2NXFA

Crystal structure of a dimetal phosphatase from danio rerio loc 393393
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
320
structure length
314
Chain Sequence
DPVFTFGLIADVQYADIEDGENYLRTRRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRRDASDRALDTVMAELDACSVDVHHVWGNHEFYNFSRPSLLSSRLNSAQGSDLIGDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEESEKHTHSWRILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVLSVLRSHQSVLCFIAGHDHDGGRCTDSSGAQHITLEGVIETPPHSHAFATAYLYEDRMVMKGRGRVEDLTITYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dimetal phosphatase
publication title Crystal Structure of a dimetal phosphatase from Danio rerio LOC 393393
rcsb
source organism Danio rerio
molecule tags Metal binding protein
total genus 119
structure length 314
sequence length 320
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nxfA01
3H68A 1S3NA 2O8AA 4UT3B 4V0VA 4JA7A 1IT6A 2WDFA 3QG5C 3K7VC 2NYMC 2QFPA 3AV0A 5IOHA 2BQ8X 3CK2A 5JPEA 1M63A 1T71A 5INBA 1UTEA 3QFNA 4XPNA 1Z2XA 4FCXA 2WDCA 4OR9A 3N5UA 4I5LC 4V0WA 2Z72A 2WDEA 2YVTA 3GVEA 3H62B 3QFOA 1JK7A 1HPUA 4ORAA 5C1VA 5B8IA 3H69A 5JPFA 2BCDA 2DFJA 3RL5A 4H1SA 3IB8A 1MF8A 4J6OA 4LU9A 4F0ZA 1QHWA 2ZBMA 4IYPC 3KBPA 4H2BA 4DHLA 2Z06A 4FBKA 2QFRA 3QFMA 1KBPA 1OIEA 4O4KA 2GJUA 3C5WC 4M0VA 2NPPC 1OIDA 1FJMA 1W24A 4DSYA 1XZWA 3DSCA 1SU1A 5JJTA 4JA9A 2QJCA 1TCOA 4FBQA 1HP1A 3RL4A 1OI8A 4UT2A 4WWLA 2JOGA 2Q8UA 2IE4C 3H67A 4O5GA 4IL1A 3THOB 1QFCA 3QFKA 3E7AA 3HVQA 4H2GA 3IVDA 2HY1A 2BDXA 4LTYA 3TGHA 1WAO1 3ZTVA 2NYLC 3E7BA 3ICFA 4H2FA 3FGAC 4TUGA 1S3LA 4G9JA 4UWQA 2Z1AA 3ZU0A 4B2OA 1UF3A 3EGHA 4ZVZA 3H60A 1WARA 3H64A 3H66A 3IB7A 3LL8A 3PSOA 4MOYA 4YKEA 1U32A 4I5NC 2O8GA 2WDDA 1S3MA 3P71C 4ORCA 4Q7FA 3PSNA 2R17A 4KKZA 4UT3A 1USHA 3T1IA 3V4YA 3EGGA 3DW8C 5F3WA 4ZX2A 1S8EA 1XM7A 5GTUA 2P6BA 4O24A 2IE3C 3AUZA 1HO5A 1V73A 1Z2WA 3K7WC 4H2IA 4KBPA 4ORBA 3H63A 4HD0A 4O43A 3C9FA 4H1YP 4FBWA 3DSDA 2KKNA 3RL3A 2IAEC 1II7A 4MOVA 2CV9A 3H61A 2A22A 2USHA 3JYFA 1T70A 4LACC 1G5BA 4V0XA 1S95A 1AUIA 3RQZA 2HYPA 5J28A 4TUIA 5DNYA 2NXFA 2XMOA 4NZVA 4DT2A 3IVEA 4MP0A 5EQVA 2AHDA 1NNWA 5HPEA 3THNA 1S70A 2HYOA
chains in the Genus database with same CATH superfamily
3H68A 1S3NA 2O8AA 4UT3B 4V0VA 4JA7A 1IT6A 2WDFA 2ZOAA 3QG5C 3K7VC 2NYMC 2QFPA 3AV0A 5IOHA 2BQ8X 3CK2A 5JPEA 1M63A 1T71A 5INBA 1UTEA 2DXLA 3QFNA 4XPNA 1Z2XA 4FCXA 2WDCA 4OR9A 3N5UA 2ZO9B 4I5LC 4V0WA 2Z72A 2WDEA 2YVTA 3GVEA 3H62B 3QFOA 1JK7A 1HPUA 4ORAA 5C1VA 5B8IA 3H69A 5JPFA 2BCDA 2DFJA 3RL5A 4H1SA 3IB8A 1MF8A 4J6OA 4LU9A 4F0ZA 1QHWA 2ZBMA 4IYPC 3KBPA 4H2BA 4DHLA 2Z06A 4FBKA 2QFRA 3QFMA 1KBPA 1OIEA 4O4KA 2GJUA 3C5WC 4M0VA 2NPPC 1OIDA 1FJMA 1W24A 4DSYA 1XZWA 3DSCA 1SU1A 5JJTA 4JA9A 2QJCA 1TCOA 4FBQA 1HP1A 3RL4A 3E0JA 1OI8A 4UT2A 4WWLA 2JOGA 2Q8UA 2IE4C 3H67A 4O5GA 3D03A 4IL1A 3THOB 1QFCA 3QFKA 3E7AA 3HVQA 4H2GA 3IVDA 2HY1A 2BDXA 4LTYA 3TGHA 1WAO1 3ZTVA 2NYLC 3E7BA 3ICFA 4H2FA 3FGAC 4TUGA 2YEQA 1S3LA 4G9JA 3FLOA 4UWQA 2Z1AA 3ZU0A 4B2OA 1UF3A 3EGHA 4ZVZA 3H60A 1WARA 3H64A 3H66A 3IB7A 3LL8A 3PSOA 4MOYA 4YKEA 1U32A 4I5NC 2O8GA 2WDDA 1S3MA 3P71C 4ORCA 4Q7FA 3PSNA 2R17A 4KKZA 4UT3A 1USHA 3T1IA 3V4YA 3EGGA 3DW8C 5F3WA 4ZX2A 1S8EA 1XM7A 5GTUA 2P6BA 4O24A 2IE3C 3AUZA 1HO5A 1V73A 1Z2WA 3K7WC 4H2IA 4KBPA 4ORBA 3H63A 4HD0A 4O43A 3C9FA 4H1YP 4FBWA 3DSDA 2KKNA 3RL3A 2IAEC 1II7A 4MOVA 2DXNA 2CV9A 3H61A 2A22A 2USHA 3JYFA 1T70A 4LACC 1G5BA 4V0XA 1S95A 1AUIA 3RQZA 2HYPA 5J28A 4TUIA 5DNYA 2NXFA 2XMOA 4NZVA 4DT2A 3IVEA 4MP0A 5EQVA 2AHDA 1NNWA 5HPEA 3THNA 1S70A 2HYOA
chains in the Genus database with same CATH topology
3H68A 1S3NA 2O8AA 4UT3B 4V0VA 4JA7A 1IT6A 2WDFA 2ZOAA 3QG5C 3K7VC 2NYMC 2QFPA 3AV0A 5IOHA 2BQ8X 3CK2A 5JPEA 1M63A 1T71A 5INBA 1UTEA 2DXLA 3QFNA 4XPNA 1Z2XA 4FCXA 2WDCA 4OR9A 3N5UA 2ZO9B 4I5LC 4V0WA 2Z72A 2WDEA 2YVTA 3GVEA 3H62B 3QFOA 1JK7A 1HPUA 4ORAA 5C1VA 5B8IA 3H69A 5JPFA 2BCDA 2DFJA 3RL5A 4H1SA 3IB8A 1MF8A 4J6OA 4LU9A 4F0ZA 1QHWA 2ZBMA 4IYPC 3KBPA 4H2BA 4DHLA 2Z06A 4FBKA 2QFRA 3QFMA 1KBPA 1OIEA 4O4KA 2GJUA 3C5WC 4M0VA 2NPPC 1OIDA 1FJMA 1W24A 4DSYA 1XZWA 3DSCA 1SU1A 5JJTA 4JA9A 2QJCA 1TCOA 4FBQA 1HP1A 3RL4A 3E0JA 1OI8A 4UT2A 4WWLA 2JOGA 2Q8UA 2IE4C 3H67A 4O5GA 3D03A 4IL1A 3THOB 1QFCA 3QFKA 3E7AA 3HVQA 4H2GA 3IVDA 2HY1A 2BDXA 4LTYA 3TGHA 1WAO1 3ZTVA 2NYLC 3E7BA 3ICFA 4H2FA 3FGAC 4TUGA 2YEQA 1S3LA 4G9JA 3FLOA 4UWQA 2Z1AA 3ZU0A 4B2OA 1UF3A 3EGHA 4ZVZA 3H60A 1WARA 3H64A 3H66A 3IB7A 3LL8A 3PSOA 4MOYA 4YKEA 1U32A 4I5NC 2O8GA 2WDDA 1S3MA 3P71C 4ORCA 4Q7FA 3PSNA 2R17A 4KKZA 4UT3A 1USHA 3T1IA 3V4YA 3EGGA 3DW8C 5F3WA 4ZX2A 1S8EA 1XM7A 5GTUA 2P6BA 4O24A 2IE3C 3AUZA 1HO5A 1V73A 1Z2WA 3K7WC 4H2IA 4KBPA 4ORBA 3H63A 4HD0A 4O43A 3C9FA 4H1YP 4FBWA 3DSDA 2KKNA 3RL3A 2IAEC 1II7A 4MOVA 2DXNA 2CV9A 3H61A 2A22A 2USHA 3JYFA 1T70A 4LACC 1G5BA 4V0XA 1S95A 1AUIA 3RQZA 2HYPA 5J28A 4TUIA 5DNYA 2NXFA 2XMOA 4NZVA 4DT2A 3IVEA 4MP0A 5EQVA 2AHDA 1NNWA 5HPEA 3THNA 1S70A 2HYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H68 A;  1S3N A;  2O8A A;  4UT3 B;  4V0V A;  4JA7 A;  1IT6 A;  2WDF A;  3QG5 C;  3K7V C;  2NYM C;  2QFP A;  3AV0 A;  5IOH A;  2BQ8 X;  3CK2 A;  5JPE A;  1M63 A;  1T71 A;  5INB A;  1UTE A;  3QFN A;  4XPN A;  1Z2X A;  4FCX A;  2WDC A;  4OR9 A;  3N5U A;  4I5L C;  4V0W A;  2Z72 A;  2WDE A;  2YVT A;  3GVE A;  3H62 B;  3QFO A;  1JK7 A;  1HPU A;  4ORA A;  5C1V A;  5B8I A;  3H69 A;  5JPF A;  2BCD A;  2DFJ A;  3RL5 A;  4H1S A;  3IB8 A;  1MF8 A;  4J6O A;  4LU9 A;  4F0Z A;  1QHW A;  2ZBM A;  4IYP C;  3KBP A;  4H2B A;  4DHL A;  2Z06 A;  4FBK A;  2QFR A;  3QFM A;  1KBP A;  1OIE A;  4O4K A;  2GJU A;  3C5W C;  4M0V A;  2NPP C;  1OID A;  1FJM A;  1W24 A;  4DSY A;  1XZW A;  3DSC A;  1SU1 A;  5JJT A;  4JA9 A;  2QJC A;  1TCO A;  4FBQ A;  1HP1 A;  3RL4 A;  1OI8 A;  4UT2 A;  4WWL A;  2JOG A;  2Q8U A;  2IE4 C;  3H67 A;  4O5G A;  4IL1 A;  3THO B;  1QFC A;  3QFK A;  3E7A A;  3HVQ A;  4H2G A;  3IVD A;  2HY1 A;  2BDX A;  4LTY A;  3TGH A;  1WAO 1;  3ZTV A;  2NYL C;  3E7B A;  3ICF A;  4H2F A;  3FGA C;  4TUG A;  1S3L A;  4G9J A;  4UWQ A;  2Z1A A;  3ZU0 A;  4B2O A;  1UF3 A;  3EGH A;  4ZVZ A;  3H60 A;  1WAR A;  3H64 A;  3H66 A;  3IB7 A;  3LL8 A;  3PSO A;  4MOY A;  4YKE A;  1U32 A;  4I5N C;  2O8G A;  2WDD A;  1S3M A;  3P71 C;  4ORC A;  4Q7F A;  3PSN A;  2R17 A;  4KKZ A;  4UT3 A;  1USH A;  3T1I A;  3V4Y A;  3EGG A;  3DW8 C;  5F3W A;  4ZX2 A;  1S8E A;  1XM7 A;  5GTU A;  2P6B A;  4O24 A;  2IE3 C;  3AUZ A;  1HO5 A;  1V73 A;  1Z2W A;  3K7W C;  4H2I A;  4KBP A;  4ORB A;  3H63 A;  4HD0 A;  4O43 A;  3C9F A;  4H1Y P;  4FBW A;  3DSD A;  2KKN A;  3RL3 A;  2IAE C;  1II7 A;  4MOV A;  2CV9 A;  3H61 A;  2A22 A;  2USH A;  3JYF A;  1T70 A;  4LAC C;  1G5B A;  4V0X A;  1S95 A;  1AUI A;  3RQZ A;  2HYP A;  5J28 A;  4TUI A;  5DNY A;  2NXF A;  2XMO A;  4NZV A;  4DT2 A;  3IVE A;  4MP0 A;  5EQV A;  2AHD A;  1NNW A;  5HPE A;  3THN A;  1S70 A;  2HYO A; 
#chains in the Genus database with same CATH topology
 3H68 A;  1S3N A;  2O8A A;  4UT3 B;  4V0V A;  4JA7 A;  1IT6 A;  2WDF A;  2ZOA A;  3QG5 C;  3K7V C;  2NYM C;  2QFP A;  3AV0 A;  5IOH A;  2BQ8 X;  3CK2 A;  5JPE A;  1M63 A;  1T71 A;  5INB A;  1UTE A;  2DXL A;  3QFN A;  4XPN A;  1Z2X A;  4FCX A;  2WDC A;  4OR9 A;  3N5U A;  2ZO9 B;  4I5L C;  4V0W A;  2Z72 A;  2WDE A;  2YVT A;  3GVE A;  3H62 B;  3QFO A;  1JK7 A;  1HPU A;  4ORA A;  5C1V A;  5B8I A;  3H69 A;  5JPF A;  2BCD A;  2DFJ A;  3RL5 A;  4H1S A;  3IB8 A;  1MF8 A;  4J6O A;  4LU9 A;  4F0Z A;  1QHW A;  2ZBM A;  4IYP C;  3KBP A;  4H2B A;  4DHL A;  2Z06 A;  4FBK A;  2QFR A;  3QFM A;  1KBP A;  1OIE A;  4O4K A;  2GJU A;  3C5W C;  4M0V A;  2NPP C;  1OID A;  1FJM A;  1W24 A;  4DSY A;  1XZW A;  3DSC A;  1SU1 A;  5JJT A;  4JA9 A;  2QJC A;  1TCO A;  4FBQ A;  1HP1 A;  3RL4 A;  3E0J A;  1OI8 A;  4UT2 A;  4WWL A;  2JOG A;  2Q8U A;  2IE4 C;  3H67 A;  4O5G A;  3D03 A;  4IL1 A;  3THO B;  1QFC A;  3QFK A;  3E7A A;  3HVQ A;  4H2G A;  3IVD A;  2HY1 A;  2BDX A;  4LTY A;  3TGH A;  1WAO 1;  3ZTV A;  2NYL C;  3E7B A;  3ICF A;  4H2F A;  3FGA C;  4TUG A;  2YEQ A;  1S3L A;  4G9J A;  3FLO A;  4UWQ A;  2Z1A A;  3ZU0 A;  4B2O A;  1UF3 A;  3EGH A;  4ZVZ A;  3H60 A;  1WAR A;  3H64 A;  3H66 A;  3IB7 A;  3LL8 A;  3PSO A;  4MOY A;  4YKE A;  1U32 A;  4I5N C;  2O8G A;  2WDD A;  1S3M A;  3P71 C;  4ORC A;  4Q7F A;  3PSN A;  2R17 A;  4KKZ A;  4UT3 A;  1USH A;  3T1I A;  3V4Y A;  3EGG A;  3DW8 C;  5F3W A;  4ZX2 A;  1S8E A;  1XM7 A;  5GTU A;  2P6B A;  4O24 A;  2IE3 C;  3AUZ A;  1HO5 A;  1V73 A;  1Z2W A;  3K7W C;  4H2I A;  4KBP A;  4ORB A;  3H63 A;  4HD0 A;  4O43 A;  3C9F A;  4H1Y P;  4FBW A;  3DSD A;  2KKN A;  3RL3 A;  2IAE C;  1II7 A;  4MOV A;  2DXN A;  2CV9 A;  3H61 A;  2A22 A;  2USH A;  3JYF A;  1T70 A;  4LAC C;  1G5B A;  4V0X A;  1S95 A;  1AUI A;  3RQZ A;  2HYP A;  5J28 A;  4TUI A;  5DNY A;  2NXF A;  2XMO A;  4NZV A;  4DT2 A;  3IVE A;  4MP0 A;  5EQV A;  2AHD A;  1NNW A;  5HPE A;  3THN A;  1S70 A;  2HYO A; 
#chains in the Genus database with same CATH homology
 3H68 A;  1S3N A;  2O8A A;  4UT3 B;  4V0V A;  4JA7 A;  1IT6 A;  2WDF A;  2ZOA A;  3QG5 C;  3K7V C;  2NYM C;  2QFP A;  3AV0 A;  5IOH A;  2BQ8 X;  3CK2 A;  5JPE A;  1M63 A;  1T71 A;  5INB A;  1UTE A;  2DXL A;  3QFN A;  4XPN A;  1Z2X A;  4FCX A;  2WDC A;  4OR9 A;  3N5U A;  2ZO9 B;  4I5L C;  4V0W A;  2Z72 A;  2WDE A;  2YVT A;  3GVE A;  3H62 B;  3QFO A;  1JK7 A;  1HPU A;  4ORA A;  5C1V A;  5B8I A;  3H69 A;  5JPF A;  2BCD A;  2DFJ A;  3RL5 A;  4H1S A;  3IB8 A;  1MF8 A;  4J6O A;  4LU9 A;  4F0Z A;  1QHW A;  2ZBM A;  4IYP C;  3KBP A;  4H2B A;  4DHL A;  2Z06 A;  4FBK A;  2QFR A;  3QFM A;  1KBP A;  1OIE A;  4O4K A;  2GJU A;  3C5W C;  4M0V A;  2NPP C;  1OID A;  1FJM A;  1W24 A;  4DSY A;  1XZW A;  3DSC A;  1SU1 A;  5JJT A;  4JA9 A;  2QJC A;  1TCO A;  4FBQ A;  1HP1 A;  3RL4 A;  3E0J A;  1OI8 A;  4UT2 A;  4WWL A;  2JOG A;  2Q8U A;  2IE4 C;  3H67 A;  4O5G A;  3D03 A;  4IL1 A;  3THO B;  1QFC A;  3QFK A;  3E7A A;  3HVQ A;  4H2G A;  3IVD A;  2HY1 A;  2BDX A;  4LTY A;  3TGH A;  1WAO 1;  3ZTV A;  2NYL C;  3E7B A;  3ICF A;  4H2F A;  3FGA C;  4TUG A;  2YEQ A;  1S3L A;  4G9J A;  3FLO A;  4UWQ A;  2Z1A A;  3ZU0 A;  4B2O A;  1UF3 A;  3EGH A;  4ZVZ A;  3H60 A;  1WAR A;  3H64 A;  3H66 A;  3IB7 A;  3LL8 A;  3PSO A;  4MOY A;  4YKE A;  1U32 A;  4I5N C;  2O8G A;  2WDD A;  1S3M A;  3P71 C;  4ORC A;  4Q7F A;  3PSN A;  2R17 A;  4KKZ A;  4UT3 A;  1USH A;  3T1I A;  3V4Y A;  3EGG A;  3DW8 C;  5F3W A;  4ZX2 A;  1S8E A;  1XM7 A;  5GTU A;  2P6B A;  4O24 A;  2IE3 C;  3AUZ A;  1HO5 A;  1V73 A;  1Z2W A;  3K7W C;  4H2I A;  4KBP A;  4ORB A;  3H63 A;  4HD0 A;  4O43 A;  3C9F A;  4H1Y P;  4FBW A;  3DSD A;  2KKN A;  3RL3 A;  2IAE C;  1II7 A;  4MOV A;  2DXN A;  2CV9 A;  3H61 A;  2A22 A;  2USH A;  3JYF A;  1T70 A;  4LAC C;  1G5B A;  4V0X A;  1S95 A;  1AUI A;  3RQZ A;  2HYP A;  5J28 A;  4TUI A;  5DNY A;  2NXF A;  2XMO A;  4NZV A;  4DT2 A;  3IVE A;  4MP0 A;  5EQV A;  2AHD A;  1NNW A;  5HPE A;  3THN A;  1S70 A;  2HYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...