA 1S3LA 3IB7A 4LTYA 4WWLA 3THOB 3RQZA 3DSDA 3P71C 4O24A 5HPEA 1HO5A 4H2IA 2BQ8X 3H69A 2R17A 4O5GA 3ZU0A 1USHA 4TUGA 4UT3B 4V0XA 2IE3C 2P6BA 3H63A 3H64A 2A22A 4I5NC 4ORCA 4F0ZA 3RL5A 3AV0A 1S95A 4J6OA 1XZWA 1HP1A 4MOVA 4UT3A 4FBQA 4UWQA 3PSOA 4LACC 4ORBA 3QG5C 5EQVA 2GJUA 2WDEA 3EGGA 2DFJA 1KBPA 1S3MA 4YKEA 1QFCA 1V73A 3FGAC 1SU1A 3E7BA 5J28A 5B8IA 2Z06A 3C5WC 4H2GA 3KBPA 2HYOA 3E7AA 4B2OA 4KBPA 4DHLA 4UT2A 1S3NA 4FBKA 1TCOA 1S8EA 4MP0A 3ZTVA 3GVEA 3H61A 4G9JA 4O4KA 4DT2A 1M63A 4DSYA 2YVTA 3H68A 3PSNA 4FCXA 1WAO1 4NZVA 2O8GA 3QFMA 4IYPC 3N5UA 4JA7A 1OIEA 2QFPA 3CK2A 3V4YA 4OR9A 1JK7A 2USHA 4HD0A 3ICFA 3HVQA 1FJMA 4H2FA 4XPNA 1T71A 5F3WA 2KKNA 3QFNA 1MF8A 3DW8C 3IB8A 4ORAA 4ZX2A 4V0VA 1S70A
chains in the Genus database with same CATH superfamily
3D03A 3QFOA 2NYLC 2O8AA 2DXNA 2BDXA 4H1YP 1NNWA 1HPUA 4Q7FA 4V0WA 2Z1AA 2WDDA 4H1SA 5JPFA 2AHDA 3H62B 4IL1A 5C1VA 2ZBMA 3AUZA 2XMOA 4FBWA 2NXFA 1II7A 2QFRA 2CV9A 4M0VA 1WARA 1OI8A 1XM7A 5IOHA 2IE4C 2Z72A 2DXLA 3FLOA 3K7WC 3T1IA 3IVEA 1AUIA 4JA9A 1Z2XA 3DSCA 4I5LC 3RL4A 1QHWA 3EGHA 3JYFA 3H66A 2WDCA 2NYMC 2QJCA 1T70A 1Z2WA 3C9FA 1U32A 4KKZA 5INBA 5JPEA 5DNYA 2IAEC 3K7VC 3THNA 2Q8UA 3LL8A 2YEQA 2HYPA 1UF3A 2JOGA 1UTEA 3QFKA 2WDFA 3TGHA 3RL3A 2HY1A 5JJTA 4LU9A 4ZVZA 3IVDA 3H60A 4MOYA 4TUIA 1G5BA 1OIDA 2NPPC 3H67A 2BCDA 4O43A 1IT6A 3E0JA 5GTUA 1W24A 4H2BA 1S3LA 3IB7A 4LTYA 4WWLA 3THOB 3RQZA 3DSDA 3P71C 4O24A 5HPEA 1HO5A 4H2IA 2BQ8X 3H69A 2R17A 4O5GA 3ZU0A 1USHA 4TUGA 4UT3B 4V0XA 2IE3C 2P6BA 2ZOAA 3H63A 3H64A 2A22A 4I5NC 4ORCA 4F0ZA 3RL5A 3AV0A 1S95A 4J6OA 1XZWA 1HP1A 4MOVA 4UT3A 4FBQA 4UWQA 3PSOA 4LACC 4ORBA 3QG5C 5EQVA 2GJUA 2WDEA 3EGGA 2DFJA 1KBPA 1S3MA 4YKEA 1QFCA 1V73A 3FGAC 1SU1A 3E7BA 5J28A 2ZO9B 2Z06A 5B8IA 3C5WC 4H2GA 3KBPA 2HYOA 3E7AA 4B2OA 4KBPA 4DHLA 4UT2A 1S3NA 4FBKA 1TCOA 1S8EA 4MP0A 3ZTVA 3GVEA 3H61A 4G9JA 4O4KA 4DT2A 1M63A 4DSYA 2YVTA 3H68A 3PSNA 4FCXA 1WAO1 4NZVA 2O8GA 3QFMA 4IYPC 3N5UA 4JA7A 1OIEA 2QFPA 3CK2A 3V4YA 4OR9A 1JK7A 2USHA 4HD0A 3ICFA 3HVQA 1FJMA 4H2FA 4XPNA 1T71A 5F3WA 2KKNA 3QFNA 1MF8A 3DW8C 3IB8A 4ORAA 4ZX2A 4V0VA 1S70A
chains in the Genus database with same CATH topology
3D03A 3QFOA 2NYLC 2O8AA 2DXNA 2BDXA 4H1YP 1NNWA 1HPUA 4Q7FA 4V0WA 2Z1AA 2WDDA 4H1SA 5JPFA 2AHDA 3H62B 4IL1A 5C1VA 2ZBMA 3AUZA 2XMOA 4FBWA 2NXFA 1II7A 2QFRA 2CV9A 4M0VA 1WARA 1OI8A 1XM7A 5IOHA 2IE4C 2Z72A 2DXLA 3FLOA 3K7WC 3T1IA 3IVEA 1AUIA 4JA9A 1Z2XA 3DSCA 4I5LC 3RL4A 1QHWA 3EGHA 3JYFA 3H66A 2WDCA 2NYMC 2QJCA 1T70A 1Z2WA 3C9FA 1U32A 4KKZA 5INBA 5JPEA 5DNYA 2IAEC 3K7VC 3THNA 2Q8UA 3LL8A 2YEQA 2HYPA 1UF3A 2JOGA 1UTEA 3QFKA 2WDFA 3TGHA 3RL3A 2HY1A 5JJTA 4LU9A 4ZVZA 3IVDA 3H60A 4MOYA 4TUIA 1G5BA 1OIDA 2NPPC 3H67A 2BCDA 4O43A 1IT6A 3E0JA 5GTUA 1W24A 4H2BA 1S3LA 3IB7A 4LTYA 4WWLA 3THOB 3RQZA 3DSDA 3P71C 4O24A 5HPEA 1HO5A 4H2IA 2BQ8X 3H69A 2R17A 4O5GA 3ZU0A 1USHA 4TUGA 4UT3B 4V0XA 2IE3C 2P6BA 2ZOAA 3H63A 3H64A 2A22A 4I5NC 4ORCA 4F0ZA 3RL5A 3AV0A 1S95A 4J6OA 1XZWA 1HP1A 4MOVA 4UT3A 4FBQA 4UWQA 3PSOA 4LACC 4ORBA 3QG5C 5EQVA 2GJUA 2WDEA 3EGGA 2DFJA 1KBPA 1S3MA 4YKEA 1QFCA 1V73A 3FGAC 1SU1A 3E7BA 5J28A 2ZO9B 2Z06A 5B8IA 3C5WC 4H2GA 3KBPA 2HYOA 3E7AA 4B2OA 4KBPA 4DHLA 4UT2A 1S3NA 4FBKA 1TCOA 1S8EA 4MP0A 3ZTVA 3GVEA 3H61A 4G9JA 4O4KA 4DT2A 1M63A 4DSYA 2YVTA 3H68A 3PSNA 4FCXA 1WAO1 4NZVA 2O8GA 3QFMA 4IYPC 3N5UA 4JA7A 1OIEA 2QFPA 3CK2A 3V4YA 4OR9A 1JK7A 2USHA 4HD0A 3ICFA 3HVQA 1FJMA 4H2FA 4XPNA 1T71A 5F3WA 2KKNA 3QFNA 1MF8A 3DW8C 3IB8A 4ORAA 4ZX2A 4V0VA 1S70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QFO A;  2NYL C;  2O8A A;  2BDX A;  4H1Y P;  1NNW A;  1HPU A;  4Q7F A;  4V0W A;  2Z1A A;  2WDD A;  4H1S A;  5JPF A;  2AHD A;  3H62 B;  4IL1 A;  5C1V A;  2ZBM A;  3AUZ A;  2XMO A;  4FBW A;  2NXF A;  1II7 A;  2QFR A;  2CV9 A;  4M0V A;  1WAR A;  1OI8 A;  1XM7 A;  5IOH A;  2IE4 C;  2Z72 A;  3K7W C;  3T1I A;  3IVE A;  1AUI A;  4JA9 A;  1Z2X A;  3DSC A;  4I5L C;  3RL4 A;  1QHW A;  3EGH A;  3JYF A;  3H66 A;  2WDC A;  2NYM C;  2QJC A;  1T70 A;  1Z2W A;  3C9F A;  1U32 A;  4KKZ A;  5INB A;  5JPE A;  5DNY A;  2IAE C;  3K7V C;  3THN A;  2Q8U A;  3LL8 A;  2HYP A;  1UF3 A;  2JOG A;  1UTE A;  3QFK A;  2WDF A;  3TGH A;  3RL3 A;  2HY1 A;  5JJT A;  4LU9 A;  4ZVZ A;  3IVD A;  3H60 A;  4MOY A;  4TUI A;  1G5B A;  1OID A;  2NPP C;  3H67 A;  2BCD A;  4O43 A;  1IT6 A;  5GTU A;  1W24 A;  4H2B A;  1S3L A;  3IB7 A;  4LTY A;  4WWL A;  3THO B;  3RQZ A;  3DSD A;  3P71 C;  4O24 A;  5HPE A;  1HO5 A;  4H2I A;  2BQ8 X;  3H69 A;  2R17 A;  4O5G A;  3ZU0 A;  1USH A;  4TUG A;  4UT3 B;  4V0X A;  2IE3 C;  2P6B A;  3H63 A;  3H64 A;  2A22 A;  4I5N C;  4ORC A;  4F0Z A;  3RL5 A;  3AV0 A;  1S95 A;  4J6O A;  1XZW A;  1HP1 A;  4MOV A;  4UT3 A;  4FBQ A;  4UWQ A;  3PSO A;  4LAC C;  4ORB A;  3QG5 C;  5EQV A;  2GJU A;  2WDE A;  3EGG A;  2DFJ A;  1KBP A;  1S3M A;  4YKE A;  1QFC A;  1V73 A;  3FGA C;  1SU1 A;  3E7B A;  5J28 A;  5B8I A;  2Z06 A;  3C5W C;  4H2G A;  3KBP A;  2HYO A;  3E7A A;  4B2O A;  4KBP A;  4DHL A;  4UT2 A;  1S3N A;  4FBK A;  1TCO A;  1S8E A;  4MP0 A;  3ZTV A;  3GVE A;  3H61 A;  4G9J A;  4O4K A;  4DT2 A;  1M63 A;  4DSY A;  2YVT A;  3H68 A;  3PSN A;  4FCX A;  1WAO 1;  4NZV A;  2O8G A;  3QFM A;  4IYP C;  3N5U A;  4JA7 A;  1OIE A;  2QFP A;  3CK2 A;  3V4Y A;  4OR9 A;  1JK7 A;  2USH A;  4HD0 A;  3ICF A;  3HVQ A;  1FJM A;  4H2F A;  4XPN A;  1T71 A;  5F3W A;  2KKN A;  3QFN A;  1MF8 A;  3DW8 C;  3IB8 A;  4ORA A;  4ZX2 A;  4V0V A;  1S70 A; 
#chains in the Genus database with same CATH topology
 3D03 A;  3QFO A;  2NYL C;  2O8A A;  2DXN A;  2BDX A;  4H1Y P;  1NNW A;  1HPU A;  4Q7F A;  4V0W A;  2Z1A A;  2WDD A;  4H1S A;  5JPF A;  2AHD A;  3H62 B;  4IL1 A;  5C1V A;  2ZBM A;  3AUZ A;  2XMO A;  4FBW A;  2NXF A;  1II7 A;  2QFR A;  2CV9 A;  4M0V A;  1WAR A;  1OI8 A;  1XM7 A;  5IOH A;  2IE4 C;  2Z72 A;  2DXL A;  3FLO A;  3K7W C;  3T1I A;  3IVE A;  1AUI A;  4JA9 A;  1Z2X A;  3DSC A;  4I5L C;  3RL4 A;  1QHW A;  3EGH A;  3JYF A;  3H66 A;  2WDC A;  2NYM C;  2QJC A;  1T70 A;  1Z2W A;  3C9F A;  1U32 A;  4KKZ A;  5INB A;  5JPE A;  5DNY A;  2IAE C;  3K7V C;  3THN A;  2Q8U A;  3LL8 A;  2YEQ A;  2HYP A;  1UF3 A;  2JOG A;  1UTE A;  3QFK A;  2WDF A;  3TGH A;  3RL3 A;  2HY1 A;  5JJT A;  4LU9 A;  4ZVZ A;  3IVD A;  3H60 A;  4MOY A;  4TUI A;  1G5B A;  1OID A;  2NPP C;  3H67 A;  2BCD A;  4O43 A;  1IT6 A;  3E0J A;  5GTU A;  1W24 A;  4H2B A;  1S3L A;  3IB7 A;  4LTY A;  4WWL A;  3THO B;  3RQZ A;  3DSD A;  3P71 C;  4O24 A;  5HPE A;  1HO5 A;  4H2I A;  2BQ8 X;  3H69 A;  2R17 A;  4O5G A;  3ZU0 A;  1USH A;  4TUG A;  4UT3 B;  4V0X A;  2IE3 C;  2P6B A;  2ZOA A;  3H63 A;  3H64 A;  2A22 A;  4I5N C;  4ORC A;  4F0Z A;  3RL5 A;  3AV0 A;  1S95 A;  4J6O A;  1XZW A;  1HP1 A;  4MOV A;  4UT3 A;  4FBQ A;  4UWQ A;  3PSO A;  4LAC C;  4ORB A;  3QG5 C;  5EQV A;  2GJU A;  2WDE A;  3EGG A;  2DFJ A;  1KBP A;  1S3M A;  4YKE A;  1QFC A;  1V73 A;  3FGA C;  1SU1 A;  3E7B A;  5J28 A;  2ZO9 B;  2Z06 A;  5B8I A;  3C5W C;  4H2G A;  3KBP A;  2HYO A;  3E7A A;  4B2O A;  4KBP A;  4DHL A;  4UT2 A;  1S3N A;  4FBK A;  1TCO A;  1S8E A;  4MP0 A;  3ZTV A;  3GVE A;  3H61 A;  4G9J A;  4O4K A;  4DT2 A;  1M63 A;  4DSY A;  2YVT A;  3H68 A;  3PSN A;  4FCX A;  1WAO 1;  4NZV A;  2O8G A;  3QFM A;  4IYP C;  3N5U A;  4JA7 A;  1OIE A;  2QFP A;  3CK2 A;  3V4Y A;  4OR9 A;  1JK7 A;  2USH A;  4HD0 A;  3ICF A;  3HVQ A;  1FJM A;  4H2F A;  4XPN A;  1T71 A;  5F3W A;  2KKN A;  3QFN A;  1MF8 A;  3DW8 C;  3IB8 A;  4ORA A;  4ZX2 A;  4V0V A;  1S70 A; 
#chains in the Genus database with same CATH homology
 3D03 A;  3QFO A;  2NYL C;  2O8A A;  2DXN A;  2BDX A;  4H1Y P;  1NNW A;  1HPU A;  4Q7F A;  4V0W A;  2Z1A A;  2WDD A;  4H1S A;  5JPF A;  2AHD A;  3H62 B;  4IL1 A;  5C1V A;  2ZBM A;  3AUZ A;  2XMO A;  4FBW A;  2NXF A;  1II7 A;  2QFR A;  2CV9 A;  4M0V A;  1WAR A;  1OI8 A;  1XM7 A;  5IOH A;  2IE4 C;  2Z72 A;  2DXL A;  3FLO A;  3K7W C;  3T1I A;  3IVE A;  1AUI A;  4JA9 A;  1Z2X A;  3DSC A;  4I5L C;  3RL4 A;  1QHW A;  3EGH A;  3JYF A;  3H66 A;  2WDC A;  2NYM C;  2QJC A;  1T70 A;  1Z2W A;  3C9F A;  1U32 A;  4KKZ A;  5INB A;  5JPE A;  5DNY A;  2IAE C;  3K7V C;  3THN A;  2Q8U A;  3LL8 A;  2YEQ A;  2HYP A;  1UF3 A;  2JOG A;  1UTE A;  3QFK A;  2WDF A;  3TGH A;  3RL3 A;  2HY1 A;  5JJT A;  4LU9 A;  4ZVZ A;  3IVD A;  3H60 A;  4MOY A;  4TUI A;  1G5B A;  1OID A;  2NPP C;  3H67 A;  2BCD A;  4O43 A;  1IT6 A;  3E0J A;  5GTU A;  1W24 A;  4H2B A;  1S3L A;  3IB7 A;  4LTY A;  4WWL A;  3THO B;  3RQZ A;  3DSD A;  3P71 C;  4O24 A;  5HPE A;  1HO5 A;  4H2I A;  2BQ8 X;  3H69 A;  2R17 A;  4O5G A;  3ZU0 A;  1USH A;  4TUG A;  4UT3 B;  4V0X A;  2IE3 C;  2P6B A;  2ZOA A;  3H63 A;  3H64 A;  2A22 A;  4I5N C;  4ORC A;  4F0Z A;  3RL5 A;  3AV0 A;  1S95 A;  4J6O A;  1XZW A;  1HP1 A;  4MOV A;  4UT3 A;  4FBQ A;  4UWQ A;  3PSO A;  4LAC C;  4ORB A;  3QG5 C;  5EQV A;  2GJU A;  2WDE A;  3EGG A;  2DFJ A;  1KBP A;  1S3M A;  4YKE A;  1QFC A;  1V73 A;  3FGA C;  1SU1 A;  3E7B A;  5J28 A;  2ZO9 B;  2Z06 A;  5B8I A;  3C5W C;  4H2G A;  3KBP A;  2HYO A;  3E7A A;  4B2O A;  4KBP A;  4DHL A;  4UT2 A;  1S3N A;  4FBK A;  1TCO A;  1S8E A;  4MP0 A;  3ZTV A;  3GVE A;  3H61 A;  4G9J A;  4O4K A;  4DT2 A;  1M63 A;  4DSY A;  2YVT A;  3H68 A;  3PSN A;  4FCX A;  1WAO 1;  4NZV A;  2O8G A;  3QFM A;  4IYP C;  3N5U A;  4JA7 A;  1OIE A;  2QFP A;  3CK2 A;  3V4Y A;  4OR9 A;  1JK7 A;  2USH A;  4HD0 A;  3ICF A;  3HVQ A;  1FJM A;  4H2F A;  4XPN A;  1T71 A;  5F3W A;  2KKN A;  3QFN A;  1MF8 A;  3DW8 C;  3IB8 A;  4ORA A;  4ZX2 A;  4V0V A;  1S70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...