2NXFA

Crystal structure of a dimetal phosphatase from danio rerio loc 393393
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
320
structure length
314
Chain Sequence
DPVFTFGLIADVQYADIEDGENYLRTRRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRRDASDRALDTVMAELDACSVDVHHVWGNHEFYNFSRPSLLSSRLNSAQGSDLIGDDIYAYEFSPAPNFRFVLLDAYDLSVIGREEESEKHTHSWRILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVHPCAADPICLAWNHEAVLSVLRSHQSVLCFIAGHDHDGGRCTDSSGAQHITLEGVIETPPHSHAFATAYLYEDRMVMKGRGRVEDLTITYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dimetal phosphatase
publication title Crystal Structure of a dimetal phosphatase from Danio rerio LOC 393393
rcsb
source organism Danio rerio
molecule tags Metal binding protein
total genus 119
structure length 314
sequence length 320
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nxfA01
3ICFA 4O4KA 3FGAC 5GTUA 3DSCA 1S70A 3H63A 1WARA 3K7WC 1OIEA 4G9JA 1QFCA 4FBKA 2O8GA 4O24A 4FCXA 1S8EA 1JK7A 1HPUA 5EQVA 5DNYA 1QHWA 2BCDA 2DFJA 2XMOA 1Z2XA 4I5NC 3C9FA 1KBPA 1S3MA 3RL3A 1T70A 2R17A 3IB7A 3EGHA 2O8AA 2BQ8X 4O5GA 3TGHA 1G5BA 2USHA 3RL5A 3QFKA 4MOYA 5IOHA 1U32A 4XPNA 4DSYA 5B8IA 1S95A 3RQZA 4DT2A 2HYOA 4J6OA 3QG5C 4UT3B 4NZVA 2KKNA 3PSOA 4V0VA 3P71C 2P6BA 3GVEA 2HY1A 1M63A 2GJUA 2QFRA 4WWLA 5JPEA 4JA7A 4H2IA 4IL1A 3AV0A 4H2BA 4MP0A 5F3WA 2YVTA 3EGGA 5HPEA 4FBWA 3H68A 4KKZA 3CK2A 3H64A 2Z1AA 3IB8A 3PSNA 3RL4A 4ORCA 4TUGA 1S3LA 2IAEC 1FJMA 4FBQA 4IYPC 4F0ZA 1Z2WA 2AHDA 1HP1A 5C1VA 3ZTVA 2WDCA 2NPPC 1WAO1 1NNWA 3IVEA 4JA9A 3V4YA 3QFOA 4HD0A 2WDFA 2Z72A 3H67A 4ORAA 1UF3A 2QJCA 1TCOA 4H1SA 4H2FA 3DSDA 2A22A 4MOVA 3H60A 4Q7FA 4O43A 2Z06A 4LTYA 4B2OA 4TUIA 1XZWA 1MF8A 2ZBMA 1V73A 3QFNA 1T71A 2BDXA 4OR9A 5J28A 4UT3A 2JOGA 4ORBA 3QFMA 1XM7A 2NYMC 4LACC 1UTEA 1SU1A 4KBPA 4ZVZA 1II7A 1HO5A 1OIDA 2WDDA 3KBPA 4LU9A 3N5UA 5JPFA 1W24A 3H61A 4V0WA 4DHLA 3DW8C 1IT6A 3THOB 2NXFA 1USHA 3LL8A 3T1IA 3E7BA 4I5LC 3E7AA 3AUZA 3C5WC 3ZU0A 3H66A 3IVDA 2IE3C 5INBA 3K7VC 2HYPA 2Q8UA 2WDEA 4UWQA 3THNA 2QFPA 2CV9A 3HVQA 4H1YP 2IE4C 1AUIA 4V0XA 4M0VA 4ZX2A 3H69A 4H2GA 3H62B 1OI8A 3JYFA 4UT2A 4YKEA 1S3NA 2NYLC 5JJTA
chains in the Genus database with same CATH superfamily
3ICFA 4O4KA 3FGAC 5GTUA 3DSCA 1S70A 3H63A 1WARA 3K7WC 1OIEA 4G9JA 1QFCA 4FBKA 2O8GA 4O24A 4FCXA 1S8EA 1JK7A 3D03A 1HPUA 5EQVA 5DNYA 1QHWA 2BCDA 2DFJA 2XMOA 1Z2XA 4I5NC 3C9FA 1KBPA 1S3MA 3RL3A 1T70A 2R17A 3IB7A 3EGHA 2O8AA 2BQ8X 4O5GA 3TGHA 1G5BA 2USHA 3RL5A 3QFKA 2ZOAA 4MOYA 1U32A 4XPNA 4DSYA 5B8IA 5IOHA 1S95A 3RQZA 4DT2A 2HYOA 2ZO9B 3QG5C 4J6OA 4NZVA 4UT3B 2KKNA 3PSOA 4V0VA 3P71C 2P6BA 3GVEA 2HY1A 1M63A 2GJUA 2QFRA 4WWLA 5JPEA 4JA7A 4H2IA 4IL1A 3AV0A 4H2BA 4MP0A 5F3WA 2YVTA 3EGGA 5HPEA 4FBWA 3H68A 4KKZA 3CK2A 3H64A 2Z1AA 3IB8A 3PSNA 3RL4A 4ORCA 4TUGA 1S3LA 2IAEC 1FJMA 4FBQA 4IYPC 4F0ZA 2DXNA 1Z2WA 2AHDA 1HP1A 5C1VA 3ZTVA 2WDCA 2NPPC 1WAO1 1NNWA 3IVEA 4JA9A 3V4YA 3QFOA 4HD0A 2WDFA 2Z72A 3FLOA 3H67A 4ORAA 1UF3A 2QJCA 1TCOA 4H1SA 4H2FA 3DSDA 2A22A 4MOVA 3H60A 4Q7FA 4O43A 2Z06A 4LTYA 4B2OA 4TUIA 1XZWA 1MF8A 2ZBMA 2YEQA 1V73A 3QFNA 1T71A 2BDXA 4OR9A 5J28A 4UT3A 2JOGA 4ORBA 3QFMA 1XM7A 2NYMC 4LACC 1UTEA 1SU1A 3E0JA 4KBPA 4ZVZA 1II7A 1HO5A 1OIDA 2WDDA 3KBPA 4LU9A 3N5UA 5JPFA 1W24A 3H61A 4V0WA 4DHLA 3DW8C 1IT6A 3THOB 2NXFA 1USHA 2DXLA 3LL8A 3T1IA 3E7BA 4I5LC 3E7AA 3AUZA 3C5WC 3ZU0A 3H66A 3IVDA 2IE3C 5INBA 3K7VC 2HYPA 2Q8UA 2WDEA 4UWQA 3THNA 2QFPA 2CV9A 3HVQA 4H1YP 2IE4C 1AUIA 4V0XA 4M0VA 4ZX2A 3H69A 4H2GA 3H62B 1OI8A 3JYFA 4UT2A 4YKEA 1S3NA 2NYLC 5JJTA
chains in the Genus database with same CATH topology
3ICFA 4O4KA 3FGAC 5GTUA 3DSCA 1S70A 3H63A 1WARA 3K7WC 1OIEA 4G9JA 1QFCA 4FBKA 2O8GA 4O24A 4FCXA 1S8EA 1JK7A 3D03A 1HPUA 5EQVA 5DNYA 1QHWA 2BCDA 2DFJA 2XMOA 1Z2XA 4I5NC 3C9FA 1KBPA 1S3MA 3RL3A 1T70A 2R17A 3IB7A 3EGHA 2O8AA 2BQ8X 4O5GA 3TGHA 1G5BA 2USHA 3RL5A 3QFKA 2ZOAA 4MOYA 1U32A 4XPNA 4DSYA 5B8IA 5IOHA 1S95A 3RQZA 4DT2A 2HYOA 2ZO9B 3QG5C 4J6OA 4NZVA 4UT3B 2KKNA 3PSOA 4V0VA 3P71C 2P6BA 3GVEA 2HY1A 1M63A 2GJUA 2QFRA 4WWLA 5JPEA 4JA7A 4H2IA 4IL1A 3AV0A 4H2BA 4MP0A 5F3WA 2YVTA 3EGGA 5HPEA 4FBWA 3H68A 4KKZA 3CK2A 3H64A 2Z1AA 3IB8A 3PSNA 3RL4A 4ORCA 4TUGA 1S3LA 2IAEC 1FJMA 4FBQA 4IYPC 4F0ZA 2DXNA 1Z2WA 2AHDA 1HP1A 5C1VA 3ZTVA 2WDCA 2NPPC 1WAO1 1NNWA 3IVEA 4JA9A 3V4YA 3QFOA 4HD0A 2WDFA 2Z72A 3FLOA 3H67A 4ORAA 1UF3A 2QJCA 1TCOA 4H1SA 4H2FA 3DSDA 2A22A 4MOVA 3H60A 4Q7FA 4O43A 2Z06A 4LTYA 4B2OA 4TUIA 1XZWA 1MF8A 2ZBMA 2YEQA 1V73A 3QFNA 1T71A 2BDXA 4OR9A 5J28A 4UT3A 2JOGA 4ORBA 3QFMA 1XM7A 2NYMC 4LACC 1UTEA 1SU1A 3E0JA 4KBPA 4ZVZA 1II7A 1HO5A 1OIDA 2WDDA 3KBPA 4LU9A 3N5UA 5JPFA 1W24A 3H61A 4V0WA 4DHLA 3DW8C 1IT6A 3THOB 2NXFA 1USHA 2DXLA 3LL8A 3T1IA 3E7BA 4I5LC 3E7AA 3AUZA 3C5WC 3ZU0A 3H66A 3IVDA 2IE3C 5INBA 3K7VC 2HYPA 2Q8UA 2WDEA 4UWQA 3THNA 2QFPA 2CV9A 3HVQA 4H1YP 2IE4C 1AUIA 4V0XA 4M0VA 4ZX2A 3H69A 4H2GA 3H62B 1OI8A 3JYFA 4UT2A 4YKEA 1S3NA 2NYLC 5JJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ICF A;  4O4K A;  3FGA C;  5GTU A;  3DSC A;  1S70 A;  3H63 A;  1WAR A;  3K7W C;  1OIE A;  4G9J A;  1QFC A;  4FBK A;  2O8G A;  4O24 A;  4FCX A;  1S8E A;  1JK7 A;  1HPU A;  5EQV A;  5DNY A;  1QHW A;  2BCD A;  2DFJ A;  2XMO A;  1Z2X A;  4I5N C;  3C9F A;  1KBP A;  1S3M A;  3RL3 A;  1T70 A;  2R17 A;  3IB7 A;  3EGH A;  2O8A A;  2BQ8 X;  4O5G A;  3TGH A;  1G5B A;  2USH A;  3RL5 A;  3QFK A;  4MOY A;  5IOH A;  1U32 A;  4XPN A;  4DSY A;  5B8I A;  1S95 A;  3RQZ A;  4DT2 A;  2HYO A;  4J6O A;  3QG5 C;  4UT3 B;  4NZV A;  2KKN A;  3PSO A;  4V0V A;  3P71 C;  2P6B A;  3GVE A;  2HY1 A;  1M63 A;  2GJU A;  2QFR A;  4WWL A;  5JPE A;  4JA7 A;  4H2I A;  4IL1 A;  3AV0 A;  4H2B A;  4MP0 A;  5F3W A;  2YVT A;  3EGG A;  5HPE A;  4FBW A;  3H68 A;  4KKZ A;  3CK2 A;  3H64 A;  2Z1A A;  3IB8 A;  3PSN A;  3RL4 A;  4ORC A;  4TUG A;  1S3L A;  2IAE C;  1FJM A;  4FBQ A;  4IYP C;  4F0Z A;  1Z2W A;  2AHD A;  1HP1 A;  5C1V A;  3ZTV A;  2WDC A;  2NPP C;  1WAO 1;  1NNW A;  3IVE A;  4JA9 A;  3V4Y A;  3QFO A;  4HD0 A;  2WDF A;  2Z72 A;  3H67 A;  4ORA A;  1UF3 A;  2QJC A;  1TCO A;  4H1S A;  4H2F A;  3DSD A;  2A22 A;  4MOV A;  3H60 A;  4Q7F A;  4O43 A;  2Z06 A;  4LTY A;  4B2O A;  4TUI A;  1XZW A;  1MF8 A;  2ZBM A;  1V73 A;  3QFN A;  1T71 A;  2BDX A;  4OR9 A;  5J28 A;  4UT3 A;  2JOG A;  4ORB A;  3QFM A;  1XM7 A;  2NYM C;  4LAC C;  1UTE A;  1SU1 A;  4KBP A;  4ZVZ A;  1II7 A;  1HO5 A;  1OID A;  2WDD A;  3KBP A;  4LU9 A;  3N5U A;  5JPF A;  1W24 A;  3H61 A;  4V0W A;  4DHL A;  3DW8 C;  1IT6 A;  3THO B;  2NXF A;  1USH A;  3LL8 A;  3T1I A;  3E7B A;  4I5L C;  3E7A A;  3AUZ A;  3C5W C;  3ZU0 A;  3H66 A;  3IVD A;  2IE3 C;  5INB A;  3K7V C;  2HYP A;  2Q8U A;  2WDE A;  4UWQ A;  3THN A;  2QFP A;  2CV9 A;  3HVQ A;  4H1Y P;  2IE4 C;  1AUI A;  4V0X A;  4M0V A;  4ZX2 A;  3H69 A;  4H2G A;  3H62 B;  1OI8 A;  3JYF A;  4UT2 A;  4YKE A;  1S3N A;  2NYL C;  5JJT A; 
#chains in the Genus database with same CATH topology
 3ICF A;  4O4K A;  3FGA C;  5GTU A;  3DSC A;  1S70 A;  3H63 A;  1WAR A;  3K7W C;  1OIE A;  4G9J A;  1QFC A;  4FBK A;  2O8G A;  4O24 A;  4FCX A;  1S8E A;  1JK7 A;  3D03 A;  1HPU A;  5EQV A;  5DNY A;  1QHW A;  2BCD A;  2DFJ A;  2XMO A;  1Z2X A;  4I5N C;  3C9F A;  1KBP A;  1S3M A;  3RL3 A;  1T70 A;  2R17 A;  3IB7 A;  3EGH A;  2O8A A;  2BQ8 X;  4O5G A;  3TGH A;  1G5B A;  2USH A;  3RL5 A;  3QFK A;  2ZOA A;  4MOY A;  1U32 A;  4XPN A;  4DSY A;  5B8I A;  5IOH A;  1S95 A;  3RQZ A;  4DT2 A;  2HYO A;  2ZO9 B;  3QG5 C;  4J6O A;  4NZV A;  4UT3 B;  2KKN A;  3PSO A;  4V0V A;  3P71 C;  2P6B A;  3GVE A;  2HY1 A;  1M63 A;  2GJU A;  2QFR A;  4WWL A;  5JPE A;  4JA7 A;  4H2I A;  4IL1 A;  3AV0 A;  4H2B A;  4MP0 A;  5F3W A;  2YVT A;  3EGG A;  5HPE A;  4FBW A;  3H68 A;  4KKZ A;  3CK2 A;  3H64 A;  2Z1A A;  3IB8 A;  3PSN A;  3RL4 A;  4ORC A;  4TUG A;  1S3L A;  2IAE C;  1FJM A;  4FBQ A;  4IYP C;  4F0Z A;  2DXN A;  1Z2W A;  2AHD A;  1HP1 A;  5C1V A;  3ZTV A;  2WDC A;  2NPP C;  1WAO 1;  1NNW A;  3IVE A;  4JA9 A;  3V4Y A;  3QFO A;  4HD0 A;  2WDF A;  2Z72 A;  3FLO A;  3H67 A;  4ORA A;  1UF3 A;  2QJC A;  1TCO A;  4H1S A;  4H2F A;  3DSD A;  2A22 A;  4MOV A;  3H60 A;  4Q7F A;  4O43 A;  2Z06 A;  4LTY A;  4B2O A;  4TUI A;  1XZW A;  1MF8 A;  2ZBM A;  2YEQ A;  1V73 A;  3QFN A;  1T71 A;  2BDX A;  4OR9 A;  5J28 A;  4UT3 A;  2JOG A;  4ORB A;  3QFM A;  1XM7 A;  2NYM C;  4LAC C;  1UTE A;  1SU1 A;  3E0J A;  4KBP A;  4ZVZ A;  1II7 A;  1HO5 A;  1OID A;  2WDD A;  3KBP A;  4LU9 A;  3N5U A;  5JPF A;  1W24 A;  3H61 A;  4V0W A;  4DHL A;  3DW8 C;  1IT6 A;  3THO B;  2NXF A;  1USH A;  2DXL A;  3LL8 A;  3T1I A;  3E7B A;  4I5L C;  3E7A A;  3AUZ A;  3C5W C;  3ZU0 A;  3H66 A;  3IVD A;  2IE3 C;  5INB A;  3K7V C;  2HYP A;  2Q8U A;  2WDE A;  4UWQ A;  3THN A;  2QFP A;  2CV9 A;  3HVQ A;  4H1Y P;  2IE4 C;  1AUI A;  4V0X A;  4M0V A;  4ZX2 A;  3H69 A;  4H2G A;  3H62 B;  1OI8 A;  3JYF A;  4UT2 A;  4YKE A;  1S3N A;  2NYL C;  5JJT A; 
#chains in the Genus database with same CATH homology
 3ICF A;  4O4K A;  3FGA C;  5GTU A;  3DSC A;  1S70 A;  3H63 A;  1WAR A;  3K7W C;  1OIE A;  4G9J A;  1QFC A;  4FBK A;  2O8G A;  4O24 A;  4FCX A;  1S8E A;  1JK7 A;  3D03 A;  1HPU A;  5EQV A;  5DNY A;  1QHW A;  2BCD A;  2DFJ A;  2XMO A;  1Z2X A;  4I5N C;  3C9F A;  1KBP A;  1S3M A;  3RL3 A;  1T70 A;  2R17 A;  3IB7 A;  3EGH A;  2O8A A;  2BQ8 X;  4O5G A;  3TGH A;  1G5B A;  2USH A;  3RL5 A;  3QFK A;  2ZOA A;  4MOY A;  1U32 A;  4XPN A;  4DSY A;  5B8I A;  5IOH A;  1S95 A;  3RQZ A;  4DT2 A;  2HYO A;  2ZO9 B;  3QG5 C;  4J6O A;  4NZV A;  4UT3 B;  2KKN A;  3PSO A;  4V0V A;  3P71 C;  2P6B A;  3GVE A;  2HY1 A;  1M63 A;  2GJU A;  2QFR A;  4WWL A;  5JPE A;  4JA7 A;  4H2I A;  4IL1 A;  3AV0 A;  4H2B A;  4MP0 A;  5F3W A;  2YVT A;  3EGG A;  5HPE A;  4FBW A;  3H68 A;  4KKZ A;  3CK2 A;  3H64 A;  2Z1A A;  3IB8 A;  3PSN A;  3RL4 A;  4ORC A;  4TUG A;  1S3L A;  2IAE C;  1FJM A;  4FBQ A;  4IYP C;  4F0Z A;  2DXN A;  1Z2W A;  2AHD A;  1HP1 A;  5C1V A;  3ZTV A;  2WDC A;  2NPP C;  1WAO 1;  1NNW A;  3IVE A;  4JA9 A;  3V4Y A;  3QFO A;  4HD0 A;  2WDF A;  2Z72 A;  3FLO A;  3H67 A;  4ORA A;  1UF3 A;  2QJC A;  1TCO A;  4H1S A;  4H2F A;  3DSD A;  2A22 A;  4MOV A;  3H60 A;  4Q7F A;  4O43 A;  2Z06 A;  4LTY A;  4B2O A;  4TUI A;  1XZW A;  1MF8 A;  2ZBM A;  2YEQ A;  1V73 A;  3QFN A;  1T71 A;  2BDX A;  4OR9 A;  5J28 A;  4UT3 A;  2JOG A;  4ORB A;  3QFM A;  1XM7 A;  2NYM C;  4LAC C;  1UTE A;  1SU1 A;  3E0J A;  4KBP A;  4ZVZ A;  1II7 A;  1HO5 A;  1OID A;  2WDD A;  3KBP A;  4LU9 A;  3N5U A;  5JPF A;  1W24 A;  3H61 A;  4V0W A;  4DHL A;  3DW8 C;  1IT6 A;  3THO B;  2NXF A;  1USH A;  2DXL A;  3LL8 A;  3T1I A;  3E7B A;  4I5L C;  3E7A A;  3AUZ A;  3C5W C;  3ZU0 A;  3H66 A;  3IVD A;  2IE3 C;  5INB A;  3K7V C;  2HYP A;  2Q8U A;  2WDE A;  4UWQ A;  3THN A;  2QFP A;  2CV9 A;  3HVQ A;  4H1Y P;  2IE4 C;  1AUI A;  4V0X A;  4M0V A;  4ZX2 A;  3H69 A;  4H2G A;  3H62 B;  1OI8 A;  3JYF A;  4UT2 A;  4YKE A;  1S3N A;  2NYL C;  5JJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...