2NY1D

Hiv-1 gp120 envelope glycoprotein (i109c, t257s, s334a, s375w, q428c) complexed with cd4 and antibody 17b
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
229
structure length
223
Chain Sequence
b'EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 49
structure length 223
sequence length 229
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny1D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny1D01
5DA0B 4Z8FH 1TJGH 2CPCA 4J1UB 3TESA 5SX5H 2A0LD 2MKLC 4WUUA 2ATKB 5IFAL 4ODVL 3O81A 3EGSA 1I1RA 3W5MA 3FKUS 4HT1H 5IVXF 3GK8H 1KTKE 2IPKA 2VITB 4APQB 2EO9A 2JJVA 5HYSG 5IHLB 1QQDA 3CLEH 5HI3C 3ZTJG 4JN1L 4JRYB 4ZFOA 5I8CA 4TOYL 4WWKC 2H1PH 3MR9B 3HUJB 2WBJB 1IKFH 3BGFC 3DX9A 3BPCB 4JFXA 5H35B 1FH5L 1EDQA 3PV6B 5LBSH 1MPAH 3TBTA 5GIRA 5E5UB 1XIWC 3LVEA 4WTXA 3VXRA 3MXVL 5IF0B 1X5KA 1G9NH 5DGRA 3BKJL 2GSGB 3LHPH 4MD0B 1QPPA 4M1DL 3BZDA 1I8IB 5TDPB 4ALAL 5EBGA 3TT3L 1FJ1B 1FVCB 2AABH 3IDMB 5TF1L 2KUTA 1KCRH 2GT9B 4H20H 1W0VA 1MHEB 4KJPD 4PLKC 1DVFD 4OCLC 4A2MA 1GZQB 5I1DB 3IDJB 5T1MA 3E6FA 1YEHH 3HZMB 4ODBD 3C60B 1T1YB 1V3MA 2FH8A 3B2VL 5DJ0B 3TWCL 4NKQB 3D5OF 1YMMD 4LVOB 3TC9A 4LARH 3QO1B 4LLVA 4YFLF 3SJVE 1LO3L 1EHAA 1B2WL 1A7QL 1KCSH 3QA3B 4XVJL 1A9EA 3FO9B 3DI3B 2E7MA 3U7YH 2I27N 2N7BA 3BQUD 4YPGB 2R39A 3U0TB 4H25A 3FAWA 4PJCB 5D7SL 4OF0A 3QSKB 5KANI 2Z4QB 4AEEA 5JUEL 2DQFB 1G7PA 3ARTA 5FO9B 2ARJA 3P9LA 3KLHC 3MSPA 3NN8B 1PLGH 1IT9L 1RD6A 2Q8BL 2XI9A 1BWWA 1JWSA 1TJHH 1QFWL 3ZHDA 5KOVC 5T1LA 1JZ3A 3T2QA 4PG2A 2NZ9D 3RWHB 1LD9A 4NJAL 3MA7A 3NACH 4YDKH 3VMNA 2AJXH 5EZIL 3LKSA 3MLSL 4W4OA 4P3WA 2D4FA 4RFNC 5ITFA 4F7CA 2JCCF 1LDSA 4PJHA 4OIBA 1OSPL 4HPYH 4GRWF 4OI7A 1MUJB 3BW9B 1CWVA 1G7LA 3QDGB 4OZIF 4D0BB 4XCYB 3B83A 1CDCA 3PWNA 4NIKB 4AIOA 2OTUA 1YQVH 4PGCA 4HEME 4QRUA 2X4PA 4ZTPH 1YNKL 3MV8D 1QSZA 3PQYB 1S7XA 1A6AB 5FF6A 3VWKB 4JY4A 1WC7A 4U1NA 2EXWD 4DCQA 1IM9D 1EHXA 5L88L 1LEKB 4NQED 3P9MB 1FG2B 3MMEB 4HK3N 4BUHA 5C9JA 2LQRA 3IJSA 4I1NB 2VDNH 3UTTB 1FORH 1HHGA 1YMME 3MCLH 4Q6IA 3CAFA 3CCHA 1NFDA 2IAMD 1XGUA 1T3FB 3GMMA 2V6HA 3D9AL 3V6ZB 5CZVH 1HNGA 1IC4H 3E6HA 9CGTA 3CC5B 5IB2A 4LSVL 2WQ8A 4U7SA 2MQ0A 4YX2H 4OUOA 4XB7A 4HDIA 3TT1L 1QVOA 4L3EA 3ZHLA 5I6XC 3MNVB 2APXA 3HNSH 3QWQB 4JM2F 3SCMA 2FL5A 3QULA 5E5RB 4O2CB 3LN4A 3HC0B 4W4NA 4ELMA 3T4AA 3V4UH 5BS0D 4OF7A 1XCQB 2EYSB 2R56L 4XBEH 4N0UE 4YEFA 3QIUB 3BMVA 4BFGA 5SV4A 4YIQB 1D9KC 4FS0A 4KV5E 1EEZA 3CFIC 2IMMA 1C08B 5I8OL 1JL8A 2BJMH 4H26B 3T0BA 1RUAH 2CSPA 2DWEA 5HI5C 2QLVB 1M05A 1TQBC 4WNQB 3U46A 3KVQA 4LLUB 4WEBL 4S2SB 3QUXB 3FT2A 4XNXH 5E99L 2GAZA 5C0DB 2BDNL 4K71B 2ZOKB 4F7EB 2WWKT 4U1JA 3HC4H 1KPVB 3MLXL 2VLMD 3PNWB 3DYPA 5D1XA 4Z0XA 1X3DA 3U7WH 3U48A 4NZUH 4JY5L 3MA9L 5DR5H 5HDQH 4K9EH 5DD3H 3WFDH 1UM6L 4KQ3L 3MV8E 4NO0B 1KT2A 3QDMA 4KK6C 5ADOH 1XR8B 2ITDB 3AU1B 4P3DB 5GS0D 1RVFL 4EIGB 2H2SC 4XWGL 2BSED 4NQEE 5H2BA 3KYKH 5MEQB 1GYAA 2BVEA 5L2KA 1T66C 4P2OA 3NH7L 5CEZL 3OPZL 3O6KL 5IIEA 5E1HB 2WWMD 2VABA 1KYOJ 2HRLA 4LHUG 1RHHB 2VDOL 3TH3T 1MHPH 4GSDL 4K2UL 2FJGA 1BFTA 5AZEL 2ZUSA 3DO7A 1IGYB 5E8EA 4Z76B 2DWDB 3SY0B 1IGTB 3DUUB 2UZIH 2Z8WC 3T2PA 1QRNA 4UOW0 1SYVB 1J0HA 1CE1H 1OAKL 5EZLA 1JPFB 4DK6A 4TYUA 1JF6A 4I18C 5TE7H 4IRZL 1QHOA 2Y36L 4ONFH 3PWPB 4ORZC 2I9LA 5BS0E 5DVKA 4QTIH 1CDJA 4MJ5B 1UJTA 1RU9H 4L1HA 4PTTB 3R8QA 4P23B 5CD3B 3I02B 2JE8A 3F58L 3QUMA 1TZIB 3OAYH 2VISB 3V5HB 3UPRA 1KIQA 3EFFB 5EOCH 3HC3L 5J13C 3T2NL 5I30H 5D7LB 4PJIF 3P0GB 2GYSA 4NNXB 2HH0L 3GSUB 2YEZB 1OWWA 1MRFL 3VWJC 2QV2A 3EYOA 3OXSA 4WU5A 2Z93B 1U91A 4HIIB 3MRBA 4FQHA 3ZDZE 2FX8H 1BECA 3BWAA 4YNYA 4Y16B 3PDGA 3MRKB 3IXTB 1ES0A 5T1KD 3FFDB 5IR1A 3VFGL 5AD0B 4HUWA 5C07D 3STZA 3DXAA 3RHWF 2VLME 3UC0L 1TTGA 4DUVA 1PX3A 2AEWA 5JOFB 1XGRA 5FIEA 1NAMH 2LAGB 5H94A 1Q9WA 3LQAC 5DHVH 3DX7B 4JFQB 3O6FA 4PY8I 5IB5A 3QFJA 4DJMA 1A4KB 2Q76A 1EZVX 1INEL 3ALXA 5C09D 2P47B 3MFFB 3KPPA 3IU3A 1I1AA 4HJGA 3BKMH 1R3IL 5DJCA 1OAXH 5C08B 5MI0B 3O0RH 4XAKD 1MCHA 1CD9B 1URLA 2VZ1A 3DUSA 3G08A 3QXWA 4NM8H 5DUPH 4ODSL 1KNOA 4R96B 3O3DB 3FONA 4HUNB 2EEBA 1MVUA 2DMBA 2J4WL 2ORBH 5CEYB 2HMIC 1YQ2A 1BVKB 3VMPA 2F54D 4LQFL 2HT4C 4XRCA 2DLGA 3KPNB 2WMPA 3ILPA 3BUTA 4YGVB 4NQSB 3JBG7 3LPGA 4PR5B 3TFKD 1JRHL 2IC2A 2WINB 5HI3D 4NZRL 4WWKD 5D9SA 2VLLA 1XF2B 2XIDA 4G43B 3IFNH 2VWEE 4QLRA 8CGTA 1H3PH 3TIDB 4R4NC 1YMMB 4LLQA 1S9VA 1DLFH 3PIQB 3F8UB 2BSRB 2V7NA 2AGJH 3EJZD 5D6CA 5C9KA 1LGVA 1M6OA 2OL3H 5DSCB 2BNQD 1UVQA 1XIWD 4G9FE 1I8MA 1ONQA 3QIWA 3JWDL 2AJSH 4NN7C 4EUPB 5HJ3A 5EWIH 3SGJC 1VFOA 5C07E 2BX5A 4QRRA 4OD1L 1HH6B 3DV6B 2HTLD 3MRMA 3QO0B 5C0EB 4PGDB 5ADPH 4I0PC 1M4KA 1KXVC 3EOBB 2XYCA 4PLKD 3TN0C 2OJZL 5IGXH 4UDTA 1BD2A 1OB1A 3ZT7A 4KHXL 1EBPA 2EDEA 5KSUB 1JK8B 2CLVB 3BP5B 3LEYL 1NGPH 3CFBB 4BYHA 2XACC 1DL7H 5F1KC 3KPRD 3IFLL 4GH7B 4YHKH 1NDGB 4NT6B 1K4CA 3TZVD 5I71B 4O5LH 4CVXA 1JF1B 3L9RB 5C09E 1KCLA 4ZO6A 4J4PD 1T1WA 1RI8A 3M1BB 1AE6H 1J8HD 4L4VB 1KELL 4XAKE 3GMPA 2OZ4H 4PJ5B 2YRPA 1YY9C 1T21A 1WFOA 3N06B 3U79A 3SE9H 4Y4KB 3T3ME 1SM3H 5BZWA 3SDAB 3GSQB 2VSCA 2DYPB 2F54E 3QWOA 4BK5A 2DN7A 2FB4H 4KTDL 3IETA 1AO7D 1CN4A 1MFCH 4GKZB 3WXVH 3O2WH 4H8WH 3CXHK 5LAXB 1QR1B 1AHWC 1YN7B 3H3PH 3HAEA 8FABA 2H32B 3KLHD 2YXMA 2B5IC 5T33H 3ULUF 1MJ7H 3ABZA 3MRHB 4QHMA 4G7YL 4OQ1A 2Z91A 1UB6B 3NZHH 5FO8B 3WIHL 1N3NB 1KPRA 4HIJB 3JVGC 3NFSH 4M03A 5JHLH 2BNQE 2NTSP 2W9DL 2VQ1B 1FAKT 2AV7B 4LLWA 1KOAA 4G80B 4HKBA 2FEDD 3U1SL 4E5XA 3MOAH 5E24E 2OCFD 1YEFL 1DANT 4MA7L 2H6PB 2C4XA 3S3PA 5E9DA 1P6AB 4OSUH 5SWSE 2PTTA 3UDWC 3EZJB 4PRHD 3X13B 4DKEL 5IB1B 1RULL 4OCXL 4OAWB 4L9LA 4Z7WE 2G60H 4ODTL 1SBBA 4X4YA 1TZGL 3MOBL 4WHYH 5ENWA 5IBLC 3MNWA 5LQBL 5ANMA 3T8XA 1E4WL 4LRIC 5I8EA 3KPRE 3IDNB 5EO0B 2VMFA 2PW1B 1ZKAA 1L9MA 4JCMA 2AEPH 1L0QA 1QA9A 4GBXD 1GHFH 1TETL 4QRTA 5MENB 1OT2A 4U1LA 4NO3A 4R90L 4E42A 1J8HE 2VRAA 4KJQC 4PREA 1BOGB 3VJ6A 1D5XB 1U8OB 1N6QL 4HJJL 2NTFA 3K1DA 3IU4H 3MBEA 5C0NC 4J3OC 4YUEH 3IDGB 1WZKA 3GMNB 3GIZL 2V5RA 1VPOL 2EIBA 4BFIB 1AO7E 5C3LD 2R4SH 3Q1SL 1CI5A 2GJZB 2KQNA 5E6IB 4Y5VA 1KB9J 5E03A 3W39A 1JGDA 5J4MA 1Z5LB 5DRZB 5IBUB 4F15C 4U1IB 3H9YA 1ZLSH 2VERN 1D9KD 3ARDB 1TCMA 3BP6A 3BPNC 4U0RB 1LWRA 1PD6A 1GZPB 4JHZA 4PJ9B 1DBAH 1KPUA 3B3IB 3H7BA 4UV4L 4EJ1C 4O51A 2NZIA 4Y4HC 4PJGE 1PW3A 2BK8A 4Y5YC 3QHZL 4Q2ZB 5JXAH 2OXHA 2VDPH 4U6XB 2XY1A 1V7MH 1WAAF 32C2A 5EC1A 4P2QD 1D5MA 3P4OB 4TUJB 5KZCB 3FOLA 4LU5H 1B88A 4PRHE 5GGRB 4P9HH 4TUOA 3LEVH 4Q58C 2ATPB 1U58A 2K9UA 2R0LH 4QRSA 2ZKHL 4K3HA 5JA9A 3G5ZA 4CADB 2BY2A 5K9QG 4KK6D 1DCLA 1KCKA 3QCUL 4RMRA 1IL1A 1IAKA 3MLUL 4H1LG 2IALB 2H2SD 4WJ5B 4M02A 4DN3L 1EAPB 3WIHA 5CBEB 2EE9A 1U8KB 4MX7B 3NCBB 3G6JE 4OZGE 5DWUL 2O5YL 1T20B 1JNNL 4G9FB 4PV9A 2DICA 5DT1L 1OW0C 3WBDA 3L3IB 4OBRA 1ZA6A 4BH7A 2HJFA 1N6VA 5T1KB 5L6YL 3D69B 4RAVA 4F2MB 2OTPA 1DQQB 5D96B 4PJBF 4WTZG 4ZPVA 2AK4B 5C07B 3L7FB 4ZFZB 1EHLH 4R4FL 3O6ML 3CVHL 3GGWB 4KRNA 3UTSA 3EJYD 5MEOA 1FO0H 3OKNB 4R97C 4Z8FL 1V8HA 4X6EB 1WK0A 4HPOH 5JDSB 5HGDA 4DKAA 5IMOA 1QG3A 4HT1L 4IBLT 3GK8L 3L3GB 4JPKH 4LSDA 1UWGH 5ICZA 3CLEL 1AGCB 1CD1A 2DKSA 4MNQD 5F72S 4F9LC 5SV3A 3W9DB 3MRCA 3NIGE 2W9EH 5B38G 4J8RA 5C09B 2FWOB 1KEMH 1G9MC 4BQ6A 1IKFL 3JZ7A 2MOVA 3VWJD 4MA3A 3ZKQD 4BZ2H 3WNLA 5T3XH 5LBSL 4QCIB 1MPAL 4BKLB 3O3EB 1DLHB 3WN5C 4M4PA 5FFLA 4P2QE 5B39A 5AEAA 2CLZA 1OAQH 4YHZH 5CZXC 3F6IA 3QIBC 5C8JA 1A7NH 1C5BH 1G9NL 3LHPL 3WHXA 1JV5A 1KJ3H 5GQBA 4M5YH 3DROA 4O00A 1JI2A 1OAYH 3JV6A 4N8VG 4XPTL 4ZPTB 5IM7A 2FJFB 2AABL 5F9DC 1KCRL 1R24B 4H0IA 1JWMA 4H20L 3TO4D 3BGFB 1FV1A 5KSVB 5IFJB 3L5WB 3S6CA 2BC4B 5ACLA 4UAOB 4I5BB 3IRPX 4XXCC 4JANA 1HWGB 1XIWB 5I8KH 3KXFD 4HFUH 5L2JB 4JKPH 1T5WB 2IANB 4OZHE 4ZOBA 3UTQA 3VXPB 4IMKA 4KJYB 5I2IA 4MCYA 1KN4H 3LKQB 1FFNA 4GXUN 3F7YB 2HMID 1KCSL 2DAVA 5DVNA 5SWSB 5GGQL 3QHFH 2HT4D 4RA3A 1IGFH 1FPTH 3QEGH 2IJ0C 4MD4B 1YDPB 4Z7WB 3CH1B 2XNAB 1DBKH 4LOUD 3BOVA 3FQNA 4OCWH 5KS9A 4JFDA 1CXFA 5D8JH 3K2MC 3L3JA 2UYLB 3NIFF 3RKPA 1Z9OA 3MO1A 1RMFH 3IKCA 1IE5A 5FO7B 4R4ND 4MNQE 4DZBA 3HZKA 1FNFA 3UP1A 1JTPA 1GAFL 3GSVA 5ECJE 1RK1A 3EO1A 5C0JA 2HVKA 3EHBC 1U8QB 2KZWA 1CT8A 4U1MA 3T0XA 2A6JB 1CDIA 3NACL 1CFNA 1OPGH 3PV7A 4V1DD 2FIRT 5FGBC 3OF6A 3X3FH 3TJHD 2AJXL 3MLYH 4QGTA 3CVHA 5JIIA 4NRZB 1AGFB 1MIEH 3V0WH 3B6SA 1VFMA 1J7VR 4S1QH 4P59H 1JPGA 4I0PD 4HPYL 3TVMA 1WITA 1LO2H 5JQ6L 4NNYA 3TN0D 4UIMA 3RZCC 4MYWB 1ZLUH 2K3TA 4E0RA 3PE9A 5SX4I 3BT2H 2BMKA 1YQVL 3GKWH 4IOIA 5DEFB 2YD5A 4ZTPL 4LLMB 4XH2B 3ZLQC 5A1AA 1KULA 1LE5B 3JV4B 4KROC 3REWA 1OSZB 5FYKH 4HF5H 2WSKA 2YPLA 1NFIA 3QRFM 3GJEB 4WHTA 3RRQA 2VLRA 4X6DE 1J8KA 3AS3A 4X98B 2VDNL 3D2UA 1AQDB 1FORL 3KXFE 4JFEA 4LSSH 4RFNB 2G5RA 4JVPA 3WFEH 3MQIA 4KDVA 1Z9SA 5CZVL 2HFGL 3GHEH 1IC4L 2NY7L 1OD7A 4LEOA 1RAMA 2CUHA 1BVLB 4PRHB 1CZ8H 4YX2L 1CGSH 1PYWB 2ESVE 1LO5B 3PHOB 1SMAA 3QEQB 5IVOA 5D7IA 5CJXC 3JWOC 3HNSL 1JVKA 2E8YA 4NQCD 3GJFH 3NCYS 3NMEA 1FL3B 4N8CH 4ODWA 4ZD3L 3DURA 5FV2A 3NFPA 3V4UL 5A3ID 3TJEH 4XBEL 3DTXB 3O3UN 3RVTD 2YZ8A 2MSPA 4M7LT 1FNEA 3RJQB 2F53D 1RURH 3AS2A 4MB5A 4ZUSB 2OLDA 4LP4A 3RGHA 5GRZA 3OX8B 3LDBB 2BJML 1ORSA 1VADA 1T5XB 1RUAL 3U4BL 1ZSDB 4V1DE 4YHIB 5D70H 5CP3A 2H8PB 1IEAB 3BEVB 2IPUG 2KKQA 1CICD 3FB7B 1NC2B 5I6XB 1QSED 4O9HH 1QEWA 2V5MA 2EC8A 2JELH 1KV3A 1INDH 1NDMA 1ACZA 1MCDA 3F7PC 5JO5A 3CVIL 1T1ZA 3OGCB 3W0WA 4R8WH 3SKJH 3U7WL 4MNGB 4UI2A 4NZUL 3L6FB 4YHOH 3CFDB 5DQJA 5HDLA 2R2BA 5DR5L 5HDQL 3NCFB 5DD3L 1N64H 3WFDL 3Q48A 1MHHB 4CMMB 1UB5B 2D03H 4NSKB 5ADOL 3QR2A 5C6TL 1RUMH 2R2CA 4PRDA 3KYKL 4ZAKA 3WUZA 1MJ8H 2V9TA 1TQBB 1RV6X 4PIRF 4KJQD 4NGHH 3WKNA 4W81A 3NZ8B 2A74A 1I4FA 3EYVA 1HHJB 2E6PA 5C0ND 4AM0B 5D7KD 1U8PB 1MHPL 4RRPG 5F7WC 4YQXH 3VFVB 1VEOA 4NHCH 2UZIL 3L3KB 1UQSA 5FB8A 1S7WA 4NQCE 3QQ9C 2NXYC 1YEKH 1CE1L 3O9WA 3MJ9H 1YYML 5TE7L 3OBAA 3SEPA 4QTIL 1RU9L 3RWEA 4NRYA 1S7VB 1ZVYA 1PZ5B 4Z7UF 3RPIA 5HPOA 3ULVF 2F53E 5DQDL 5EOCL 4DAGH 4Q7DA 5EIQA 4Y4HD 1SJHB 5K9OB 4JN2B 3BHBB 5I30L 1VCAA 3H9HA 1XGQB 1CFSB 5IB3B 2Y25A 5FYLD 4D8PA 3P30H 1BBJA 3RGVA 1MCLA 2FX8L 1FGVH 1QSEE 3U9UA 5F9JB 3DETC 2HVJA 3B4NA 5DUMH 4I18B 1Q0XH 4NN5B 4JGMA 4OZFA 1K3ZA 4NCC1 4TSBH 2ZUTA 4GXVH 1S9YB 2NPLX 1NAML 4MHHG 3VDBA 4OT1H 4UINH 1MFAH 3B5TA 4I2XA 1QSVA 4P57A 2JJTA 5TQ2H 1ND0B 4AMKH 2VXUH 4LKXB 1L7TL 3VWJB 3VGEA 1XF4B 3KJ4C 4FQJH 4ODXA 4XX1E 4Y1AA 2CDGB 3MROA 2UY6A 5BV7C 2MMXA 2FSEA 3G6DH 3BKML 2VXVL 2X4RB 1OAXL 5FK9B 3C87A 3O0RL 4NM8L 5DUPL 1CTNA 1HI6A 2R0KH 5D7KE 1O7SA 5EO1A 2FGWH 4HUXB 4H0GA 2ORBL 5I76B 4JPVL 4ZUUB 1N2RB 2BOCB 5CCKH 4M7KH 4PG2C 2E5EA 5DRXA 2NX5B 5H8DA 4XPHH 3RNQA 3QDJB 1SEQL 1A6TA 4FTVA 1WV7T 4W4OC 1AGBB 1MF2H 2EYRA 1YEGL 3IFNL 3M17B 1T2XA 5AG8A 4K07A 3Q0HA 4LSPH 1H3PL 4Y5XA 1I3UA 3TCLB 1CK0H 1KTDA 1O7VA 4YK4C 5E00B 3S9DB 5T5NG 1JN6A 1DLFL 1XZ0B 5JNYB 2AGJL 2OL3L 5T3ZD 1K5NB 1P1ZB 3HE7B 3F6LA 1PY4A 4IRJC 3ZE0F 5FYLE 1T7XA 4XAWH 5CZXD 5EU7E 4HS6B 3QIBD 5E4IA 2ZUWA 5I19L 2ESVB 3FCTB 1IEHA 3B9EA 5IK3B 1FG9C 4F57H 1EZVY 1A8JH 4GW5A 3RDTA 1ZVSB 5FGRA 2V5SA 3L3OA 1O5DT 5FDYA 4MJIA 2ATKA 5IGXL 1AI1H 1EMTH 1I9JH 5CINH 4Y19B 5JHDD 5JPMA 3R1GH 3FQRB 1GGBH 4F33B 2VITA 4APQA 1NGPL 1B0RB 1H3GA 4JRYA 4L29B 4NQDD 1DL7L 3AY4A 43C9B 2X9WA 5CP7B 5DJDB 3HUJA 4L4JA 2WBJA 4O5LL 1AKJB 3BPCA 4NN7B 5H35A 3IFPB 3SCMC 1GGIH 1ZT1B 1AE6L 4D0CB 3PV6A 2OZ4L 4OQTL 2C3GA 3RIAF 4HLJA 2YHGA 5DMYA 2EKSA 1PG7W 4I0PB 2P24B 1HNFA 1SM3L 1PZUB 4POZD 3S3JA 3TEUA 3TN0B 1MFBH 1U8NB 3MTRA 2FB4L 2GSGA 4MD0A 4GO6B 3WXVL 1JBJA 1I8IA 5TDPA 3O2WL 1WUNT 4H8WL 4M3KB 1QACA 3MREB 3H3PL 4HWZA 1HQRB 1FJ1A 1FVCA 3IDMA 4L4TB 2GT9A 4K7PX 3V6OA 2D7PA 1MHEA 4GG6B 5T33L 4R2GB 1MJ7L 2PR4L 3AFLA 1GZQA 3VFWB 3EHBD 4FXGB 1Q9KB 2KL6A 3NZHL 5I1DA 1OGAD 4GG6F 2NLJB 3HZMA 1NCUA 2HLFC 1AXTH 1FQ9C 3C60A 1T1YA 4JZJC 5TDOB 5DJ0A 3NFSL 3OKLB 5T3ZE 4UILH 3OB0H 3HI6H 1EUTA 3BD4A 3QO1A 3O2DH 4KGJA 5F44A 5IQ9B 4S1DC 1YZZA 3QA3A 3UJJH 5C6WH 4FFWD 3RZCD 5DO2C 4NQCB 4OJFH 3FO9A 2RCSH 4P2OC 3FT4B 4JKWA 2X44D 1NPUA 1B6UA 2G60L 3VXMD 2RR3A 1TPXC 2ICWI 1SVCP 4MA8H 4YPGA 4DVRH 3U0TA 4PJCA 4G8GD 2CRIA 4BQ9A 5JHDE 4JREB 2ADIB 4OF8A 2Z4QA 2F53B 2DQFA 1W72B 5FO9A 5EOTB 5I15H 2NY2D 2XKUA 4NQDE 3NN8A 5D1ZD 3UTPD 4YZFF 5D2LE 4KXZI 5GGRY 4OZ4B 3HMWH 3T08A 4CU6A 2R0WH 4NC1C 1YECH 2HJKB 4LCWB 1GHFL 5GS3A 3QP3A 1AQKH 2VXQL 4OCNC 1YYLH 4LHQB 1BJMA 5KSAD 1G0DA 3IU4L 2B4CC 4YFDB 5DD0H 4YUEL 3FQUB 3V2AR 2DIJA 1NGYB 4PBVC 3D39B 4NBYB 1MUJA 2C26A 2R4SL 3QDGA 2CIKB 3MJ6A 2EXYD 5CFHA 4M3JA 1ZLSL 3PQYA 3U7AA 1A6AA 3VWKA 5FEBA 3ULVH 1R3JB 3SDDD 5L8JB 1OGAE 1LEKA 3P9MA 1FG2A 5JQHC 3EYUH 5DDHB 4UNUA 2W59A 4TNVF 3UTTA 4BQCA 1AJ7H 5JXAL 5DMGC 2VDPL 4M1GL 3UO1H 5E8NB 3OKYA 3V6ZA 1V7ML 5TE6L 1G6RH 3CC5A 5HVHC 4XMLH 3TO2B 3O6FC 5I1AB 3VFMB 3BESR 2ICWB 4P9HL 3WE6A 3EYQC 3LEVL 4F15B 3M45A 4J3UA 3MNVA 2R0LL 3VXME 2DQEL 2WWKO 3BE1H 1RIHH 4G8GE 3BPNB 3GIVB 2D3VA 2V2TB 7FABH 4O2CA 3HC0A 1CS6A 4HGWB 1CDBA 1XCQA 3B9KD 3UTPE 2Z35A 3QIUA 4X7DC 5FYJH 4EKXA 5HHPB 4Y5YB 4JZNA 4YIQA 4ZS7H 2WLYA 1UACL 4WUUD 2FBOJ 4M1CC 1C08A 4NWTH 1WT5A 1R3LA 5IMMB 4H26A 3HI1B 4TVPD 5HHVH 4MWFB 4WNQA 4LLUA 4AIXA 4S2SA 3PJSB 3QUXA 5CJQH 1EGJA 5C0DA 3AS1A 4ZO7A 2CXKA 2ZOKA 4F7EA 1FO0L 4ZOAA 1QR4A 3QQ9D 2NXYD 2Y9RT 1KPVA 1QTYT 4RBPH 1X44A 3PNWA 2YBRB 1CXHA 4HPOL 2X42A 2P46B 1P7QB 2Y23A 5GRXG 2CGRH 3VXRD 3MXWH 4NO0A 4ZFFB 4JPKL 1XGTB 1UWGL 1XR8A 2ITDA 3AU1A 3DWTA 4P3DA 1N5YH 3TYGH 4HD9A 1GGCL 3TIEA 1J5OL 1KEML 1QZ1A 5MEQA 2XA3A 3LKRA 1QKZH 1TVBB 4BZ2L 5HHQB 4XXDA 5MP6H 4J3TA 5T3XL 2RAMA 3E3QC 3ARFC 4OKVB 4MXQC 2YPVL 3DETD 3H9SB 4HMEA 1RHHA 2HT2C 3KGRA 1OAQL 1XF3A 4YHZL 4P5MB 5HGAA 1TJIH 5C0RH 1C5BL 3GSOB 1IGYA 3WLWC 4Z76A 1KJ3L 2DWDA 3SY0A 1IGTA 1OAYL 4Z7VE 3DUUA 5FUOH 1VB9A 4OB5H 3WUWB 5J1AB 1RHFA 1SYVA 4Q9QH 1PKOA 2COQA 3PWPA 2OMNA 4MJ5A 4LBEB 5CD3A 3BN9C 3I02A 1CFTB 4PJIA 1TZIA 4XWOD 2VISA 3V5HA 3EFFA 4GAYB 1T7WA 4WUUE 2KH2B 5D7LA 3W11C 4HFUL 4NNXA 1I9IH 3GSUA 4JKPL 2YEZA 3G5XB 2ZNXA 4M61A 4G42B 4TVPE 1KN4L 5ESVB 2Z93A 4HIIA 1IC7H 4Y16A 3MRKA 3QHFL 2J3SA 3IXTA 2M2DA 1K9TA 1IGFL 3FFDA 3QEGL 1I7RA 3GUTB 5AD0A 4JHBA 1LEIB 3M07A 1DBKL 1GGTA 3D0VB 2P5WA 5JOFA 1CVRA 2X89D 3WDIA 3VXRE 1C5DA 1RMFL 4X6BB 3MYZA 4NQDB 4HG4J 3ULUL 2P8MB 3DX7A 5GGSB 3VA6A 3N9GH 5E94B 5D2LB 5I75C 4JFQA 4XX1G 1A4KA 3MUHL 2Q1EA 1U3YA 4IRJD 5LXGH 4HC1L 4L9LC 2YC1B 3MFFA 5JW4N 4RZCA 5GJTH 5C08A 2BHUA 3QXDB 4POUB 1B90A 1P69B 3VH8B 1J12A 2XWTB 2AJUH 3ZKMC 5F7KC 1NCDH 3O3AB 4R96A 3O3DA 4WY7H 2DBLH 4S1QL 4K94C 4P59L 3OKMB 4LFHD 5CEYA 4X5XB 2EO1A 1BVKA 1AIFB 4MAUH 4U1GB 1UXWB 2BVQB 3WS6C 4ZSOE 2FCBA 1U93B 4YGVA 4NQSA 5A2FA 5T1DH 3BT2L 1E0OB 1G7IB 3GKWL 4IRSB 4PR5A 3A6BH 4JO1H 1M7IB 1KLFA 2WINA 4E9LA 4YHNB 1GL4B 5FYKL 3ALWA 1XF2A 4G43A 2ZUQC 5ALBH 3HS0A 1A3QA 1T83A 4L3ED 2CRMA 5J9PB 3V4VL 2W91A 2X9YA 3SCMD 5HDBF 1SY6H 3PIQA 2BSRA 4LSSL 4JPWH 4Y5VC 3WFEL 4JQIH 4WW2B 3OJDB 5DSCA 1MWAB 5EFIB 3GHEL 4KU1A 2AKRB 1IAIH 4H1LB 4EUPA 3RZCB 3WNOA 5KJRH 4UOJA 1CZ8L 1CGSL 2EIEA 1P84J 1HH6A 3DNKA 3DV6A 3QO0A 5C0EA 4KROB 4PGDA 3EOBA 4ENED 1I3GH 4N8CL 4NFDA 5C2BH 4PJHE 3TJEL 1JK8A 4HWBH 2CLVA 3BP5A 4QHNB 2HLFD 3P0VH 5CSGA 3U83A 4W68A 3ZSSA 3QH3B 1OQOA 1NDGA 4XNQB 4NT6A 5D1XD 1J1OH 2MHAB 4UU9B 1JF1A 3L9RA 1S78C 5IP4A 4ETQB 3M1BA 4L4VA 3P40A 1DBMH 3QDMD 4HJ0C 4PJ5A 4JCLA 4S1DD 1EFXD 4U6TA 3Q6FB 4P4RB 1XF5B 2DQGH 1R0AH 5DO2D 3T3PF 4O9HL 4S11A 4Y4KA 3RWGB 2DJSA 5ICXA 5F7LB 5L2KD 4K3EL 3SDAA 3GSQA 4P2OD 2DYPA 2Q87A 5B38B 4LMQE 2JELL 1NFDE 1RJZB 1INDL 1H5BB 4HUVB 2J6EH 4GRLC 4GKZA 3SKJL 1C12B 4YHOL 5IFHH 4MQ7B 2R29H 5LAXA 2D4DA 2D7NA 1YN7A 4MQTB 1QR1A 1TQCB 2H32A 3EO0B 3KLAB 5EBWB 1BQLL 4P3CH 4JDZB 1E4XI 5HBBA 1RUML 5L8KB 1IKNA 4Z9KB 5ISZB 4L3EE 5ACMA 4HC1A 2EE6A 3TBYB 5FO8A 1MJ8L 1QRND 2ZZUT 1N3NA 2NQCA 4BH8B 4HIJA 3OAUH 2I26N 4JGJA 4N8VB 3RNKB 3I75B 4AZ8A 3GSXB 3C5ZB 3ZT6A 2E8ZA 3GSNB 2VQ1A 2AV7A 3AAZB 4HGMA 1QFOA 3QI9C 1FSKC 3TV3H 4Z7OF 3DV4B 3SGDI 5TJWK 5I9QC 2QADB 4NZTH 3VGAC 5DD5H 1G9EA 4YQXL 4NHCL 4Z7VB 2Q3ZA 1MOEA 2AQ3A 1QBAA 2W92A 3R0MA 3X13A 4TULH 3BX7C 5IB1A 2D9QB 4PLJC 1AH1A 2J8UF 1X5FA 4OAWA 1CBVH 4P5TB 1YEKL 1MH5B 1T6WA 5JW4R 5L9DH 2J8OA 4XT1C 4N5ED 1BQUA 1HSBA 3T77B 4PUBH 2IH1A 1NANH 1S7TB 3DXAD 2X4OB 1JZ8A 3ZDZF 4DAGL 4PRIB 1V3KA 2VOTA 3IDNA 5CIPH 5EO0A 4KKCC 2PW1A 1TZHB 2RGSA 5DMGD 5MENA 4KKLC 2P44B 5I8CB 3FHAA 3QDME 4YJZL 5DYOA 3P30L 5H37H 4JDTH 1BOGA 5GZND 1D5XA 1U8OA 1FGVL 3O6FD 1ZWIB 2Z8SA 2GIYA 5E7FA 5L2KE 2XXMB 3QFJD 3IDGA 3GMNA 5DA4A 4XP5H 4CU7A 5DFTA 1BJ1H 4WFED 5DUML 1EH9A 1I1AD 1Q0XL 4FZ8H 3TBTB 4BFIA 2GJZA 5E6IA 4TSBL 1A3LH 1Z5LA 5DRZA 4C55A 5JIPA 3QEHB 4U1IA 4UINL 1MFAL 3VRLF 2DQIH 3DX6B 4I3RH 1BIHA 1N5AB 3ARDA 3BKYL 5TQ2L 4NC1E 4AMKL 1ZT4B 4HIHB 4XPFH 4KGLA 5GRJH 2RBLA 3HFMH 4PRPB 1QRNE 4IMLB 1W0VB 3OKOB 1GZPA 4PJ9A 3B3IA 3EDDA 2A6IB 3FQWB 5EH1A 4OLUL 3G6DL 4QY8A 3UPAA 3HNVL 5D72H 1WAAA 1OAUH 2YPKB 4K55A 4D0DB 4Q2ZA 1R3KB 4U6XA 3DOSA 2I5YH 5I0ZA 3MRJB 1C8PA 3CD4A 1F5WA 5DRWB 3V52L 2FGWL 3ARSA 2AXGB 1P7KB 3P4OA 2ARWA 2DJUA 4TUJA 1AR1C 4ZSOB 5CCKL 2NY6C 4QHKI 4M7KL 5GGRA 3BO8B 2P8LA 2ATPA 2VL4A 3QIWD 4XPHL 4CADA 1NGZB 2WIMA 1MF2L 4WJ5A 1EAPA 1DQMH 3DXAE 4QRRD 4LSPL 5CBEA 5BV7B 1U8KA 1UWXH 1CK0L 4MX7A 4F3FB 3TVMC 3QPXL 4GKOA 2X05A 3SKNB 1V3JA 1BD2D 1T20A 2VZUA 4G9FA 4ZOEA 5HYQB 1ETZB 3RWCB 3P9LB 4MXQD 3L3IA 1ZLVH 1KIUA 1DQDL 4XAWL 2HT2D 4AK1A 1IM3B 5T1KA 3D69A 4F2MA 5FOBB 2A6DB 1DQQA 1WSST 5HHMD 2AK4A 3FN0L 1E4KA 2VYRE 3L7FA 3QFJE 3PGFL 4ZFZA 2XG4A 3WLWD 4F57L 1MCWM 2X1QA 4WFEE 3OKNA 1JHKH 2GJ6B 3LKSB 4C56A 4ODUB 3QZWG 4X6EA 5JDSA 2QKIA 1AI1L 3ZE2F 4M6MH 1I9JL 3REVB 3R1GL 1G9NC 1GGBL 4C58B 5DZNA 3ZDYE 1AGCA 1V3LA 4PGCB 3W9DA 4IRJB 4F37F 3W11D 1LP9F 2PKDA 5ITBH 2FWOA 4ONHB 4JKLA 3IJYB 1GGIL 3LPFA 5HVGB 3H3BC 1VFBB 2QQLH 4RSVA 1QFWI 3L5XH 4QCIA 4BKLA 3O3EA 1DLHA 5E6YA 4MHHI 3S36L 2R1YB 4RMWA 1WFTA 1MFBL 3K46A 4OGXH 43CAB 4DTGH 3UPCA 4PJFB 1I3RB 1MREL 4A6YH 2FJFA 3S37L 5F9OH 1R24A 3RUGB 5LKNA 4S1SH 1GJIA 4X7EC 3V6FB 4PG9B 1GGUA 3BUYB 4HDIB 4QRRE 5KSVA 5IFJA 3L5WA 5F7EL 2FL5B 1OLLA 4CW1B 3QULB 1IGCH 2EZ0C 3C6LB 5DC4B 1AXTL 4I5BA 4ODHH 3FTGB 1BD2E 1XIWA 3E3QE 4EI6B 5J12C 3S5LB 5TDNB 2R1XB 3HI6L 5L2JA 2IANA 4K7FB 4RAHA 3SGEI 3VXPA 1JHLH 4KJYA 1REIA 3LKQA 3O2DL 1MFEH 1EEZB 5SWSA 2BVUA 1YUHB 4MD4A 4UNVA 4XMPH 4KMLB 5EOQL 1YDPA 4OJFL 2XNAA 5ABDE 4PJEF 1ZT7B 2AP2A 3KPTA 4DFIA 4MA8L 4DVRL 2UYLA 3TBSB 3MBED 4O58H 4U1JB 4I4WB 5FO7A 3VGDA 4JZJB 4GXUM 4Y89A 1EAJA 4DGIH 5I15L 3U30B 1YNTB 4DKFH 4PJ8C 4O2FB 4GG8B 3HMWL 3GM0A 1YECL 1U8QA 4NP4L 5I1KH 4FQPA 2A6JA 4K7PY 1U41A 1FZKB 1AQKL 3S4SG 1EFXB 1ZK9A 1AY1H 5DVLA 5H2BB 1YYLL 1G7QB 1K85A 2IWGA 1ZHKB 4HIXH 3R06B 2BVOB 1AGFA 5HYJE 5A2KH 5DD0L 3QPQC 1K8DB 1TPXB 1KSRA 1U2CA 4M9OA 1MFDH 3TPUB 4FA8A 4AQ1B 1L6ZA 3DECA 3OB8A 5DEFA 3W9EA 2EDKA 2P5ED 2EKJA 4HBQA 4LLMA 4XH2A 4PJGF 3RGVC 1LE5A 3PWLB 1F97A 1OSZA 5IHUH 4F7TB 3FL7A 3ULVL 1OTTC 2PN5A 3GJEA 3DX8B 4OLWL 4ZO8A 3RHWK 1YJDH 4X98A 1AQDA 4AEIH 1AJ7L 4CMHB 3GI9H 2VE6B 4HUKB 5ANME 5JW4Q 3BYTA 3UO1L 4U3HA 5AZ2H 3OJVC 3BI9X 1JTOA 4GAJH 3MUY1 1G6RL 4XMLL 2JJTC 3P4LA 1T89C 1BVLA 1JZ6A 1A7RL 1PYWA 1LO5A 3PHOA 3QEQA 4KUZH 5GS0H 4DQOL 1KUMA 5DGQA 4YNYB 4URTB 3G6JF 2JJWA 1RIHL 4OZGF 1FL3A 4PJ7B 1UGNA 5T5NF 3STZB 7FABL 1U9KA 5KW9H 2A9NL 1MCOH 2XN9B 3DTXA 4PJ7F 5FYJL 3VI4E 2ZOLB 5D6DC 5ESQB 1B0GB 5BO1H 4ZUSA 5EC2B 3EYSH 4NO5B 4NWTL 2CRZA 3OX8A 1Q9LB 5HVHB 3RTQB 2NY4C 1T5XA 2Y06L 3WS3B 1ZSDA 4YHIA 3O6FB 2YD3A 5HHVL 2C3VB 4B50A 2H8PA 1IEAA 3BEVA 3N1MC 5HVWA 1IFHH 3FB7A 1FVEB 1FZOB 4LFHG 1NC2A 4YXLH 5CJQL 1J11A 3C08H 4Y5XC 1HHKB 2ADFH 4PLJD 4P46C 4X83A 3NIGF 3OGCA 2XTJC 4MNGA 3RI5F 3CFDA 1Z6JT 2P5EE 2IFGA 1MHHA 1T4KA 4CMMA 1DJSA 2MFNA 1UB5A 4KK9C 2GK0A 4NSKA 1IAOB 1N5YL 1PY9A 3TYGL 1NL0L 3VFPB 4FFYL 2YKLH 2AW2A 3BXNB 4QRPD 5MP6L 1D6VH 3NZ8A 5GRVK 4YBQD 3NGBC 3OKEB 2FECL 5GGSY 4IEFB 3D18B 3GO1H 3CZFB 4AM0A 3GB7B 1IAMA 4APQC 1U8PA 1TJIL 2D0GA 2W1NA 2M26A 1BQHG 3AY4C 3VFVA 2GY7B 5I1GH 2GCYA 1BZ7B 4RAUB 2XZZA 3L3KA 4H88H 4IHOB 5FUOL 5HJ3B 3KLDA 4FFZH 5J1SC 4J3SA 4Q9QL 4Z7UA 5DTFA 4OZHF 1PJ9A 1S7VA 3CH8A 5FUZH 1PZ5A 5KVFL 1IGML 3DRQB 2GKIA 4JFDD 1P5VA 4G5ZH 1JRHI 1SJHA 4UDTB 5K9OA 4JN2A 4ESKA 3ARFB 1F90H 3BHBA 1I1YB 3LIZH 2Y7QB 1CG9B 3QB7C 3H3KA 2X4UA 4H5SB 2VIRB 4AT6B 1DBJH 1I9IL 1MSPA 2EEDA 5C7XH 1XGQA 4TNWF 1CFSA 1WTGT 2XOTA 5GZOC 2QSCH 4WHYG 1AR1D 2WNGA 4JRXB 1Z2KA 2NY6D 4EI5A 5F9JA 4NCDA 3RWIB 4AENB 1PSKH 2YUZA 4PRNB 4IIQB 2Y5TB 4I18A 1ZVHA 4WU7B 3N1FC 1MCKA 3OF6D 2O26U 5GGVY 3BDBA 4LF3B 1S9YA 4CN6A 3P0YH 1QYGL 3LS5H 3N9GL 2ZSVB 3TVMD 5C92A 5IBTH 5CKAA 1BIIB 3KG5A 1ND0A 2IEPA 4LKXA 8FABB 1XF4A 2AXHA 1FL5B 5LXGL 4QRPE 2CDGA 4YBLB 1G6VK 3ESVF 3EOAB 5GJTL 1ROWA 2QR0B 2X4RA 5FK9A 3WKMH 3V6BR 1RJCA 2YPLD 3RVVC 5HYJB 3VRIB 1KPRB 4HUMB 4N9OB 2VLRD 2DBLL 1WIOA 2XQBH 3EO9H 3NTCL 3S96B 4F80A 1A14H 4QF1B 4ZUUA 2X9XA 3RVXD 1N2RA 2MPAH 3D2UD 4HHAB 4JFED 4MAUL 4OFYA 3T1WA 3MACH 2LVCA 3O6LH 5T1DL 3TP4A 4X6DF 3A6BL 4NZDA 1NCWH 2NX5A 4JO1L 5I75B 4EZMA 3QDJA 4QXGL 2E9JA 5FYKU 3S88H 1AGBA 4HS3B 3LQZB 3SDCC 3KPSB 4TN9A 2G75B 3M17A 2GW5A 5ALBL 1JIBA 1RZGB 5KS9E 1FBIL 3TCLA 4JFDE 2YRZA 3U4AA 5E00A 3RY5A 5ENWB 3MNWB 1XZ0A 1SY6L 4FG6C 3ULSB 6CGTA 5JNYA 4JPWL 1OT1A 1MCWW 3LZFH 1N26A 4JQIL 3T8XB 1K5NA 1P1ZA 5D5MB 3HE7A 5EUKB 5DURB 4MVBC 1LK2B 1IAIL 4YC2C 5D5MF 3VWKC 2ESVA 3FCTA 5KJRL 4NO3B 1RUPH 1EO8H 1OAZH 3TA3C 1NCBL 5KSBB 2VR9A 1ZVSA 3GZKA 5CHNB 2A2QT 3QQNA 3SDXF 1KF9B 4RCAA 2ZUQB 2FX7L 2NMSA 3BPOC 4U49A 5C2BL 2VDQL 4Y19A 3FQRA 1RSFA 4HWBL 4G6FD 2W0FA 4F33A 4Y5VB 4X6FB 3P0VL 1B0RA 4L29A 4JM2C 2MCG1 3SOBH 1G0XA 4MJ4A 43C9A 4H8WC 5F1NB 5CP7A 3W0WD 2KDGA 5DJDA 4CVZB 5A40E 5ALCH 1J1OL 1AKJA 5JDJA 3FHQA 4ISVB 3W5NA 2QSTA 3Q3GB 4KDTC 3OR7B 3ARZA 3IFPA 5F6HI 3V8OA 1ZT1A 4D0CA 1DBML 2YMXH 2YPLE 4GQPH 4M62H 3X14A 2YUWA 4UQ3B 2CRYA 2DQGL 5FM8A 1R0AL 2NYYC 2VLRE 4I0PA 1DUZB 2P24A 1A0QL 4ZAKD 3I9GH 4YWGH 5AG9A 1MJUL 3T4YB 4M7JH 3TN0A 4JFEE 1U8NA 4HUUB 2J6EL 4LSRH 2CD0A 5F6HJ 2P5EB 1WT5C 32C2B 4XGZB 3KR3H 5IFHL 2R29L 3MREA 3D48R 1X5LA 1HQRA 1I7TB 4L4TA 1H9VA 4PY7A 4JJ5B 4TUOB 4GG6A 4P3CL 3KJ6L 3QBTB 4LLAA 4LHUA 3QUXC 5D7IE 1JGUH 4K71C 3OAZH 3VFWA 5E56A 5E6ZA 4FXGA 2VLJB 2NLJA 2O5XL 4EN3A 1IAKB 4C59B 1CCZA 3OAUL 3VA2C 5TDOA 1S9WB 1U8MA 2X7LA 3MGAA 1MAKA 3TV3L 5CBAB 1JMXA 3QPQD 4BFBD 4Z5RB 5CSBA 4NZTL 4BQ8A 5IQ9A 4GRLB 5DD5L 2ZG3A 3H9ZA 3DMMA 1S5HA 4NQCA 5F89B 1HH9B 1VEPA 4TULL 3FT4A 1CBVL 4FQCH 4M4RA 3RGVD 1GVIA 5L9DL 1JZ5A 4XNZB 1AXSB 4PUBL 2Z31C 1OTTD 1AD0B 2ADIA 4PJXB 2JF1A 3V95A 5JMRA 4L3CB 1W72A 3JVGA 4R7DA 5EOTA 4DUXA 1FZJB 4PJXF 4MDJB 4XMKH 3RU8H 2P7TB 4OZ4A 1AD9B 3QI9B 4JFPB 2HWZH 2HJKA 4LCWA 1WBZB 5I9QB 4DVBA 5C0IB 5K9JH 1MVFA 3U36B 3MRCB 4JDTL 5FXCH 4G8FB 3UDWA 5C0FB 3IAGC 2XZAL 1X4YA 4MA3B 4JG1H 1JYXA 1J05B 1U3JA 3FQUA 2A1WH 4Y1AD 4N0YH 1NGYA 3MRFB 3D39A 4FZ8L 4HSQA 2CIKA 2YR3A 2ADJB 4OF6A 1A3LL 1S7RB 4GMTH 4NFBA 4BM7A 2DQIL 4I3RL 1IQWL 5DVOA 4Y16C 4P9HC 3JV6B 4K8RD 4LLDB 2Q86B 3EUUA 1R3JA 3E8UH 4XPFL 1YA5A 5GRJL 3MJ7B 3HFML 5BCAA 1Y0LB 4QRPB 1D3CA 1PKQA 2NY4D 5DDHA 4P2YA 4HXBH 1W2KT 2WW8A 1FV1B 1J18A 1C7SA 2ZUVA 4FTVD 5D72L 2EDNA 2ITCB 4LHJB 4KMQA 3MV01 2I5YL 3HNTH 5E8NA 3JV5A 4HCRH 1DP0A 3TO2A 5I1AA 3MZTA 3VFMA 4GAGH 2XTJD 2ICWA 3DRTB 1WBXB 5E2TH 2HKHL 3O8XC 2FRGP 2UUDH 4KK9D 1UEYA 5MI0C 2DQHH 3GIVA 3LB6D 5CJ5A 2V2TA 1FZMB 4HGWA 3ARBB 1DQML 1QFWM 3ZL4L 5FAAA 3RDTD 2HRPH 3VD7A 4LSQH 1HK6A 4Y5YA 3G9VA 4MJID 5GS1C 4XI5D 1B4JH 3RX8A 5DHYB 4DK3A 4YFEA 5E08H 5IMMA 2Q6WB 2AXFB 2VAJA 4I2XE 4APQD 1BQSA 2NY6B 3F12B 5EPMB 3LQAH 3OHXA 4Z7QE 1CDYA 2A9MH 3SN6N 3PJSA 2WBJD 1OP3H 4Y1AE 1T83C 4NNPH 4F58H 1HKLL 5IEHA 1ZS8B 3CVHB 3W2DH 2YBRA 1P2CB 1CLOH 1P7QA 4Z7NF 1JPGB 4M6ML 4RX4A 5JW5B 3PP4H 1A1NB 4ZFFA 1XGTA 4UIMB 2FH6A 1HHIB 2JKXA 3Q6GH 4I3GA 3VD4A 4CVUA 1NBYB 2Z92B 3VFSB 2AEQL 1OW0A 3GMQB 4D2NA 1KLGB 5ITBL 4LPUA 1NEZG 1DR9A 2YUXA 1IBGH 3LPWA 1TVBA 5HHQA 4FTVE 5EZOH 3LCYA 3VI3E 5GZOD 4WHTB 3I6LD 3T0VA 3HKFA 3L5XL 5J56B 1EVTC 4QXUH 2AVGA 3A6CH 3H9SA 3PWVB 5LGHL 2EC9T 4JFEB 4KUCF 2O61B 3DGCR 3C60D 5KG9B 4OGXL 3GSOA 3CFCH 2XTJE 5IOPB 2DTMH 5I71C 1MCEA 1SJVA 5L0QB 3RFZC 4A6YL 3WUWA 5J1AA 2X1OA 2XA8H 5CGMA 5EDXA 5F9OL 4QGYA 4S1SL 3CLFH 5GGTL 4G6JH 2YXFA 4G6KH 1N4XH 4Y4KC 1CFTA 5DK3A 3OAZK 3SDAC 4PD4J 1IGCL 4GAYA 3MRLB 5FGSA 4ODHL 4MJIE 3N1QC 3NFPB 4Z95H 3NPSC 5GGUB 4EOWH 1S9KC 2E27L 4IS6B 3ULUC 1FNEB 1JHLL 1BZ9B 4RMQA 3WIFB 4G42A 1WIPA 5ESVA 1IZKA 3RKDC 3RQ3A 1MFEL 1KENH 1DUYB 4RGNC 1IKNC 4TTDC 1H15B 1JNLL 2IPTH 2VR4A 3GUTA 1CGXA 1T1XA 1LEIA 2R4RH 5I17A 1UCBH 3D0VA 4Y2DA 5B39G 4M6OL 3SDCD 4O58L 5JORA 3LN5B 1J87A 2YA0A 4X6BA 4NQDA 2P8MA 5GGSA 4DGIL 5E94A 3B5HA 5D2LA 3AGVA 4E41B 5J12B 3ME0A 1YEEL 3CU1A 3QDGD 4FG6D 4K23H 2R2BB 1YPZB 5EG6C 5I1KL 3V6OE 1OF2B 3K8MA 3I50H 4MVBD 3I6LE 1AY1L 3PQYD 1HE7A 4PRDB 5DK2B 3QXDA 3VWKD 3ZDXF 4CAGA 3OR6B 2GHWB 5I1EH 3BAEH 4HIXL 2CDEB 3VH8A 4QWWC 2ICES 1KJ2L 3OKMA 4LIQE 4X5XA 3EYVB 1MFDL 3GBNH 3UTTD 3HE6C 1AIFA 1UXWA 2BVQA 1A7BA 3RPKA 3P77B 4DOHB 1U93A 1VFUA 1J0KA 4IRSA 5JW4M 1OARH 2DB8A 4PJ8B 1Q9OB 3D1MC 4JM2D 5IHUL 2C3HA 1NBZB 4Z78B 1MCPH 4KI5F 4XC3H 1W0YT 1CXKA 4PYGA 4XB8A 5J9PA 2C4FT 2LE9A 1RUQL 5EU6A 4EXKA 3PDDA 1YJDL 4W6WB 4PJCE 3RWEB 1HXYB 4AEIL 2DDQH 3GI9L 4WW2A 3OJDA 3G5VB 1MWAA 2DQTH 1K4DB 2NYYD 1K6QL 5AZ2L 5TFSH 2EDQA 2C7UB 4GAJL 1VENA 2AKRA 4H1LA 3ARDC 2ICCA 4ERSH 3CXHJ 4LKCB 4PFEA 4KUZL 5GS0L 4D8PB 1BBJB 1YEDB 1I7ZA 3EZ8A 4KK8C 4GRWE 3MUJA 4N0RA 2YWZA 2CKBH 2EDDA 3QUXD 5HXMA 4X0KB 4JR9H 5A2LH 1MCOL 4MXWH 3HRZB 5FYJU 1E4XL 4WTZA 4QHNA 3LEXB 3QDGE 3UBXI 1JGEB 5BO1L 1DFBH 3DUHA 3QH3A 3RL2B 4XNQA 2MHAA 3EYSL 4UU9A 4X80H 2UY7A 2CH8A 1IEBA 3WO4C 4TTGA 4NO0D 3KPOA 3PQYE 4ETQA 2PETA 4BELD 3Q6FA 1T22A 4P4RA 1XF5A 4ODXB 4YXLL 3VD5A 2WLZA 4K7PH 3C08L 3RWGA 4NOBA 5IQ7H 2B8OT 3X11B 2L0DA 4HS8H 1RIUH 4BZ1H 5B38A 1RJZA 1H5BA 2Y1VA 1INQA 5BZDB 1Z3GH 3WFCH 1C12A 2Z31D 4MQ7A 1X4ZA 1BFSA 3KYOB 4CL7A 3KLAA 4WI3A 5EBWA 3OG6B 4JDZA 5D96C 5FYLH 1E4KC 2WV3A 5DRXB 5ISZA 3TBYA 2WP3O 2YKLL 4TUKH 4AYFA 4GJTB 3L1OH 2EYRB 1BAFH 5HHXH 4N8VA 3RNKA 3I75A 3GSXA 3C5ZA 3QNYB 3GSNA 3PWPD 3D25B 2ZCLH 3AAZA 1KTDB 1KJ2A 5F3HA 3DV4A 3AM8A 4P46B 2Z0BA 1Z9MA 1SEBA 4WFHD 2XTJB 4J23A 5D7LD 5J7CC 4U31A 2EICA 5I1GL 4R4BB 4AG4H 4YHPB 4H88L 1Z9LA 2E7LC 4FFZL 4P5TA 3RA7H 5JPNA 1MH5A 1X9QA 2YA1A 3U4EB 2PTUA 4KRPB 4Y16D 4KPHH 3UBXB 4NOFA 3T77A 4QT5B 5CEXB 2IFFL 3T0EB 4I0KA 3X12B 5FUZL 3L3OB 1S7TA 3BDXA 5IVXB 2X4OA 4MXVF 4MJIB 1FLRL 4PRIA 2EDOA 1KB5H 1CTOA 3NGBB 1F90L 1L7IH 5DUBB 4D94A 1TZHA 3LIZL 3MV9B 1U92B 2P5WD 3ROOB 1AP2A 5JPMB 5C70A 1DBJL 1FYTB 5C7XL 4U6VL 1U95A 1WIUA 3L95B 2ZCKL 4X6CB 5JIKA 2QSCL 5JXEC 4GFTB 3S34H 1ZWIA 4WGVB 4O2EB 1K8IB 2OXGA 1PSKL 4X6CF 4B41A 1G9MH 4UAOC 3TCXA 3GFUA 4KRLB 2EKSB 5C08D 5CAYB 2PTVA 3TPKA 3S35L 1F4XH 3QAZB 2MCPH 4FQLL 5T3ZH 1EVUA 3QEHA 3LS5L 3OTTA 4PGBB 4C54A 2J88L 1NAMB 3DX6A 5IBTL 5DHVB 4NZJA 1N5AA 3ZKXC 3UAJC 3BGAA 1T80A 1ZT4A 2FHFA 4HIHA 4HWZB 4TSCH 4BSVB 3CNKA 4PYHA 3KPQB 4PRPA 1ULVA 4IMLA 3OKOA 1F6FB 2A6IA 3FQWA 2BP3A 4HKJB 2E9IA 3PWPE 3WKML 2YPKA 2OP4H 4D0DA 2F58H 1R3KA 4PJIE 1PG7X 3JUYA 4FXKB 3MRJA 4WFHE 5DRWA 3EO9L 4QRQB 2AXGA 1P7KA 3LN9A 4TSAH 4XZUB 5D7LE 1A14L 2MPAL 1T0PB 4ZSOA 4JJHA 4M7LH 3D87B 1V7NL 1HZHH 3PHSA 3BO8A 3O6LL 2EH7H 4NQXB 3WSQH 4CGTA 3ARGB 3ZT5A 3B2UC 3QXUA 4L8SC 1NCWL 1UZ6F 4QOKB 4ONGH 3VGFA 1NGZA 4EVNB 3S88L 5F93C 3U9PH 1RJLB 3SE3A 2ENSA 5F9AC 2RFXB 4CU8A 4O02H 4OZFG 1MLCB 1P7HL 4F3FA 3UYOD 3WV0A 1E28B 5KVEH 3HA0A 2P5WE 2LV4A 1L9NA 3SKNA 3LZFL 4V2BA 3VGBA 3P11H 1EERB 5HYQA 4U3CA 1ETZA 4UB0L 5AYQA 3RWCA 5IT2L 1M71B 3QISA 4R26H 1X7QB 1II4E 2VNCA 2OL3B 1OM3L 2UZYB 1IM3A 1NUGA 5FOBA 2A6DA 3GRWH 3KWWB 1RUPL 1EO8L 1EJ6A 2IBGA 4PJHF 1OAZL 2LVEA 5SWZB 2JCCB 2GJ6A 4OLEA 5C08E 4L4VD 4GRWB 2FIKB 4ODUA 4RGOH 3SDCB 2X89A 4IDJH 4PJ5D 4OZIB 2J7LA 2VXSH 1UZ8B 3WDHA 4Y4KD 2R15A 3REVA 1NLDL 4X4MA 3QXAB 1CU4H 3SDAD 2BY1A 4LCUB 3WFBH 1BBDH 2DYPD 5MERB 2DM3A 4ZXBB 1WQVT 1YY8B 4X7CC 4X7SH 4CNIB 4IRJA 3AS0A 4N0FB 5ALCL 5EU5B 2V5YA 4ONHA 2FHBA 4YC2B 3IJYA 1JGVH 1GPOH 3RKDD 1NFDF 4MLSA 2AS5M 2YMXL 4GKNB 1VFBA 3TA3B 4M62L 1R5VA 3VG0H 2AJZB 2C3WA 3I3BA 3L7EA 3I9GL 4YWGL 1OP5K 5DJAB 3DSFH 3O2VH 2R1YA 4M7JL 5SWQB 3BPOB 43CAA 2BNRB 1JNHB 4IOSD 4ZNEE 1EA9C 4PJFA 4LSRL 1I3RA 4Z18A 1CF8H 1LK3H 4AL8H 3LDBC 3KR3L 4YLQT 3QFDA 2APFA 2D9CA 4JM2B 3S7GA 3HMXL 3RUGA 3WE6B 4ELMF 3V6FA 1GIGH 4PG9A 3BUYA 3BSZH 1JGUL 4XPBH 4JVUA 2LFGA 5FM4A 4CW1A 1BQHB 4GW1B 3C6LA 3OGOE 4B5EA 2ENYA 3FTGA 3DI2B 4EI6A 4EBQH 2Z35B 3S5LA 1PQZB 2AJVH 2R1XA 5TDNA 4K7FA 4QWWD 4IOFC 4JZNB 3X3GH 5LWYL 3ZTNH 2ZJSH 1CL7H 4NWUH 1R3LB 1YUHA 3EJJX 4PB0H 2HFFA 3B8SA 5J11C 2YN5A 5MEND 2AJ3B 3HLAB 4XC1H 1HCVA 4L4VE 2RQ8A 4PJ5E 2ZPKH 1ZT7A 1CGTA 1HWHB 4LDEB 3D85A 2H3NA 3TBSA 3BN3B 4JZOB 4L3AA 5L7XL 1IJ9A 3EAKA 4N1CA 5E2JA 4I4WA 5J6HB 2VC2L 3GKZA 4JZJA 3GSNH 1QOKA 1YNTA 5E4EB 2DLEA 3J8F7 5E6ID 3RU8L 4O2FA 5KVDH 3HI5H 4GG8A 3DGGB 3ULUE 1QBLL 2HWZL 4U33A 5K9JL 4FHBD 1EEQA 1FZKA 5D1QC 2DRUA 5ID0B 2ICEB 1EFXA 1NKRA 1P9MC 4WI8A 5ERWB 3ULVC 4K3JH 4RGNE 4YH6A 4HBCH 1H3WM 3TIEB 1G7QA 1ZTXH 2AV1B 3ARDD 1ZHKA 1P53A 1ZGLM 1F3JA 3LKRB 3H0TB 4UZGA 3SE4A 3R06A 2BVOA 4JG1L 5F70A 2OR9H 1DDHB 4XXDB 1K8DA 1ADQH 4MA1B 4QHLB 2A1WL 4PJ9D 2B1AH 4XP1H 4L9DA 3TPUA 4UQ2B 2Z31B 1JPST 3QQ3B 1ZANH 1XF3B 5HGAB 2LTQB 2D7QA 3G6AB 4GMTL 1DEDA 2J1KA 4HWNA 3PWLA 4L8CB 5KZCD 4D9LH 4EI5C 3PXJA 4TVPH 4F7TA 1LMKA 1KC5H 2NY3C 2E6QA 3A6OA 4J2XA 3DX8A 4QNPE 1MEXH 1QO3B 1MY7A 4NN5C 3BPLC 4HXBL 1RFDH 2DLIA 4PJIB 2VE6A 5E95B 1EV2E 3I2CH 1NMBH 1UH3A 2FLBT 1G1YA 3HNTL 3WFZA 4QO1A 2FD6H 4HCRL 2IADB 5T5FH 4FQQB 4M61B 1G7JB 4GAGL 5MENE 4G9FD 1Z0MA 5IKCB 4HXAH 5F9WC 4PJ7A 1I7RB 2DQHL 1UCTA 2AK4D 3BP7B 4OD2B 1MRCL 1M1SA 3SO3B 4OLYH 2XN9A 2BZDA 1RZFH 2HRPL 3WXWH 2R8SL 2ZOLA 4LSQL 3DYOA 4JG0H 2P5WB 1B0GA 5ESQA 1NMAH 4C56D 2VB5A 3O45B 1C5DB 2UWEB 5EC2A 5IROC 4JQVA 3UZVB 4NO5A 1B4JL 3K0WA 5FECB 5E08L 1Q9LA 1QFPA 3RTQA 4LEXH 3WS3A 2UWEF 4OFDA 2C3VA 1ZA3B 5L8LB 1QLRB 2A9ML 1FVEA 1FZOA 3O8XB 3TM6A 1GH7A 4PLOB 4RZCB 1BLNB 4F58L 2LAAA 1HHKA 4X9HA 4FQ1H 1F00I 1WAAE 3MRDB 3UYRH 2DMCA 1FO0B 1JWUA 3K2UH 1CLOL 3HE7C 3IDXH 4F9PA 3PP4L 5A2IH 3MV11 3WO3B 4KAQH 2AI0H 5GS1B 1X5AA 3Q6GL 1MAMH 1IAOA 3NIDF 3LQMA 4G6AC 4M43H 1N8ZB 5EULV 3VFPA 3CMOH 2FO1A 1KFAH 2ADGB 3FQXA 1XGYH 5IVZB 5EU4A 1IBGL 2DL9A 3BGMB 1P5UA 3BXNA 2XY2A 5F88B 3RX7A 5EZOL 3NFNB 4N1EA 3HS0B 3BZEA 5BRZE 4U6YB 3QCVH 3OKEA 4QXUL 4WI4A 3A6CL 3QUYB 3D18A 1F4WL 5A2JH 3CZFA 5EBMB 3GB7A 4MLIA 5D4QA 3CFCL 5B3JF 1G7HB 4YE4H 4ZO9A 2DTML 4HQQH 2IAND 3ZHKA 1BZ7A 4RAUA 4IHOA 4JFZL 3C8HA 4XNUH 2XA8L 1HKFA 4KC3B 3VXSA 3V5DB 1RZ8B 3CLFL 2AK4E 4G6JL 2DL2A 5SWSD 4G6KL 5HYIA 3QUZC 3UJTL 5HTSA 4C56E 3CDCA 1VGEL 3DRQA 1RZJH 2CKNA 4Z95L 3ARFA 1I1YA 1VESA 1CG9A 2Y7QA 4H5SA 5E5MB 4EOWL 3VW3H 2VIRA 4JM4L 4KFZC 4AT6A 2W0PA 3INUH 1BM3H 2CUMA 1KENL 2XQYK 5C71A 1GC1C 4JRXA 4O4YH 2GY5A 4R2GC 3K8LA 4ZODA 1ZHBB 3RWIA 4AENA 4PRNA 5D7JB 4EN3C 1CFQB 4IIQA 2Y5TA 3B2UD 5TF1H 4WU7A 2R4RL 3PF2A 1P84K 2ZUYA 5MHSD 4XCCH 1UCBL 4P5KB 1NKOA 4TRPH 5ICXB 4LF3A 1A64A 3SQBA 4L8BA 5H37G 3NPSB 2X5PA 2ZSVA 3QRGH 4B7IA 1BIIA 3WJLA 4KK5C 4K23L 1D5IH 4GQ9H 3DMMC 5IESH 1FL5A 4MCZB 1UG9A 1ZE3C 4MB4A 3I50L 4RGNB 1LO3H 1A1MB 3EOAA 2QR0A 2BSSA 4XVJH 3BAEL 5HYJA 5I1EL 4WENB 3VRIA 4JREC 1KXQE 4LPCA 3B9DA 4Q9BA 4MNHB 1J86A 3S96A 4Q9CA 1I8LC 4G8EB 4IJ3B 4QF1A 3AC0A 4HHAA 2WUCH 3FQTB 2Y07H 4QHUB 5I1JL 2IANE 3ARYA 5D7SH 2EIZB 2VLKB 5JUEH 5CGYC 1OARL 2OI9C 2EEAA 3TH2T 4UTAH 4GKSB 2Q8BH 1BF2A 4HS3A 3LQZA 2BOBB 3KPSA 1A6WH 3QEQD 2G75A 4R3SB 2GI7A 1RZGA 4XC3L 4M9PA 3THML 1C5CH 1MCBA 2CLRB 1HSBB 3ULSA 4AEHH 2IH1B 2DDQL 5D5MA 2FX9H 5EUKA 2B20A 5TFSL 3HE6B 3ZSTA 5CD5C 1LK2A 4MJ6B 3WS6A 4X5LA 4ERSL 3VFOB 1OTUC 4RWYH 5FGCE 4PJDB 5DYOB 5KSBA 3VI4F 1ZHLB 3MYJB 5MHSE 4LNRB 2NY0B 1YNKH 3W82A 4WRLA 5CHNA 4PJDF 3VXNB 3K80A 1UJ3C 4BZYA 2CKBL 1K3IA 1NC2D 3GJFB 3AREB 1LO4H 1VKXB 1KJVA 4JR9L 5L88H 4MXWL 1F6AA 2B4CH 1TENA 2X4SB 4X6FA 3QUMH 1DFBL 5EBLA 5F1NA 4CVZA 2HLAB 1A2YB 3MRIB 4XBGB 4WIQA 4X80L 3G5YB 4ISVA 5F96L 3BWUC 3Q3GA 4IOFD 3OR7A 3HPJB 1N0LA 1CD0A 2DIAA 4UQ3A 1SHMA 3UX9B 2OQJB 5HI5D 1DUZA 2R9HC 3BRGC 1HCFX 5IQ7L 2J5LC 4QY8B 3TT1H 3VXUB 5DQ9B 3T4YA 3H6JA 4HS8L 5HYEA 1RIUL 5IJKA 3OZ9L 2WIIB 5IW6B 4HUUA 1WZMA 1AC6A 4NKIH 5AAWA 1NEZB 1T04B 5BQ7B 2P5EA 4XGZA 3WFCL 1LEGB 2P4AB 1YN6B 2ZCHL 4ONOA 5CLWA 1I7TA 4YXKL 4YHLH 4JJ5A 1M7XA 2P8LB 5FYLL 3QEQE 4BK4A 1VSCA 3WO4B 4PRAB 5I8OH 1FCGA 2VLJA 4TUKL 3L1OL 5HHXL 1BAFL 1QNZH 5BRZB 5F1IB 1L4IA 1S9WA 3WNNA 2ZCLL 3FB6B 1T66D 2NY5H 5CBAA 4Z5RA 5KBNC 3AXLA 4MAYC 2DD8H 4HK0B 4GRLA 3CU7A 1MJJB 1MY5A 4GT7A 4NPYB 4PJBB 1AGEA 1Q72H 2PW2B 4F37K 2E3VA 2RHEA 4JAMA 1DSFH 4PJAF 4AG4L 1BJ8A 5F89A 2AJYH 1HH9A 3MA9H 4N5UA 1A22B 2ZUUA 2PYEA 2MWCA 4K3DH 4KPHL 1AXSA 4EI5D 4XWGH 2NY3D 5IWLC 1AD0A 2RB8A 2DLTA 2RIKA 4PJXA 4C56B 3C09B 4J12A 1TJGL 4MQXC 4L3CA 4N9GB 1FZJA 4RNRB 2QKIB 1KB5L 4GRMB 1L7IL 4MDJA 4MNGE 2P7TA 2OK0H 1AD9A 1UEMA 3QI9A 3U2SB 4NRXB 2YSSB 4JFPA 4FQ2H 4FMKA 5I74C 1WBZA 35C8H 5EU3B 5C0IA 1RK0B 3U36A 2VDOH 3PP3K 2H1PL 5HY9B 2DM7A 4G8FA 3T65B 3DLQR 5AZEH 5C0FA 3S34L 4RISH 1IMHC 4MZ2A 4V2CB 1J05A 2C3XA 1U3ZA 1KEGH 2DI7A 1G9ML 3MRFA 2DQCH 4JFFB 4G8IB 5FDWB 4M93C 5I16B 3QT2A 1Y18B 2ADJA 4IRZH 3S36X 1S7RA 4L1DA 1F4XL 1HHHB 4EEEA 4M6AA 5T3ZL 2F5BH 4UUJB 4OLXH 5E8OB 5TGBB 2BNUA 4LLDA 4OFYD 2Q86A 3FB5A 3S37X 1U8HB 4QYOB 4TSCL 3MJ7A 2W07A 1Y0LA 1MRFH 4QRPA 4D9RD 3JUZA 5GS2D 2NX5D 4Z7UE 3JWNC 4CVWA 3QDJD 3EFDH 1VACB 3PWUB 4Y2DC 3HZYB 5K59F 2OP4L 2F58L 3IKKA 2ITCA 4HH8A 1SYSB 1YEHL 5FCUH 3BJLA 3VFGH 1PEWA 4TSAL 5C0CD 2X1WL 4M7LL 1IARB 4LARL 1HZHL 1EXUB 3DRTA 2XPGA 2EH7L 1WBXA 3HE7D 3WSQL 3QYCA 5C0AB 3VFUB 3ZKXB 5IEKB 1VGKA 3HAEH 4ONGL 5A43C 5HHOB 2ESVD 3U9PL 4JPIB 1DVFC 4WUKH 4G6AD 1FZMA 3ARBA 3GSRA 3MBXH 3U7YL 3K3QA 1INEH 2CIIB 5KVEL 5IBUG 4U1GC 2XXCB 3ARVA 5FYJE 5DHYA 3V9FA 4ODSH 4IRSC 4Y19D 1PLGL 2Q6WA 4R26L 1JP5A 1TJHL 2AXFA 3UTZB 5EPMA 3F12A 1L0XA 3GRWL 5FGCB 1AKJD 4L8SB 3RBSA 4YDKL 1ZS8A 4RGOL 3O11B 4IDJL 3BQUC 1P2CA 4NZRH 5M7QA 4WW2C 5CJOH 2P45B 3V8CA 3GMLB 4QEGA 1MQ8A 2VXSL 4YO0A 5JW5A 2F19H 1CU4L 3WFBL 1A1NA 2IBBA 1BBDL 2GUOA 1G0YR 1HHIA 5I73C 4K94H 1NBYA 2Z92A 5EB9A 3VFSA 3GMQA 3W9EB 1KLGA 4D9RE 1UH2A 3BYYA 2NX5E 3QDJE 2C1PB 4L4TD 1JGVL 4P49A 4R0LB 5CGTA 1BGXH 4W6XB 3CXDH 4LHUD 3E2HC 4R2GD 3VG0L 1I8KB 3KLSA 3SGKC 3VXTB 3PWVA 4M48H 3ZE0E 1MI5B 3LKNB 5C0CE 3DSFL 4EN3D 3MCLL 3O2VL 2O61A 1YY9D 3MCKB 3Q2CA 5KG9A 3KNBB 3O3BB 5IOPA 1ZGLA 2DBJA 3I6GB 1LK3L 2UZXB 3KYMB 3V5KB 1XR9B 2PYFB 1F11B 4LCIH 3JXAA 2YD6A 4KK5D 3U6RB 3BSZL 1Q8MA 5EA0H 3DMMD 1QSFB 4XPBL 5GXBB 3MRLA 1H5BC 5GGUA 2EYTA 5BW7C 2IAMC 4EBQL 3PABB 4FQIH 2BRQA 4IS6A 2V2WA 4Y19E 3RI5K 1BZ9A 3WIFA 1TQCC 3BH9B 3X3GL 3ZTNL 2ZJSL 5IUSA 1CL7L 1DUYA 2DJ4A 4KTDH 4NWUL 1FE8H 4PB0L 1H15A 4LCWD 1PFCA 5A16A 2C9AA 5CGYD 2ZPKL 5HYSB 4KKBC 2EDHA 3C5ZC 4XNXL 1VEMA 5C0BB 5B22A 3VFRB 1G84A 3HC4L 3LN5A 3AM8C 2QADC 3WIHH 3D39D 1LNUB 4E41A 4GLRH 5IBLD 2YWYA 4K9EL 3HI5L 4XVTH 2EDXA 1YPZA 1T4KB 4L4TE 3DYMA 2GK0B 1OF2A 4P5TC 1NJ9B 2VUYA 4GG6E 2FR4B 5CD5D 2A73B 5DC0A 4K3JL 5DK2A 4HBCL 5J11B 3OR6A 3J7HA 2CDEA 3KS0H 1KLUB 4DKEH 5HI4C 1ADQL 1YJDC 3MODH 2X10A 4XP1L 1SBSH 1TLKA 4ODTH 3JTSB 1TZGH 5FHBH 4DN4H 4PBXA 3S3SA 3MLWH 1D5BA 3P77A 1A7PH 3EBAA 2X4TB 4G3YH 2ED8A 4PJ8A 1Q9OA 5DK0A 4X5WB 2GCYB 3RIFK 5GS0C 4TVPL 4WV1A 1KC5L 4ZFOL 1NBZA 4Z78A 5D1QB 1AC0A 1MEXL 4Z7UB 4S0TD 5DTFB 4YHYB 1A47A 4ONFL 4RFOH 5C0GB 3NAAH 1LDPH 1RFDL 1HDMB 4YZFE 1HXYA 4B7LA 5IMKB 4HH9B 3U0PA 3IJHA 3DVGB 1N6QH 4HJJH 1Z0NA 3G5VA 1K4DA 4BUGA 3CX5K 2R9HD 1UM5H 3GIZH 2NCMA 2BCKB 2C7UA 2X4UB 1QPXA 2FD6L 5T5FL 3V7MA 4LCWE 4LPVA 1G6RB 4LKCA 2W60B 3MV7B 4U2ZA 5GRUH 3ZYZA 4CDGC 2FECI 1YEDA 4NDMA 1M7DA 1N7MH 3TLRA 3LKOB 2W65B 4HXAL 3NABH 4EI5B 1CQYA 2NY3B 2K7PA 2BHYA 5IMLB 1A6VH 1U3HB 4X8JB 4X0KA 4OLYL 3VCLA 1AGDB 3BPLB 5HPMB 3HRZA 3D39E 1RZFL 1JUFB 3LEXA 1JGEA 1NMAL 4Z7QF 2D0FA 2LU7A 3RL2A 1P7QD 5EO9B 2ZP0T 4RX4D 3QZWA 4LEXL 1ORQB 1T89A 4GUPB 1GRWA 3P2TA 1NC4B 1LVEA 3R0NA 1JHTB 3GMOB 3SE3C 1PKQE 3ARXA 4JFOB 4WI5A 3X11A 1J1XH 2YD7A 3FO2B 1HILB 2O5ZH 4YR6B 4RIRB 5F9WB 4FQ1L 4J6RH 5FKPB 2Z9TA 4HW6A 1S8DB 3D0LB 3UYRL 2JLLA 3K2UL 4HEPG 1UFUA 3DJ9A 3MLUH 5BZDA 5KAQG 1YNLH 3H9SD 5D6DA 1CGVA 4N0CC 3OG4B 5E1AB 3GDBA 4MQXD 5J8OA 3KYOA 2LABA 2BRRH 4KAQL 3T2OA 4LAJH 5KN5B 1MAML 1DANU 3P4MB 4M43L 2AK1H 2O5YH 3CMOL 4D3CH 1TNNA 1TXKA 1XGYL 3P4NB 1OGTB 2H41A 1OHQA 2ZSWB 5CUSH 5F7NC 2DM2A 3QNYA 3BMWA 1FRGH 3D25A 3QCVL 2ZG1A 3CVHH 5C0CB 4P46A 4C83B 3SDYH 2WBWB 4S1RH 4YE4L 3F7VB 4R4BA 1J0ZA 3CJJA 4HQQL 2AJSL 1F58H 4YHPA 3NCEB 1FP5A 4XNUL 5EWIL 3TFKC 3ES6B 1IC1A 3U4EA 4F7MB 1X5IA 2FZ3B 4WW1B 3UBXA 3N50A 4QT5A 5ADPL 5CEXA 3T0EA 3X12A 3IAQA 5IVXA 1U8IB 1IGJB 1GGYA 1EX0A 1R6VA 1CR9H 1RZJL 3HUJF 1ZLWK 2FO4B 5DUBA 4Y2DD 3EJZC 3MV9A 1U92A 3ROOA 3VW3L 3ISWA 2W0FB 1FYTA 3INUL 1BM3L 3SBWC 3L95A 5JZ7C 4YHKL 4X6CA 1CLZH 4R7NB 2HYMA 2NXZC 4O4YL 4O2EA 2VTFA 1T0NB 1K8IA 4XPTH 2HTLC 3C6LC 3X14B 3C8KA 1IAII 5HHNB 4XCCL 4TRPL 3KPMB 3SE9L 3QUZB 3H9SE 3S4SA 4L5FH 4NBZB 3OSKA 3MJGX 1DZBA 1N59A 2Y6SC 4PGBA 1NAMA 1MFCL 4Z77B 3QRGL 2XICA 4JO3H 5DHVA 5D2NB 1FNHA 1D5IL 4GQ9L 4BSVA 3TZVC 5CKGA 5IW3A 3KPQA 5IESL 4PY7B 3EOTH 4IRSD 2BXZA 3ET9F 4J4PC 4LHUB 4HKJA 5DJ8B 3MCG1 2CR6A 5CP3H 5E7BA 5DI8B 5GGQH 1XCTB 1EO5A 3DHJA 1Q94B 2I07B 4EN3B 4FXKA 2Q8AH 2E6JA 3MFGB 3U30C 4QRQA 1KTLB 4XZUA 5JHLL 5EU6D 5BMFH 1FFOB 1U8MB 2WUCL 2X7LB 5HSFA 2DKMA 2DI9A 2Y07L 2F74B 1Q1JH 3TYFB 1E27B 2VO5A 3MOAL 2CDFB 4NQXA 4CJ0A 1ZHNB 3ARGA 1FC1A 5DS8B 3WEXB 2KBGA 4OSUL 4QOKA 4UTAL 2VZVA 4PJCF 2MJWA 4EVNA 3DMMB 1GAFH 1S5HB 3D3VB 3C9NB 3SE4C 1RJLA 4XHQA 1A6WL 1QLFB 4L8DB 3GI8H 4PP2B 2RFXA 2JIXB 3L3HB 2H9GB 1MLCA 4KROD 5ACZB 1E28A 1C5CL 1RZIB 4WI2A 3EIFA 4AEHL 4MZ3A 4R7DB 5E8DH 1M71A 4JO4H 1JCKA 2FEDC 2FX9L 1X7QA 1ZMYA 3QG7H 2OL3A 2AEPL 4P4KA 3B43A 1BF8A 1X6NA 4DVBB 4KZDH 5JQ6H 3KWWA 3O4LD 4I3SH 5DD1H 4RWYL 3CDGB 2OI9B 5EUOB 5SWZA 1I85C 2JCCA 2HAZA 3WDJA 2FIKA 3SDCA 5JIHA 4OZIA 5BXFB 4CMHC 1ZOXA 3B9VA 5EUOF 3WLBB 2ERJC 1LO4L 1UZ8A 1KBGH 2YRLA 1Y6KR 3HB3C 3QXAA 4LCUA 3MUZ1 2B4CL 1UKTA 3K8KA 3QUML 4HKXB 5MERA 4ZXBA 1YY8A 4ZUVB 4CNIA 3IT8D 3VE0B 1SJXA 4N0FA 4GBXC 1MAJA 5EU5A 4ETYA 1KXTB 1E6OH 4EQ3A 4ELKA 1NANI 3ROLB 2HFGH 2NY7H 1EEUA 2YD4A 1E4JA 5BVPH 4BSWB 4GKNA 3MGTB 3TA3A 2OR7A 5HDBE 4Y4FB 2X1PA 5TF0A 2AJZA 5LG1A 1PKQB 1DBAL 5ISZD 4YHMH 1H0DB 4HX1B 4OQTA 2OZ4A 5DJAA 25C8H 5EU6E 1FFRA 3RWDB 4P2RB 2XZQH 5SWQA 1UJ3B 2BNRA 4X4XB 1JNHA 3PGDB 4IDLA 3C5ZD 4KKBD 4NKIL 4JQVC 4ZD3H 4N68A 4OZFH 5AWNH 3RTQC 2ZNWA 3ARRA 3C5JB 4CBPA 4JM2A 4QXWA 2QADD 4LU5L 3CUPB 4YHLL 4YDLC 2AEIT 1CVSC 3DO3A 1DQLH 1GSMA 2E9BA 2J8HA 4LVNB 4KDTA 1BQHA 4GW1A 3U4BH 4P5TD 3ECBB 5I66B 5DFWH 1QNZL 3BZFB 2PO6A 1MNUH 1PQZA 2J5LB 2VQUA 3QDAA 5J3HC 2NY5L 2VJXA 5C86A 4F9PC 1BJ1J 1PBYA 5HI4D 4LP5A 2DD8L 4PRID 4AIZB 4BJLA 1F2QA 3MLZH 3O4LE 1FN4B 5SX5K 3DARA 2JB5H 3CVIH 1SMOA 1Q72L 4K8RH 2DQJH 1DSFL 2AJ3A 3T3PE 2AJYL 3HLAA 3OHXB 3IVKB 3BVNB 1EHLL 4LPXA 4OIIH 4YAQB 5C6TH 4K3DL 1NQBA 1JPTH 1FLTX 2X6MA 4JZOA 1QRKA 5IEHB 1IZJA 1H8NA 3V79C 5J6HA 4AJ0A 4DEPB 2N4IA 2B2XH 4ZUWB 1BPVA 3MJ8B 2OK0L 3NCYP 5D93C 3DGGA 3DPBA 5IB4B 4FQ2L 4WCYH 5CIPB 35C8L 1T2QH 1V05A 4MAYB 2E7BA 5ID0A 2ICEA 5ERWA 2W9EL 3SKMB 3VG9C 2AV1A 4RISL 5ISZE 3H0TA 3PGCB 1F4AA 4PRPD 4W6YB 1DDHA 3EJYC 1NAKH 4QHLA 1KEGL 4MS8C 4Z7OE 2DQCL 4UQ2A 2Z31A 1YYMH 1U2HA 1GOGA 3QQ3A 3FRPA 4FFVC 2R0ZH 4LVHC 1A7NL 3G6AA 1FFQA 2F5BL 4OLXL 4PLNC 5DQDH 2J8UE 4L8CA 5M94B 4M5YL 5I74B 2DIBA 4X7FC 1KIPB 3PL6B 3CZJA 2IBZX 4JKMA 5CSZB 3TBWB 1QO3A 4IIQC 3SJVB 4F8QA 3KPLB 3EFDL 3HG1D 2WM0A 5FA3B 4YDIH 5FCUL 2KQMA 4X99B 4M93B 3ZE1E 4PRIE 3FFCA 2NY1C 5I8KL 4WO4A 2PNDA 3WJLC 2IADA 5K9KB 3HZVB 4FQQA 1G7JA 4DGVH 1J0JA 2I25N 2YUVA 4N0CD 4YBLC 5IKCA 1MLBA 4P99A 5K9QI 2WAHA 3TO4C 1FPTL 1NSNH 3BP7A 1T1XB 4WUKL 4OD2A 1OL0A 3CDFA 1L7TH 2A38A 4OCWL 3MBXL 5D8JL 5I17B 3I84A 2GJ6D 4NM4H 4Y2DB 1F4YH 3OKKB 4PD4K 3VRLE 1MQKH 2VXVH 3O45A 3OL2A 2UWEA 4NYLB 5JORB 4ORGB 4LIQH 4XCEB 4RGMC 5ICYA 2ED9A 5FECA 1TTUA 2X4QB 4RDQG 1RJYB 3KAAA 5HGHB 1S3KH 4PY8J 1Q0YH 4JPVH 1I7UB 1ZA3A 1FNSH 2CR3A 1QLRA 4PRPE 3O8XA 4UNTA 1OPGL 3QG6B 1BLNA 3QXTA 3X3FL 4LOUC 1I9EA 2D31A 2VAAA 3MLYL 1DVFB 3MRDA 4I48A 3S8WA 4NQUA 1MIEL 1SEQH 3V0WL 1FO0A 5CJBA 5F3BB 3S98A 1T7ZA 5CJOL 1JTTA 1YEGH 3DSNA 5C6PB 1I1FB 2F19L 2XZCH 1FDLH 1LO2L 1DN0B 1A6ZB 1EEYB 5GS1A 4C57C 3BEWB 3JWDC 2E7CA 4K94L 1N8ZA 4X9IA 4OCSH 2ADGA 1FNGB 3LMJH 5IVZA 3WNKA 3HG1E 4HF5L 4OM1H 3BGMA 1VHPA 5JZ7D 5F88A 4FNLH 1UWEH 3STLB 1BGXL 2AAVA 3NFNA 3TJHC 5I19H 3CXDL 2NXZD 5F71A 1FNAA 4U6YA 1O0VA 2HN7B 3QUYA 5EU6B 4GRWH 2PXYA 5EBMA 4M48L 2JK5A 3C6LD 3BQUB 3TF7C 4ZNEA 3ZYIA 1G7HA 2GJJA 1OD9A 2GK2A 4JHAH 4N0UB 3MRNB 4NKMB 5I73B