2NYDA

Crystal structure of staphylococcus aureus hypothetical protein sa1388
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
368
structure length
300
Chain Sequence
b'DPMKIADLMTLLDHHVPFSTAESWDNVGLLIGDEDVEVTGVLTALDCTLEVVNEAIEKGYNTIISHHPLIFKGVTSLKANGYGLIIRKLIQHDINLIAMHTNLDVNPYGVNMMLAKVMGLKNISIINNQQDVYYKVQEFMIDAYQKSRAEQLIKQTPVFDFIEIKQTSLYGLGVMAEVDNQMTLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIGYEYQAVQQGADVFVTGDIKHHDALDAKIHGVNLIDINHYSEYVMKEGLKTLLMNWFNIEKINIDVEASTINTDPFQYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0135 protein SA1388
publication title Structure of a conserved hypothetical protein SA1388 from S. aureus reveals a capped hexameric toroid with two PII domain lids and a dinuclear metal center.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 90
structure length 300
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.260 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2nydA02
2NYDA 3LNLA
chains in the Genus database with same CATH superfamily
1DX8A 1TWAL 1TWHL 1F4LA 3PO2L 5JVG1 4JADA 4XGHA 2PSMC 4TVMA 4QIWP 2PMZP 1Y1WL 1QQTA 2QL0A 4BXXL 3PIO1 2PYAA 4AHZA 2Z3QB 2PVEA 1PFVA 3KYXA 5C44L 3J7Y1 3GTQL 3VPBE 2JI3A 2A6HD 4AR6A 3K7AL 2CR8A 5M5WL 5IYCL 2M6PA 3H99A 1SMMA 1R0JA 2XJTA 3LWQB 1PFWA 1YK5A 3H9CA 1YUZA 3IU3I 2JI2A 3MQKB 5MFZA 1B13A 3PIP1 4BY1L 4X6AL 1I50L 2M4VA 1E8JA 3KYWA 2R7ZL 4A3BL 3RZDL 5MFPA 3PL5A 3LWPB 3HAXC 1VZIA 2AUSB 1QYBA 3S15L 2KKDA 2C6BA 3B08B 3WWLA 1PZXA 3GTLL 1DVBA 2VUML 2M4YA 3HOVL 4JAGA 2RFKB 4LHNA 1BRFA 3I4ML 1ZRPA 3RZ6A 1RWDA 3LNLA 1LKPA 3MPSA 5AN9H 1B71A 3P8BA 1RDGA 1I3QL 2V0FA 3RZOL 3GTML 5DM71 3M3YL 5C4JL 1I6HL 5IYDL 4AR3A 2PPTA 2ZIXA 3S17L 2Z3RB 1B2OA 3LPEB 3KYYA 5MLC3 3ZG6A 5M3ML 2JA7L 1P7PA 2B5ID 2XJVA 1NNQA 2NYDA 4Y7NL 4AI1A 3NFPI 3WWNB 2NVQL 4A3FL 1SMUA 1T9PA 1LKMA 2V0EA 4A3LL 3QVDA 2RDVA 2AYJA 3HKZP 2BE5D 2XJQA 2KN9A 2NVXL 1SMWA 3A44A 4AHXA 5JVH1 5C3EL 4TPUA 3FKIL 2V3BB 2XJRA 3S1NL 3GTKL 4A3IL 4A93L 3HOWL 3PO3L 2VL6A 1TWCL 1FHMA 1CADA 1VCXA 1BQ8A 4E6YA 1WCML 4C3HL 2E2JL 2R93L 1NXEA 3CQZL 4AR5A 4LHLA 4ME3A 5EINC 2B63L 4A3EL 2HR5A 5MF6A 1IROA 4AI2A 2CKCA 2DSXA 2JA5L 2A6ED 1R0HA 3GTPL 3HOYL 4POFA 3B0AB 2XJUA 5AI3A 1YK4A 2Y0SP 1YUXA 1NXGA 2M6OA 1RYQA 4V196 2C6AA 1JYBA 1ODHA 1IRNA 5IY0A 1PFYA 4ZN1B 1OWBA 4Y52L 1WJVA 1S30A 1R0GA 5IP7L 5MGNA 3J7Z1 7RXNA 2L0ZA 1B2JA 1RB9A 4BY7L 3PZAA 3HJYB 1IW7D 1R0FA 2HVYC 4ZN3B 4K9FA 4AI0A 4GS7D 2YU9L 1K83L 3MSUA 5GADc 1TWGL 1S2ZA 6RXNA 2ERSA 1R9TL 2J9UB 3FDJA 4A3GL 5M3FL 5GAEc 2XJPA 2JA8L 3PKIA 1LTLA 3PKJA 1FHHA 2MS3A 5AI2A 1PFUA 2NVYL 3RYGA 1IU6A 5C4XL 3H9BA 5EIOC 1BFYA 4AHWA 5DM61 3QQCE 4B8CD 3S1ML 3GTGL 1QCVA 2R92L 5IP9L 2A68D 1VZHA 2O5JD 1CAAA 3HOUL 4AR4A 3S2HL 3LWRB 5K2ME 5H1Sc 1T9OA 1RDVA 3H3VM 5GAHc 1LKOA 1SFOL 2JA6L 1Y1VL 1C09A 3KYUA 1OWCA 3I4NL 2A69D 1BQ9A 2EY4E 4RXNA 4BBRL 3LWOB 2LCQA 3PWFA 3M4OL 3H97A 3S16L 2APOB 4YWLA 4POGA 8RXNA 3KYVA 2WAQP 4JAFA 3RZTA 1S24A 2NVTL 1R0IA 1IU5A 2ERJA 2E2IL 1H7VA 4YWMA 4WFN1 2XJSA 4A3JL 1BE7A 2PVXA 3SS2A 5GAGc 3HJWB 3S1QL 2CKAA 4U671 3LWVB 4A3CL 1TWFL 5M5YL 3P2AA 3K35A 3S1RL 4G6BA 3HOZL 5FLML 4A3KL 3GTJL 1YV1A 2K2DA 4A3ML 5FJ8L 1Z92B 5RXNA 4BBSL 4AHYA 5IYBL 4JAEA 4AYBP 5M5XL 3GTOL 4UY81 1T9QA 3S14L 1VZGA 2GMGA 2JI1A 3H0GL 3S2DL 4C3JL 3JR7A 4XXBB 1RYTA 4AI3A 4A3DL 3HOXL 4C3IL 2H12A 4C2M1 2WB1P 2AQCA 2E2HL
chains in the Genus database with same CATH topology
1RDGA 1DX8A 4POFA 2V0FA 1T9OA 3B0AB 1RDVA 2XJUA 5AI3A 5DM71 1YK4A 5GAHc 5JVG1 1LKOA 4JADA 1YUXA 1NXGA 2M6OA 1C09A 1RYQA 4XGHA 3KYUA 1OWCA 2C6AA 2PSMC 4V196 4AR3A 1JYBA 2A69D 4TVMA 1IRNA 1ODHA 5IY0A 2PPTA 2ZIXA 1BQ9A 4RXNA 2Z3RB 4ZN1B 1B2OA 3LPEB 1OWBA 2QL0A 2LCQA 3PWFA 3PIO1 2PYAA 4YWLA 4POGA 1WJVA 4AHZA 1S30A 3KYYA 1R0GA 8RXNA 2Z3QB 2PVEA 3KYXA 5MGNA 3J7Y1 3KYVA 5MLC3 3J7Z1 3VPBE 3ZG6A 7RXNA 4JAFA 2L0ZA 2B5ID 2XJVA 1S24A 3RZTA 2JI3A 1NNQA 2A6HD 1R0IA 1IU5A 1B2JA 4AR6A 2CR8A 1RB9A 2ERJA 2NYDA 4AI1A 1H7VA 3PZAA 3NFPI 3WWNB 1IW7D 4YWMA 2M6PA 1R0FA 1SMMA 1R0JA 1SMUA 2XJSA 1T9PA 4WFN1 1LKMA 2V0EA 1BE7A 2PVXA 2XJTA 3QVDA 2RDVA 2AYJA 3SS2A 5GAGc 1YK5A 4ZN3B 1YUZA 2BE5D 2XJQA 4K9FA 4AI0A 2KN9A 2CKAA 4GS7D 4U671 3IU3I 2JI2A 1SMWA 3A44A 5MFZA 1B13A 3MSUA 5GADc 3PIP1 1S2ZA 3P2AA 2M4VA 3K35A 6RXNA 4AHXA 1E8JA 3KYWA 4G6BA 5JVH1 4TPUA 2ERSA 5MFPA 2J9UB 2V3BB 5GAEc 2XJRA 2XJPA 3PKIA 1YV1A 2K2DA 1VZIA 1LTLA 1Z92B 3PKJA 1FHHA 2MS3A 1QYBA 5RXNA 2KKDA 4AHYA 2C6BA 3B08B 2VL6A 5AI2A 3WWLA 1FHMA 4JAEA 1CADA 1VCXA 1BQ8A 4E6YA 1DVBA 2M4YA 3RYGA 1IU6A 4JAGA 4UY81 1T9QA 4LHNA 5EIOC 1BFYA 1BRFA 4AHWA 5DM61 3QQCE 1NXEA 1ZRPA 1VZGA 2GMGA 4AR5A 4B8CD 2JI1A 1QCVA 4LHLA 4ME3A 5EINC 4XXBB 2HR5A 5MF6A 2A68D 1RYTA 1VZHA 3RZ6A 1RWDA 1IROA 3LNLA 4AI3A 1LKPA 4AI2A 2CKCA 2O5JD 2DSXA 1CAAA 2H12A 3MPSA 2A6ED 5AN9H 1B71A 3P8BA 4AR4A 5K2ME 1R0HA 5H1Sc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYD A;  3LNL A; 
#chains in the Genus database with same CATH topology
 1DX8 A;  1TWA L;  1TWH L;  1F4L A;  3PO2 L;  5JVG 1;  4JAD A;  4XGH A;  2PSM C;  4TVM A;  4QIW P;  2PMZ P;  1Y1W L;  1QQT A;  2QL0 A;  4BXX L;  3PIO 1;  2PYA A;  4AHZ A;  2Z3Q B;  2PVE A;  1PFV A;  3KYX A;  5C44 L;  3J7Y 1;  3GTQ L;  3VPB E;  2JI3 A;  2A6H D;  4AR6 A;  3K7A L;  2CR8 A;  5M5W L;  5IYC L;  2M6P A;  3H99 A;  1SMM A;  1R0J A;  2XJT A;  3LWQ B;  1PFW A;  1YK5 A;  3H9C A;  1YUZ A;  3IU3 I;  2JI2 A;  3MQK B;  5MFZ A;  1B13 A;  3PIP 1;  4BY1 L;  4X6A L;  1I50 L;  2M4V A;  1E8J A;  3KYW A;  2R7Z L;  4A3B L;  3RZD L;  5MFP A;  3PL5 A;  3LWP B;  3HAX C;  1VZI A;  2AUS B;  1QYB A;  3S15 L;  2KKD A;  2C6B A;  3B08 B;  3WWL A;  1PZX A;  3GTL L;  1DVB A;  2VUM L;  2M4Y A;  3HOV L;  4JAG A;  2RFK B;  4LHN A;  1BRF A;  3I4M L;  1ZRP A;  3RZ6 A;  1RWD A;  3LNL A;  1LKP A;  3MPS A;  5AN9 H;  1B71 A;  3P8B A;  1RDG A;  1I3Q L;  2V0F A;  3RZO L;  3GTM L;  5DM7 1;  3M3Y L;  5C4J L;  1I6H L;  5IYD L;  4AR3 A;  2PPT A;  2ZIX A;  3S17 L;  2Z3R B;  1B2O A;  3LPE B;  3KYY A;  5MLC 3;  3ZG6 A;  5M3M L;  2JA7 L;  1P7P A;  2B5I D;  2XJV A;  1NNQ A;  2NYD A;  4Y7N L;  4AI1 A;  3NFP I;  3WWN B;  2NVQ L;  4A3F L;  1SMU A;  1T9P A;  1LKM A;  2V0E A;  4A3L L;  3QVD A;  2RDV A;  2AYJ A;  3HKZ P;  2BE5 D;  2XJQ A;  2KN9 A;  2NVX L;  1SMW A;  3A44 A;  4AHX A;  5JVH 1;  5C3E L;  4TPU A;  3FKI L;  2V3B B;  2XJR A;  3S1N L;  3GTK L;  4A3I L;  4A93 L;  3HOW L;  3PO3 L;  2VL6 A;  1TWC L;  1FHM A;  1CAD A;  1VCX A;  1BQ8 A;  4E6Y A;  1WCM L;  4C3H L;  2E2J L;  2R93 L;  1NXE A;  3CQZ L;  4AR5 A;  4LHL A;  4ME3 A;  5EIN C;  2B63 L;  4A3E L;  2HR5 A;  5MF6 A;  1IRO A;  4AI2 A;  2CKC A;  2DSX A;  2JA5 L;  2A6E D;  1R0H A;  3GTP L;  3HOY L;  4POF A;  3B0A B;  2XJU A;  5AI3 A;  1YK4 A;  2Y0S P;  1YUX A;  1NXG A;  2M6O A;  1RYQ A;  4V19 6;  2C6A A;  1JYB A;  1ODH A;  1IRN A;  5IY0 A;  1PFY A;  4ZN1 B;  1OWB A;  4Y52 L;  1WJV A;  1S30 A;  1R0G A;  5IP7 L;  5MGN A;  3J7Z 1;  7RXN A;  2L0Z A;  1B2J A;  1RB9 A;  4BY7 L;  3PZA A;  3HJY B;  1IW7 D;  1R0F A;  2HVY C;  4ZN3 B;  4K9F A;  4AI0 A;  4GS7 D;  2YU9 L;  1K83 L;  3MSU A;  5GAD c;  1TWG L;  1S2Z A;  6RXN A;  2ERS A;  1R9T L;  2J9U B;  3FDJ A;  4A3G L;  5M3F L;  5GAE c;  2XJP A;  2JA8 L;  3PKI A;  1LTL A;  3PKJ A;  1FHH A;  2MS3 A;  5AI2 A;  1PFU A;  2NVY L;  3RYG A;  1IU6 A;  5C4X L;  3H9B A;  5EIO C;  1BFY A;  4AHW A;  5DM6 1;  3QQC E;  4B8C D;  3S1M L;  3GTG L;  1QCV A;  2R92 L;  5IP9 L;  2A68 D;  1VZH A;  2O5J D;  1CAA A;  3HOU L;  4AR4 A;  3S2H L;  3LWR B;  5K2M E;  5H1S c;  1T9O A;  1RDV A;  3H3V M;  5GAH c;  1LKO A;  1SFO L;  2JA6 L;  1Y1V L;  1C09 A;  3KYU A;  1OWC A;  3I4N L;  2A69 D;  1BQ9 A;  2EY4 E;  4RXN A;  4BBR L;  3LWO B;  2LCQ A;  3PWF A;  3M4O L;  3H97 A;  3S16 L;  2APO B;  4YWL A;  4POG A;  8RXN A;  3KYV A;  2WAQ P;  4JAF A;  3RZT A;  1S24 A;  2NVT L;  1R0I A;  1IU5 A;  2ERJ A;  2E2I L;  1H7V A;  4YWM A;  4WFN 1;  2XJS A;  4A3J L;  1BE7 A;  2PVX A;  3SS2 A;  5GAG c;  3HJW B;  3S1Q L;  2CKA A;  4U67 1;  3LWV B;  4A3C L;  1TWF L;  5M5Y L;  3P2A A;  3K35 A;  3S1R L;  4G6B A;  3HOZ L;  5FLM L;  4A3K L;  3GTJ L;  1YV1 A;  2K2D A;  4A3M L;  5FJ8 L;  1Z92 B;  5RXN A;  4BBS L;  4AHY A;  5IYB L;  4JAE A;  4AYB P;  5M5X L;  3GTO L;  4UY8 1;  1T9Q A;  3S14 L;  1VZG A;  2GMG A;  2JI1 A;  3H0G L;  3S2D L;  4C3J L;  3JR7 A;  4XXB B;  1RYT A;  4AI3 A;  4A3D L;  3HOX L;  4C3I L;  2H12 A;  4C2M 1;  2WB1 P;  2AQC A;  2E2H L; 
#chains in the Genus database with same CATH homology
 1RDG A;  1DX8 A;  4POF A;  2V0F A;  1T9O A;  3B0A B;  1RDV A;  2XJU A;  5AI3 A;  5DM7 1;  1YK4 A;  5GAH c;  5JVG 1;  1LKO A;  4JAD A;  1YUX A;  1NXG A;  2M6O A;  1C09 A;  1RYQ A;  4XGH A;  3KYU A;  1OWC A;  2C6A A;  2PSM C;  4V19 6;  4AR3 A;  1JYB A;  2A69 D;  4TVM A;  1IRN A;  1ODH A;  5IY0 A;  2PPT A;  2ZIX A;  1BQ9 A;  4RXN A;  2Z3R B;  4ZN1 B;  1B2O A;  3LPE B;  1OWB A;  2QL0 A;  2LCQ A;  3PWF A;  3PIO 1;  2PYA A;  4YWL A;  4POG A;  1WJV A;  4AHZ A;  1S30 A;  3KYY A;  1R0G A;  8RXN A;  2Z3Q B;  2PVE A;  3KYX A;  5MGN A;  3J7Y 1;  3KYV A;  5MLC 3;  3J7Z 1;  3VPB E;  3ZG6 A;  7RXN A;  4JAF A;  2L0Z A;  2B5I D;  2XJV A;  1S24 A;  3RZT A;  2JI3 A;  1NNQ A;  2A6H D;  1R0I A;  1IU5 A;  1B2J A;  4AR6 A;  2CR8 A;  1RB9 A;  2ERJ A;  2NYD A;  4AI1 A;  1H7V A;  3PZA A;  3NFP I;  3WWN B;  1IW7 D;  4YWM A;  2M6P A;  1R0F A;  1SMM A;  1R0J A;  1SMU A;  2XJS A;  1T9P A;  4WFN 1;  1LKM A;  2V0E A;  1BE7 A;  2PVX A;  2XJT A;  3QVD A;  2RDV A;  2AYJ A;  3SS2 A;  5GAG c;  1YK5 A;  4ZN3 B;  1YUZ A;  2BE5 D;  2XJQ A;  4K9F A;  4AI0 A;  2KN9 A;  2CKA A;  4GS7 D;  4U67 1;  3IU3 I;  2JI2 A;  1SMW A;  3A44 A;  5MFZ A;  1B13 A;  3MSU A;  5GAD c;  3PIP 1;  1S2Z A;  3P2A A;  2M4V A;  3K35 A;  6RXN A;  4AHX A;  1E8J A;  3KYW A;  4G6B A;  5JVH 1;  4TPU A;  2ERS A;  5MFP A;  2J9U B;  2V3B B;  5GAE c;  2XJR A;  2XJP A;  3PKI A;  1YV1 A;  2K2D A;  1VZI A;  1LTL A;  1Z92 B;  3PKJ A;  1FHH A;  2MS3 A;  1QYB A;  5RXN A;  2KKD A;  4AHY A;  2C6B A;  3B08 B;  2VL6 A;  5AI2 A;  3WWL A;  1FHM A;  4JAE A;  1CAD A;  1VCX A;  1BQ8 A;  4E6Y A;  1DVB A;  2M4Y A;  3RYG A;  1IU6 A;  4JAG A;  4UY8 1;  1T9Q A;  4LHN A;  5EIO C;  1BFY A;  1BRF A;  4AHW A;  5DM6 1;  3QQC E;  1NXE A;  1ZRP A;  1VZG A;  2GMG A;  4AR5 A;  4B8C D;  2JI1 A;  1QCV A;  4LHL A;  4ME3 A;  5EIN C;  4XXB B;  2HR5 A;  5MF6 A;  2A68 D;  1RYT A;  1VZH A;  3RZ6 A;  1RWD A;  1IRO A;  3LNL A;  4AI3 A;  1LKP A;  4AI2 A;  2CKC A;  2O5J D;  2DSX A;  1CAA A;  2H12 A;  3MPS A;  2A6E D;  5AN9 H;  1B71 A;  3P8B A;  4AR4 A;  5K2M E;  1R0H A;  5H1S c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...