2NYEA

Crystal structure of the bateman2 domain of yeast snf4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
132
Chain Sequence
THFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPIIDENGYLINVYEAYDVLGLIKNDLSLSVGEALMRRSYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYILLGSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Bateman2 domain of yeast Snf4: dimeric association and relevance for AMP binding.
pubmed doi rcsb
molecule keywords Nuclear protein SNF4
molecule tags Protein binding
source organism Saccharomyces cerevisiae
total genus 28
structure length 132
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 2nyeA00
1O50A 4O9KA 3OCMA 1PVMA 3OCOA 3KXRA 2NYCA 4NOCA 2UV7A 3PC4A 2O16A 3L2BA 2QREE 2OOYE 1Y5HA 3PC2A 4COOA 2ZY9A 4GQYA 2P9MA 3LFZA 5KS7A 2OOXE 4PCUA 2YZQA 3SL7A 3FWSA 2RC3A 3K6EA 4L0DA 5K25C 2EMQA 2QRCE 3KPBA 3LHHA 3LQNA 2QH1A 4L3VA 2EF7A 5K24C 3FNAA 4GQWA 2YVXA 3FV6A 4FXSA 4P1GA 2UV5A 4P1OA 2OUXA 3TDHC 3TE5C 2QR1E 3ORGA 3L31A 5IIPA 2QRDE 1XKFA 3FHMA 5LXQA 3DDJA 5MMZA 2PFIA 2RIFA 2UV6A 3FWRA 4GQVA 3OI8A 3GBYA 2D4ZA 2UV4A 4L27A 3HF7A 2YVYA 4ESYB 2NYEA 3KPDA 2RIHA 4IY4A 3I8NA 3PC3A 2YVZA 2QLVC 3LV9A 2YZIA 3T4NC 4FRYA 1PBJA 3KPCA 4UUUA 4DQWA 4IY3A 4IYSA 3KH5A 5K22B 3K2VA 4L28A 4IY2A 4IY0A 1YAVA 4ESYA 4HG0A 5K23C
chains in the Genus database with same CATH superfamily
1O50A 4O9KA 3OCMA 1PVMA 3OCOA 3KXRA 2NYCA 4NOCA 2UV7A 3PC4A 2O16A 3L2BA 2QREE 2OOYE 1Y5HA 3PC2A 4COOA 2ZY9A 4GQYA 2P9MA 3LFZA 5KS7A 2OOXE 4PCUA 2YZQA 3SL7A 3FWSA 2RC3A 3K6EA 4L0DA 5K25C 2EMQA 2QRCE 3KPBA 3LHHA 3LQNA 2QH1A 2JA3A 4L3VA 2EF7A 5K24C 3FNAA 4GQWA 2YVXA 3FV6A 4FXSA 4P1GA 2UV5A 4P1OA 2OUXA 3TDHC 3TE5C 2QR1E 3ORGA 3L31A 5IIPA 2QRDE 1XKFA 3FHMA 5LXQA 3DDJA 5MMZA 2PFIA 2RIFA 2UV6A 3FWRA 4GQVA 3OI8A 3GBYA 2D4ZA 2UV4A 4L27A 3HF7A 2YVYA 4ESYB 2NYEA 3KPDA 2RIHA 4IY4A 3I8NA 3PC3A 2YVZA 2QLVC 3LV9A 2YZIA 3T4NC 4FRYA 1PBJA 3KPCA 4UUUA 4DQWA 4IY3A 4IYSA 3KH5A 5K22B 3K2VA 4L28A 4IY2A 4IY0A 1YAVA 2J9LA 4ESYA 4HG0A 5K23C
chains in the Genus database with same CATH topology
1O50A 4O9KA 3OCMA 1PVMA 3OCOA 3KXRA 2NYCA 4NOCA 2UV7A 3PC4A 2O16A 3L2BA 2QREE 2OOYE 1Y5HA 3PC2A 4COOA 2ZY9A 4GQYA 2P9MA 3LFZA 5KS7A 2OOXE 4PCUA 2YZQA 3SL7A 3FWSA 2RC3A 3K6EA 4L0DA 5K25C 2EMQA 2QRCE 3KPBA 3LHHA 3LQNA 2QH1A 2JA3A 4L3VA 2EF7A 5K24C 3FNAA 4GQWA 2YVXA 3FV6A 4FXSA 4P1GA 2UV5A 4P1OA 2OUXA 3TDHC 3TE5C 2QR1E 3ORGA 3L31A 5IIPA 2QRDE 1XKFA 3FHMA 5LXQA 3DDJA 5MMZA 2PFIA 2RIFA 2UV6A 3FWRA 4GQVA 3OI8A 3GBYA 2D4ZA 2UV4A 4L27A 3HF7A 2YVYA 4ESYB 2NYEA 3KPDA 2RIHA 4IY4A 3I8NA 3PC3A 2YVZA 2QLVC 3LV9A 2YZIA 3T4NC 4FRYA 1PBJA 3KPCA 4UUUA 4DQWA 4IY3A 4IYSA 3KH5A 5K22B 3K2VA 4L28A 4IY2A 4IY0A 1YAVA 2J9LA 4ESYA 4HG0A 5K23C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O50 A;  4O9K A;  3OCM A;  1PVM A;  3OCO A;  3KXR A;  2NYC A;  4NOC A;  2UV7 A;  3PC4 A;  2O16 A;  3L2B A;  2QRE E;  2OOY E;  1Y5H A;  3PC2 A;  4COO A;  2ZY9 A;  4GQY A;  2P9M A;  3LFZ A;  5KS7 A;  2OOX E;  4PCU A;  2YZQ A;  3SL7 A;  3FWS A;  2RC3 A;  3K6E A;  4L0D A;  5K25 C;  2EMQ A;  2QRC E;  3KPB A;  3LHH A;  3LQN A;  2QH1 A;  4L3V A;  2EF7 A;  5K24 C;  3FNA A;  4GQW A;  2YVX A;  3FV6 A;  4FXS A;  4P1G A;  2UV5 A;  4P1O A;  2OUX A;  3TDH C;  3TE5 C;  2QR1 E;  3ORG A;  3L31 A;  5IIP A;  2QRD E;  1XKF A;  3FHM A;  5LXQ A;  3DDJ A;  5MMZ A;  2PFI A;  2RIF A;  2UV6 A;  3FWR A;  4GQV A;  3OI8 A;  3GBY A;  2D4Z A;  2UV4 A;  4L27 A;  3HF7 A;  2YVY A;  4ESY B;  2NYE A;  3KPD A;  2RIH A;  4IY4 A;  3I8N A;  3PC3 A;  2YVZ A;  2QLV C;  3LV9 A;  2YZI A;  3T4N C;  4FRY A;  1PBJ A;  3KPC A;  4UUU A;  4DQW A;  4IY3 A;  4IYS A;  3KH5 A;  5K22 B;  3K2V A;  4L28 A;  4IY2 A;  4IY0 A;  1YAV A;  4ESY A;  4HG0 A;  5K23 C; 
#chains in the Genus database with same CATH topology
 1O50 A;  4O9K A;  3OCM A;  1PVM A;  3OCO A;  3KXR A;  2NYC A;  4NOC A;  2UV7 A;  3PC4 A;  2O16 A;  3L2B A;  2QRE E;  2OOY E;  1Y5H A;  3PC2 A;  4COO A;  2ZY9 A;  4GQY A;  2P9M A;  3LFZ A;  5KS7 A;  2OOX E;  4PCU A;  2YZQ A;  3SL7 A;  3FWS A;  2RC3 A;  3K6E A;  4L0D A;  5K25 C;  2EMQ A;  2QRC E;  3KPB A;  3LHH A;  3LQN A;  2QH1 A;  2JA3 A;  4L3V A;  2EF7 A;  5K24 C;  3FNA A;  4GQW A;  2YVX A;  3FV6 A;  4FXS A;  4P1G A;  2UV5 A;  4P1O A;  2OUX A;  3TDH C;  3TE5 C;  2QR1 E;  3ORG A;  3L31 A;  5IIP A;  2QRD E;  1XKF A;  3FHM A;  5LXQ A;  3DDJ A;  5MMZ A;  2PFI A;  2RIF A;  2UV6 A;  3FWR A;  4GQV A;  3OI8 A;  3GBY A;  2D4Z A;  2UV4 A;  4L27 A;  3HF7 A;  2YVY A;  4ESY B;  2NYE A;  3KPD A;  2RIH A;  4IY4 A;  3I8N A;  3PC3 A;  2YVZ A;  2QLV C;  3LV9 A;  2YZI A;  3T4N C;  4FRY A;  1PBJ A;  3KPC A;  4UUU A;  4DQW A;  4IY3 A;  4IYS A;  3KH5 A;  5K22 B;  3K2V A;  4L28 A;  4IY2 A;  4IY0 A;  1YAV A;  2J9L A;  4ESY A;  4HG0 A;  5K23 C; 
#chains in the Genus database with same CATH homology
 1O50 A;  4O9K A;  3OCM A;  1PVM A;  3OCO A;  3KXR A;  2NYC A;  4NOC A;  2UV7 A;  3PC4 A;  2O16 A;  3L2B A;  2QRE E;  2OOY E;  1Y5H A;  3PC2 A;  4COO A;  2ZY9 A;  4GQY A;  2P9M A;  3LFZ A;  5KS7 A;  2OOX E;  4PCU A;  2YZQ A;  3SL7 A;  3FWS A;  2RC3 A;  3K6E A;  4L0D A;  5K25 C;  2EMQ A;  2QRC E;  3KPB A;  3LHH A;  3LQN A;  2QH1 A;  2JA3 A;  4L3V A;  2EF7 A;  5K24 C;  3FNA A;  4GQW A;  2YVX A;  3FV6 A;  4FXS A;  4P1G A;  2UV5 A;  4P1O A;  2OUX A;  3TDH C;  3TE5 C;  2QR1 E;  3ORG A;  3L31 A;  5IIP A;  2QRD E;  1XKF A;  3FHM A;  5LXQ A;  3DDJ A;  5MMZ A;  2PFI A;  2RIF A;  2UV6 A;  3FWR A;  4GQV A;  3OI8 A;  3GBY A;  2D4Z A;  2UV4 A;  4L27 A;  3HF7 A;  2YVY A;  4ESY B;  2NYE A;  3KPD A;  2RIH A;  4IY4 A;  3I8N A;  3PC3 A;  2YVZ A;  2QLV C;  3LV9 A;  2YZI A;  3T4N C;  4FRY A;  1PBJ A;  3KPC A;  4UUU A;  4DQW A;  4IY3 A;  4IYS A;  3KH5 A;  5K22 B;  3K2V A;  4L28 A;  4IY2 A;  4IY0 A;  1YAV A;  2J9L A;  4ESY A;  4HG0 A;  5K23 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...