2NYJA

Crystal structure of the ankyrin repeat domain of trpv1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
250
structure length
244
Chain Sequence
RLYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTKFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ankyrin Repeats of TRPV1 Bind Multiple Ligands and Modulate Channel Sensitivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords Transient receptor potential cation channel subfamily V memb
total genus 58
structure length 244
sequence length 250
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2nyjA00
4BERA 1S70B 1BI8B 2DZNA 1A5EA 4DRXE 4K5BA 5AQ9A 1WG0A 4U8VD 2JABA 1NFIE 5D66A 3HRAA 3UTMA 1IKND 4BSZB 4U8YD 4HRNA 3V2XA 3J5PA 4CYMD 1BU9A 2PNNA 5CEAA 2XZTG 4RLYA 4DUIA 2KXPC 5ENQD 2Y0BG 4HI8A 3NOCD 1MX4A 4O1OA 2MYOA 5HS0A 5CECB 3Q9UC 5BXOA 2AJAA 4F1PA 1AWCB 2F8YA 4DX6D 5CBOA 3TWWA 4O60A 3V30A 2DZOA 1DC2A 1BD8A 5AARA 2KBXA 5AAOA 4HRLA 1SVXA 1OY3D 3AAAC 3HG0D 4BETA 4U96D 4DX7D 1IHBA 1N0RA 1QYMA 3F6QA 1K1BA 1BLXB 5HRYA 2ZGDA 3LJNA 3TWQA 4TUMA 3T9KA 3T8KA 3W9FA 5EIBE 3JUEA 4LNUD 5EYPF 5JA4D 4JB8P 4N5QA 4BEPA 3D9HA 4ZHBA 5AQAA 3NBNB 3ZUVB 3ZNGA 5EIDA 3TWTA 4ZFHA 3EU9A 3ZU7B 5ENTD 4G8LA 3IXEA 4LSZE 5KNGA 3W9GA 3JXIA 1MYOA 3J5QB 5ITZF 4OAVB 2RFAA 1MX6A 1WDYA 4HQDA 4HB5A 2F8XK 4BESA 4QQIA 1K1AA 2Y1LE 4K5AB 2V4HC 5EN5D 4HRMB 3TWRA 5BXUA 3Q9NC 4HNAD 1MJ0A 2V5QC 1D9SA 2ETAA 4J7WA 4UUCA 2VGEA 4HLLA 1AP7A 2ETCA 4DX2A 2ZGGA 2FO1E 2A5EA 4U95D 1YYHA 4YDWA 5FINA 3V2OA 2P2CP 2RFMA 5ENOD 5ENRD 2F37A 4NIKA 5FIOA 1YCSB 2XZDG 4CZ2D 5AN8A 4DX1A 3DEPA 3JXJA 4G8KA 2BKKB 1IXVA 1YMPA 4ATZD 3B7BA 4Z68A 1OT8A 1G3NB 3ZKJA 4DX5D 5AQBA 4K5CA 4A63B 1N0QA 5JMND 2QC9A 3TWUA 4F6RD 1MX2A 2HE0A 4HI9A 4LG6A 5KWDA 3EHQA 1TR4A 2XEHA 2DWZA 3V31A 2XENA 3KEAA 3B95A 5ENSD 3EHRA 3TWSA 4O1PA 1BI7B 2XEEA 3NOGD 4QFVA 5EYLA 3UI2A 1UOHA 5CERB 3TWVA 4YDYA 3UXGA 2L6BA 4J8YA 1DCQA 2J8SD 3AJIA 5KBAA 4GPMA 3V79K 2QYJA 5HKPA 1K3ZD 2BKGA 2B0OE 2NYJA 5AQ7A 5KNHD 1N11A 2DVWA 4HBDA 4GMRA 5ENPD 3SO8A 4B93B 4C48B 1SW6A 2ETBA 3DEOA 3C5RA 5EILA 5CEDB 4OAUC 5CBNA 3TWXA
chains in the Genus database with same CATH superfamily
4WNGA 3L6AA 5FZSA 4G26A 3SNXA 2HR2A 3NOCD 2BF0X 4XI9A 2AXUA 3FHEA 3UIPC 3CVNA 2J4BA 2Y4UA 3R9MA 4GZ3A 3G2TA 3EIJA 3RIBA 3LVQE 3O48A 2IQCA 2XCBA 4XE0A 5FQ4A 3D9HA 3B7SA 3FTYA 3Q78A 2VGXB 2KCKA 1N4SA 4HB5A 1LF8A 1HS6A 3PEVB 4F1SA 1WM5A 3AS4A 4RG9A 3LKUA 2GRMA 2P9NG 2UY1B 2WPVA 1XGWA 4G8KA 2B6CA 1JPLA 4JEHA 4KZCA 4B8CB 3TG4A 3AU5A 2LXMA 2X6FA 2QC9A 4FLBA 4D10C 3KEAA 3FP3A 3EUVA 5CERB 1X81A 5EYLA 4KZ0A 3UXGA 3MV2B 2L6BA 4J8YA 3LXUX 2HYZA 5A23A 2A4ZA 3IKOB 1SW6A 3CGHA 2AWIA 4EZLA 2WXOA 5BV0A 1ELRA 1ELWA 5G04C 4LNBA 5ENQD 3AG1E 4F3VA 3OTNA 3S7JA 5HS0A 2CFUA 2P9PG 2DYRE 3LY7A 4YVQC 3D9OA 1INZA 1HE8A 4O60A 2BUGA 5ARGA 1RZ4A 4ANXA 1HO8A 1WY6A 3PS6A 3CHOA 2XPIA 3CK7A 1DVPA 3ZVVA 5FWQA 4E85A 4ZHBA 4NQ0A 3FU0A 2IONA 4I43A 4ZFHA 5ENNA 1OWOA 4UQXA 4K5AB 4I9CA 2WXKA 3HXCA 3O4ZA 2OCCE 3ONLA 3AG2E 5D0OD 4B8AA 3ZXSA 5B1AE 4ILGA 3CVYA 2YHCA 5CCLA 1EDUA 2XS1A 1HXIA 3DEPA 2GRNB 5FJYA 3L82A 3SD5A 4DK5A 3VLEA 2IO3C 3FUFA 4DLQA 3FTXA 2DWZA 1FVHA 4I1AA 4DI4A 4XIFA 4JL0A 3ASNE 3CVXA 4GMJA 3U9WA 1DCQA 3AJIA 1BPOA 5D0QD 4GZCA 2B0OE 2VQ2A 3PH0C 2MRIA 3LDZA 5CEDB 2CHWA 2A5UA 2ETBA 3C5RA 3OXLA 3VTYA 4N3AA 4YDOA 5H7PA 3Q79A 4DRXE 3ENEA 1IYGA 2JLBA 4U8VD 4UI9J 3FH8A 3L08A 4APFA 4KXKB 1E90A 3I3NA 1K8KG 3VTXA 5CMWA 4OVVA 4PS3A 4BETA 5ANLA 4DX7D 1N0RA 3G2WA 3CHPA 4KMOA 1A17A 4GA0A 3SQVA 3MV3B 2VYIA 4LNUD 3KSQA 3CSTA 1Z3YA 4N5CA 5C1DA 5G05J 4GU5A 3ZNGA 3RO3A 4TRQA 4IRUA 3CVWA 5EKQD 4EECA 1DNPA 3PRZA 4FLHA 4JEUA 3GZ2A 4ABNA 2GRLA 3FY4A 4WNDA 3V2OA 4B0ZA 4EQFA 1TJCA 3SGHA 3KEZA 2I6HA 4N2SA 3T8MA 4LRZA 1OCCE 1N0QA 4L9PA 5CRVA 4HI9A 4FULA 5KWDA 3HHMA 3TWSA 1SZ9A 4H7YA 4GZDA 2DBAA 4J8DA 4G1TA 5ARFA 1S0PA 3IHVA 1IQUA 2YQ8A 4R7LA 3RKVA 4WUYA 3IEGA 3L16A 3FULA 5G55A 1E8XA 2WMNA 5D66A 2GGFA 4U8YD 2XZTG 2KXPC 3MCXA 3DXKG 5BUZA 4G2VA 3FDHA 5CECB 4C9BB 3FTSA 3IBEA 5HQ8A 3D9KA 4CT0A 3JUIA 3CEQA 1BD8A 2WXHA 1U2VG 4I6EA 2AW6A 4FHKA 2R5SA 3W9FA 2AVPA 5JA4D 4AY5A 2YNQA 4AV7A 3U3WA 4LERA 4C0MA 3ZU7B 3Q4AB 2OOEA 2X6KA 4OAVB 2BEDA 3CHQA 1SA4A 4U63A 1UJKA 2DIWA 3QAQA 3C3OA 1KZPA 4OVUA 3UIOC 3PREA 1TNYA 2VGEA 3E4BA 2VJ8A 5FIOA 2X6IA 4Z68A 3PUKA 5FZQA 2EQXA 4DX5D 4K5CA 3GYZA 2EILE 3AS5A 3APFA 3FUDA 1BI7B 2XEEA 5EIBE 4FJZA 3MGBA 2XPZA 5KBAA 1E8WA 4PS8A 4EPZA 1KLXA 5KNHD 1E8ZA 4NRHB 4A1SA 3UTMA 2LSVA 4FP7A 2PNNA 3QARA 1UW4B 2XRYA 2C2LA 2RD0A 4I6GA 3DSUA 1JCQA 1JCRA 2PL2A 3Q9UC 4F1PA 3LCAA 4GZ6A 3PZDA 1N94A 2X6JA 1ZBPA 1IHBA 1LD8A 1UN8A 3UM3A 4CDMA 4APOA 4KT6B 2DYSE 3QC1A 2VSNA 3E34A 4LSZE 5FQ8A 3E32A 3DPDA 1Z6TA 3TWRA 3BUAA 4JHJA 1E7UA 4H7XA 2P9IG 2EIME 4O6FA 1EPUA 1U3CA 4J0UA 4DX1A 3IV0A 4Q96A 1YMPA 1TN6A 5JMND 2Y4TA 1L5JA 4TUUA 2XENA 1Q2ZA 3CK9A 4I9EA 4LNGA 4QFVA 3SZ7A 4G23A 1UOHA 4HOQA 4ACKA 4NACA 4L23A 3CR3A 5B3SE 5HKPA 3E30A 3PNLB 2NYJA 3T5VA 2WXGA 4XX5A 5AQ7A 4DJAA 3X2QE 2ZIRA 5CBNA 3ONKA 3DEOA 5EILA 4HS2A 1O5MA 4GA1A 4M3OA 4K5BA 4L7TA 3AG3E 3HRAA 2VTBA 1QBQA 2GW1A 2GRRB 5FQ7A 1PAQA 3ML8A 2MHKA 5LCWJ 3JQ1A 4ACLA 5T3RA 1SQMA 2DCPA 2ONDA 4WNEA 3HXDA 5CBOA 3NAWA 3Q75A 1EF1C 3HVEA 3ABLE 2V5FA 3LEWA 1TEZA 3I5PA 4KVOA 3UX4A 3OXGA 5EYPF 3BQOA 4JB8P 3ZW3A 1H6OA 4GPKA 3RAUA 2C0LA 1VDYA 4HXIA 3DPYA 1QNFA 2R02A 4HNAD 2XHEA 3ZYQA 1AP7A 4JA7A 1N52A 5BT1A 4NURA 2ZXWE 3Q15A 4JHRA 5FINA 3ISMC 4CGWA 4PDXA 3FUIA 3TXMA 3EHNA 4A63B 1D8EA 4V3IA 4GTTA 3LS8A 2XEHA 4GCOA 5ENSD 1H19A 2OEWA 3SI5A 4A3VA 3FEXA 2I9CA 1HG5A 3VLDA 4FU3A 2PQNA 1ZU2A 5G2NA 2YINA 2L0TB 1O1SA 4I6JA 3D9JA 4GYWA 3C3QA 5FZRA 3UKUG 2KM4A 2NC9A 3QK0A 2XEVA 3FH5A 3FUHA 2WXJA 3TWWA 4ANVA 4UWFA 4TXQA 2KATA 4FC8A 3JCKC 1SA5A 1H6KA 3RK6A 2WVIA 2R17C 3PNTB 4CDRA 4K03A 1DCEA 1HG2A 1MYOA 1OXJA 1FT1A 2V4LA 3ASFA 4XZ4A 3FTUA 2NSZA 3NF1A 2IO2C 2X6HA 1Z3XA 2P58C 1TJFA 4CRWA 3ESKA 1IQRA 5LCWC 3MKRA 2BKKB 3MA5A 3TGOA 3SFZA 1EYHA 1MX2A 4I17A 4LG6A 3Q73A 1TR4A 1W3BA 4UQZA 4FADA 2ZISA 2J8SD 2E2EA 4FA6A 2LSUA 2FI7A 5AJDA 2WXRA 4WNFA 4JW1A 3DWLG 2KZTA 3HXBA 5AQ9A 5G05C 1IKND 3ZHEA 3DSVA 4EHMA 3FH7A 3PE3A 2F0YA 5BXOA 2IF4A 3QOUA 2F8YA 3CVLA 3RJVA 2P9KG 2R59A 3S2AA 3ESLA 4GZ5A 4U07A 1QYMA 3RRMB 3CHRA 4AY6A 1RW2A 2C0MA 3S7FA 3T8KA 5EDSA 1FCHA 4A3TA 3I4GA 2XQ0A 4GTRA 1NI1A 4J8FA 1KT1A 2AXZA 3I4RB 3WXXA 4A1GA 3QWPA 2V4HC 5CMYA 2UY1A 2ETAA 1O1TA 4PH4B 4U95D 3CVUA 2XRZA 1E7VA 2X3MA 1YCSB 2QFCA 4GB9A 1H6PA 5B1BE 2WM9A 2WQHA 4XI0A 4Y6CA 3NOGD 3QKYA 1IHGA 2QY7A 1LTXA 5AENA 3LPZA 3UINC 2WXLA 5ENPD 4OAUC 2EINE 5DBKA 1WG0A 4ILHB 1OCZE 2IY0C 3NQPA 5FQ6A 4MBGA 4XEIG 2LO6A 5EX3A 5ANRA 2ILRA 2MYOA 1MHQA 3SY2A 3CLJA 1QQEA 4RQIA 3TG5A 4BT9A 4BWRA 2P9LG 5LOZA 3FU5A 1KT0A 2OVBA 4AXHA 5AYWD 3WG7E 2HM8A 3UM2A 3F6QA 2ZGDA 3DXMG 3S7BA 5LFAA 3G2VA 4BSXA 4ATGA 4WWOA 3Q5MA 3HVEB 1WDYA 2V0PA 5CHEE 2F8XK 4GTSA 2I1JA 4RVBA 4EBAA 1N4RA 4Y6WA 5EN5D 4L2LA 3DSTA 3QJZA 4LCTA 3ABME 2FO1E 4DLOA 3NZSA 1JCSA 2P2CP 5CRUA 3TL5A 2XPYA 4BX9A 5KJLA 3B7BA 2XCCA 4N3BA 1OWLA 4G11A 2CG2A 4I1OB 5KJKA 4HLEA 3C98A 2QYJA 3ABKE 2JEKA 3LY9A 4GTOA 4EZKA 4B93B 4AJWA 1UG3A 4CEMA 1SZAA 1BI8B 2WXQA 1HX8A 4HRNA 2R2LA 4U0SA 2GRPB 2PM7A 3UM0A 3QB2A 3NZUA 2ZU6B 1OWNA 1E96B 1TNBA 2E0IA 4TXRA 2M63A 1YA0A 3D9IA 3HG0D 2MOWA 3LVRE 2WXPA 3U64A 3PZ2A 3LJNA 3T9KA 1O1RA 3D9MA 3ULQA 3Q47B 3MYVA 2QYUA 2L6JA 4A55A 3EU9A 3IXEA 3TXNA 1N9AA 3J5QB 2FBNA 5JHAA 4FJYA 1K1AA 2CHXA 2IEJA 3TAXA 4DX2A 4J6IA 4J8SA 5AIJA 3RRNB 3RSEG 3BU8A 4MKTA 2XS8A 4F6RD 2J07A 3KS2A 4G24A 2WQ7A 2VSXE 3AU4A 4JPSA 1V54E 4E6HA 3ASGA 1K3ZD 5G04J 4AIFA 2R05A 4JA9A 5KJMA 3FFLA 4Q69A 4U04A 1A5EA 2QZAA 1HZ4A 2JABA 5A7DB 3SFXA 1BU9A 4DPRA 1OUVA 3FTVA 2R03A 3SF4A 2Y0BG 1NP7A 1JWGA 4UQYA 4MLPA 1N95A 4HVBA 1E8YA 4XKBA 2YHEA 1WAO1 3PDNA 1LD7A 4MS6A 1BLXB 1PC2A 4TUMA 3FWVA 1S63A 2Y3AA 3UT4A 5T8IA 4N5QA 3ZUVB 4IULA 4JZYA 2VSYA 3BEEA 3W9GA 3CVVA 1ZB1A 4ANWA 3QWVA 5ITZF 3ZYMA 2KZTB 2Q7FA 5EX0A 4QQIA 5BNWA 2WXIA 1PY1A 3APCA 4ME2A 3UPVA 2A5EA 4AP2A 5JHBA 4JXTA 1OCOE 5AN8A 3DSXA 4RG6A 2WXFA 3Q49B 1OT8A 3HXEA 3LJ3A 2FO7A 1MZCA 5BW8C 4BFRA 4WWPA 3GZSA 1UJJA 3B95A 3ASOE 3TWVA 1X5BA 3DSWA 5KJNA 4CT4A 4C48B 3QNKA 2Y69E 3D9NA 3EU5A 4YDEA 5M72A 1HU3A 4L2YA 2X38A 4BSZB 1TNZA 3R7QA 3V2XA 3FTWA 5FT9A 3BG0B 5E76A 3RU0A 3CVPA 4J8EA 2UWJG 4XKCA 3K9IA 3CK8A 1GW6A 3C3RA 2P9UG 2J9QA 4BTBA 5AARA 4UWKA 5CCMA 1OWPA 5HRYA 3LY8A 3DRAA 5AQAA 3ZFWA 2LUHA 3E33A 4WAFA 3ZPJA 1TN8A 4N39A 4AM9A 3RO2A 3FU3A 1Y8MA 2RFAA 4ILIA 4HQDA 3ASDA 3FU6A 3ZHEB 2L0IA 2V5QC 3MJWA 1XNFA 4UUCA 1YYHA 1P5QA 2RFMA 4TV3A 3UT7A 4N3CA 5AJLA 2XZDG 3HXFA 4CZ2D 4UWLA 3RRUA 5AQBA 4W9RA 3CVQA 3T5XA 2OEVA 1TNUA 5JJTA 3MKQA 2BKGA 5A6CA 2CHZA 4HBDA 3PE4A 1NA0A 2KCVA 3ZN3A 1N4PA 3JYSA 4BT8A 5BPPA 1S64A 4CYMD 3E37A 2CG3A 4C0EA 4I2WA 2PQRA 3ZEFA 1TN7A 3MEKA 3U66A 4YNDA 2DZOA 4PS7A 5BV1A 3UMVA 1K1BA 3L22A 3KD7A 3CSFA 3HYMB 3UM1A 3HDXA 3S7DA 3VLFA 4G8LA 1N4QA 3JXIA 3FUNA 3FUMA 1MX6A 4GA2A 4EZJA 2Y1LE 2WXNA 4N2QA 1MJ0A 1TNOA 2GRQB 2EIKE 1B89A 4GTPA 2XGSA 4UI9C 5ENOD 4NIKA 2VTBB 4AEZC 1NL4A 3CV0A 3ML9A 3PZ1A 3TJPA 1D8DA 4IN3B 4YDYA 4YVOA 2P9SG 2L9BA 4P29A 2J4DA 3U4TA 2DVWA 4GMRA 3SO8A 2I2OA 4B94A 1HH8A 3BG1B 3JQ0A 4BTAA 2WMOA 3MX3A 4CDNA 2KC7A 4PUCA 4RLYA 2RG8A 3UKRG 3C72A 4HI8A 3QDNA 2NXPA 2FULA 4GYYA 4UWGA 1DC2A 2J08A 4HRLA 3D9PA 4GCNA 1H2UA 2PM6A 3L17A 1OCRE 3CHSA 3URZA 4AOFA 2J09A 3CIAA 3AG4E 3NBNB 5T4YA 4F7AA 3TWTA 2FF4A 3KSLA 4UI9K 3N71A 5E75A 3MZLB 3PUJA 4BX8A 3EHMA 4L1BA 4CCAA 3B7RL 3Q9NC 1D9SA 4JHKA 2H6FA 3PVLA 2ETCA 4HOUA 2HO1A 4F53A 5ENRD 4Q94A 2IOLA 5KCMA 3B7UX 1NA3A 1G3NB 5C2YA 2CFZA 4ANUA 2VSOE 4JD2G 3R7RA 3TWUA 3PZ4A 2KCLA 4GTVA 4U7EB 4KVMA 3EHRA 4O1PA 4GTQA 3R9AB 4GPMA 3CQGB 2IFUA 3SHFA 2I1KA 4JVSA 1N11A 1OWMA 4BY6A 2LNIA 4GTMA 3TWXA 2VGXA 4BERA 3UQ3A 1S70B 2DZNA 3LYAA 1HF8A 1NFIE 3G2SA 5J90A 3FUKA 5CEAA 3ZIMA 4I1MA 4HOSA 2WB2A 4B89A 2WXMA 3B13A 1MX4A 5D2MC 2AJAA 2H6IA 4KBQA 4EBAG 3OAWA 1AWCB 1H2VC 2H6GA 4U0ZA 3APDA 2J49A 3V30A 3DSSA 4LEUA 2KBXA 3IHYA 5J08A 2V8SE 5AAOA 1SVXA 1OY3D 3AAAC 5LX8A 4U96D 1QZ2A 2FEZA 3ZXPA 3P1UA 4U0UA 3TWQA 1ELKA 1H0AA 1Y6IA 2GROB 3Q7AA 1V55E 1MQSA 5DIZA 4CGVA 4M7CA 4FHJA 3ZGQA 2WQ6A 2IU1A 2LAHA 5KNGA 1HFAA 1UN9A 3UUXA 3FUEA 3CKBA 4G25A 3ZYLA 4URKA 4J7WA 4HLLA 3OXFA 3NB2A 4HOTA 1FPPA 4YDWA 1U3DA 2H6HA 5JJ7A 2F37A 1JUQA 4AVXA 4GMLA 1IXVA 5HI7A 1N54A 4GAAA 3CHMA 1FVFA 2HE0A 3V31A 3L9TA 2RKKA 3SFYA 4UWHA 4HORA 1H2TC 4LUNU 3CQCB 1FT2A 3D9LA 2LAIA 3UT8A 3ZRHA 3QWWA 3ZYKA 3CKCA 3J5PA 3EDTB 1TYQG 3PEUB 2LXLA 4DUIA 1Z5SC 4HFGA 4O1OA 2AXVA 4TXPA 3Q7FA 2VGYA 3AS8A 1NZNA 4DX6D 3GW4A 2OVFA 3DBSA 2PZIA 5LP0A 3PZ3A 3P2BA 3GZ1A 3EJNA 2EIJE 3JUEA 3MKQB 3ULEG 2IOSA 4BEPA 4IYPA 2XGOA 3L54A 4WWNA 5EIDA 5ENTD 3HIZA 1JWFA 4I2ZA 3SBSA 2XGMA 4BESA 5BXUA 4HRMB 2OV8A 3FTZA 3G2UA 3FEYA 3KAEA 4JC8A 2ZGGA 2IJGX 3ASHA 5IY5E 4DI3A 3JXJA 5FTPA 3SBTB 4GYOA 4MRUA 4ATZD 5JJ6A 4RSYA 3ZKJA 4X8QA 3FUJA 3EHQA 3B7TA 3D3MA 3UI2A 1KPSB 4K0RA 3L13A 3V79K 4KYOB 1KZOA 3ULYA 3EIQC 4OYSA 4U8HA 2BTDA
chains in the Genus database with same CATH topology
4BERA 1S70B 1BI8B 2DZNA 1A5EA 4DRXE 4K5BA 5AQ9A 1WG0A 4U8VD 2JABA 1NFIE 5D66A 3HRAA 3UTMA 1IKND 4BSZB 4U8YD 4HRNA 3V2XA 3J5PA 4CYMD 1BU9A 2PNNA 5CEAA 2XZTG 4RLYA 4DUIA 2KXPC 5ENQD 2Y0BG 4HI8A 3NOCD 1MX4A 4O1OA 2MYOA 5HS0A 5CECB 3Q9UC 5BXOA 2AJAA 4F1PA 1AWCB 2F8YA 4DX6D 5CBOA 3TWWA 4O60A 3V30A 2DZOA 1DC2A 1BD8A 5AARA 2KBXA 5AAOA 4HRLA 1SVXA 1OY3D 3AAAC 3HG0D 4BETA 4U96D 4DX7D 1IHBA 1N0RA 1QYMA 3F6QA 1K1BA 1BLXB 5HRYA 2ZGDA 3LJNA 3TWQA 4TUMA 3T9KA 3T8KA 3W9FA 5EIBE 3JUEA 4LNUD 5EYPF 5JA4D 4JB8P 4N5QA 4BEPA 3D9HA 4ZHBA 5AQAA 3NBNB 3ZUVB 3ZNGA 5EIDA 3TWTA 4ZFHA 3EU9A 3ZU7B 5ENTD 4G8LA 3IXEA 4LSZE 5KNGA 3W9GA 3JXIA 1MYOA 3J5QB 5ITZF 4OAVB 2RFAA 1MX6A 1WDYA 4HQDA 4HB5A 2F8XK 4BESA 4QQIA 1K1AA 2Y1LE 4K5AB 2V4HC 5EN5D 4HRMB 3TWRA 5BXUA 3Q9NC 4HNAD 1MJ0A 2V5QC 1D9SA 2ETAA 4J7WA 4UUCA 2VGEA 4HLLA 1AP7A 2ETCA 4DX2A 2ZGGA 2FO1E 2A5EA 4U95D 1YYHA 4YDWA 5FINA 3V2OA 2P2CP 2RFMA 5ENOD 5ENRD 2F37A 4NIKA 5FIOA 1YCSB 2XZDG 4CZ2D 5AN8A 4DX1A 3DEPA 3JXJA 4G8KA 2BKKB 1IXVA 1YMPA 4ATZD 3B7BA 4Z68A 1OT8A 1G3NB 3ZKJA 4DX5D 5AQBA 4K5CA 4A63B 1N0QA 5JMND 2QC9A 3TWUA 4F6RD 1MX2A 2HE0A 4HI9A 4LG6A 5KWDA 3EHQA 1TR4A 2XEHA 2DWZA 3V31A 2XENA 3KEAA 3B95A 5ENSD 3EHRA 3TWSA 4O1PA 1BI7B 2XEEA 3NOGD 4QFVA 5EYLA 3UI2A 1UOHA 5CERB 3TWVA 4YDYA 3UXGA 2L6BA 4J8YA 1DCQA 2J8SD 3AJIA 5KBAA 4GPMA 3V79K 2QYJA 5HKPA 1K3ZD 2BKGA 2B0OE 2NYJA 5AQ7A 5KNHD 1N11A 2DVWA 4HBDA 4GMRA 5ENPD 3SO8A 4B93B 4C48B 1SW6A 2ETBA 3DEOA 3C5RA 5EILA 5CEDB 4OAUC 5CBNA 3TWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BER A;  1S70 B;  1BI8 B;  2DZN A;  1A5E A;  4DRX E;  4K5B A;  5AQ9 A;  1WG0 A;  4U8V D;  2JAB A;  1NFI E;  5D66 A;  3HRA A;  3UTM A;  1IKN D;  4BSZ B;  4U8Y D;  4HRN A;  3V2X A;  3J5P A;  4CYM D;  1BU9 A;  2PNN A;  5CEA A;  2XZT G;  4RLY A;  4DUI A;  2KXP C;  5ENQ D;  2Y0B G;  4HI8 A;  3NOC D;  1MX4 A;  4O1O A;  2MYO A;  5HS0 A;  5CEC B;  3Q9U C;  5BXO A;  2AJA A;  4F1P A;  1AWC B;  2F8Y A;  4DX6 D;  5CBO A;  3TWW A;  4O60 A;  3V30 A;  2DZO A;  1DC2 A;  1BD8 A;  5AAR A;  2KBX A;  5AAO A;  4HRL A;  1SVX A;  1OY3 D;  3AAA C;  3HG0 D;  4BET A;  4U96 D;  4DX7 D;  1IHB A;  1N0R A;  1QYM A;  3F6Q A;  1K1B A;  1BLX B;  5HRY A;  2ZGD A;  3LJN A;  3TWQ A;  4TUM A;  3T9K A;  3T8K A;  3W9F A;  5EIB E;  3JUE A;  4LNU D;  5EYP F;  5JA4 D;  4JB8 P;  4N5Q A;  4BEP A;  3D9H A;  4ZHB A;  5AQA A;  3NBN B;  3ZUV B;  3ZNG A;  5EID A;  3TWT A;  4ZFH A;  3EU9 A;  3ZU7 B;  5ENT D;  4G8L A;  3IXE A;  4LSZ E;  5KNG A;  3W9G A;  3JXI A;  1MYO A;  3J5Q B;  5ITZ F;  4OAV B;  2RFA A;  1MX6 A;  1WDY A;  4HQD A;  4HB5 A;  2F8X K;  4BES A;  4QQI A;  1K1A A;  2Y1L E;  4K5A B;  2V4H C;  5EN5 D;  4HRM B;  3TWR A;  5BXU A;  3Q9N C;  4HNA D;  1MJ0 A;  2V5Q C;  1D9S A;  2ETA A;  4J7W A;  4UUC A;  2VGE A;  4HLL A;  1AP7 A;  2ETC A;  4DX2 A;  2ZGG A;  2FO1 E;  2A5E A;  4U95 D;  1YYH A;  4YDW A;  5FIN A;  3V2O A;  2P2C P;  2RFM A;  5ENO D;  5ENR D;  2F37 A;  4NIK A;  5FIO A;  1YCS B;  2XZD G;  4CZ2 D;  5AN8 A;  4DX1 A;  3DEP A;  3JXJ A;  4G8K A;  2BKK B;  1IXV A;  1YMP A;  4ATZ D;  3B7B A;  4Z68 A;  1OT8 A;  1G3N B;  3ZKJ A;  4DX5 D;  5AQB A;  4K5C A;  4A63 B;  1N0Q A;  5JMN D;  2QC9 A;  3TWU A;  4F6R D;  1MX2 A;  2HE0 A;  4HI9 A;  4LG6 A;  5KWD A;  3EHQ A;  1TR4 A;  2XEH A;  2DWZ A;  3V31 A;  2XEN A;  3KEA A;  3B95 A;  5ENS D;  3EHR A;  3TWS A;  4O1P A;  1BI7 B;  2XEE A;  3NOG D;  4QFV A;  5EYL A;  3UI2 A;  1UOH A;  5CER B;  3TWV A;  4YDY A;  3UXG A;  2L6B A;  4J8Y A;  1DCQ A;  2J8S D;  3AJI A;  5KBA A;  4GPM A;  3V79 K;  2QYJ A;  5HKP A;  1K3Z D;  2BKG A;  2B0O E;  2NYJ A;  5AQ7 A;  5KNH D;  1N11 A;  2DVW A;  4HBD A;  4GMR A;  5ENP D;  3SO8 A;  4B93 B;  4C48 B;  1SW6 A;  2ETB A;  3DEO A;  3C5R A;  5EIL A;  5CED B;  4OAU C;  5CBN A;  3TWX A; 
#chains in the Genus database with same CATH topology
 4WNG A;  3L6A A;  5FZS A;  4G26 A;  3SNX A;  2HR2 A;  3NOC D;  2BF0 X;  4XI9 A;  2AXU A;  3FHE A;  3UIP C;  3CVN A;  2J4B A;  2Y4U A;  3R9M A;  4GZ3 A;  3G2T A;  3EIJ A;  3RIB A;  3LVQ E;  3O48 A;  2IQC A;  2XCB A;  4XE0 A;  5FQ4 A;  3D9H A;  3B7S A;  3FTY A;  3Q78 A;  2VGX B;  2KCK A;  1N4S A;  4HB5 A;  1LF8 A;  1HS6 A;  3PEV B;  4F1S A;  1WM5 A;  3AS4 A;  4RG9 A;  3LKU A;  2GRM A;  2P9N G;  2UY1 B;  2WPV A;  1XGW A;  4G8K A;  2B6C A;  1JPL A;  4JEH A;  4KZC A;  4B8C B;  3TG4 A;  3AU5 A;  2LXM A;  2X6F A;  2QC9 A;  4FLB A;  4D10 C;  3KEA A;  3FP3 A;  3EUV A;  5CER B;  1X81 A;  5EYL A;  4KZ0 A;  3UXG A;  3MV2 B;  2L6B A;  4J8Y A;  3LXU X;  2HYZ A;  5A23 A;  2A4Z A;  3IKO B;  1SW6 A;  3CGH A;  2AWI A;  4EZL A;  2WXO A;  5BV0 A;  1ELR A;  1ELW A;  5G04 C;  4LNB A;  5ENQ D;  3AG1 E;  4F3V A;  3OTN A;  3S7J A;  5HS0 A;  2CFU A;  2P9P G;  2DYR E;  3LY7 A;  4YVQ C;  3D9O A;  1INZ A;  1HE8 A;  4O60 A;  2BUG A;  5ARG A;  1RZ4 A;  4ANX A;  1HO8 A;  1WY6 A;  3PS6 A;  3CHO A;  2XPI A;  3CK7 A;  1DVP A;  3ZVV A;  5FWQ A;  4E85 A;  4ZHB A;  4NQ0 A;  3FU0 A;  2ION A;  4I43 A;  4ZFH A;  5ENN A;  1OWO A;  4UQX A;  4K5A B;  4I9C A;  2WXK A;  3HXC A;  3O4Z A;  2OCC E;  3ONL A;  3AG2 E;  5D0O D;  4B8A A;  3ZXS A;  5B1A E;  4ILG A;  3CVY A;  2YHC A;  5CCL A;  1EDU A;  2XS1 A;  1HXI A;  3DEP A;  2GRN B;  5FJY A;  3L82 A;  3SD5 A;  4DK5 A;  3VLE A;  2IO3 C;  3FUF A;  4DLQ A;  3FTX A;  2DWZ A;  1FVH A;  4I1A A;  4DI4 A;  4XIF A;  4JL0 A;  3ASN E;  3CVX A;  4GMJ A;  3U9W A;  1DCQ A;  3AJI A;  1BPO A;  5D0Q D;  4GZC A;  2B0O E;  2VQ2 A;  3PH0 C;  2MRI A;  3LDZ A;  5CED B;  2CHW A;  2A5U A;  2ETB A;  3C5R A;  3OXL A;  3VTY A;  4N3A A;  4YDO A;  5H7P A;  3Q79 A;  4DRX E;  3ENE A;  1IYG A;  2JLB A;  4U8V D;  4UI9 J;  3FH8 A;  3L08 A;  4APF A;  4KXK B;  1E90 A;  3I3N A;  1K8K G;  3VTX A;  5CMW A;  4OVV A;  4PS3 A;  4BET A;  5ANL A;  4DX7 D;  1N0R A;  3G2W A;  3CHP A;  4KMO A;  1A17 A;  4GA0 A;  3SQV A;  3MV3 B;  2VYI A;  4LNU D;  3KSQ A;  3CST A;  1Z3Y A;  4N5C A;  5C1D A;  5G05 J;  4GU5 A;  3ZNG A;  3RO3 A;  4TRQ A;  4IRU A;  3CVW A;  5EKQ D;  4EEC A;  1DNP A;  3PRZ A;  4FLH A;  4JEU A;  3GZ2 A;  4ABN A;  2GRL A;  3FY4 A;  4WND A;  3V2O A;  4B0Z A;  4EQF A;  1TJC A;  3SGH A;  3KEZ A;  2I6H A;  4N2S A;  3T8M A;  4LRZ A;  1OCC E;  1N0Q A;  4L9P A;  5CRV A;  4HI9 A;  4FUL A;  5KWD A;  3HHM A;  3TWS A;  1SZ9 A;  4H7Y A;  4GZD A;  2DBA A;  4J8D A;  4G1T A;  5ARF A;  1S0P A;  3IHV A;  1IQU A;  2YQ8 A;  4R7L A;  3RKV A;  4WUY A;  3IEG A;  3L16 A;  3FUL A;  5G55 A;  1E8X A;  2WMN A;  5D66 A;  2GGF A;  4U8Y D;  2XZT G;  2KXP C;  3MCX A;  3DXK G;  5BUZ A;  4G2V A;  3FDH A;  5CEC B;  4C9B B;  3FTS A;  3IBE A;  5HQ8 A;  3D9K A;  4CT0 A;  3JUI A;  3CEQ A;  1BD8 A;  2WXH A;  1U2V G;  4I6E A;  2AW6 A;  4FHK A;  2R5S A;  3W9F A;  2AVP A;  5JA4 D;  4AY5 A;  2YNQ A;  4AV7 A;  3U3W A;  4LER A;  4C0M A;  3ZU7 B;  3Q4A B;  2OOE A;  2X6K A;  4OAV B;  2BED A;  3CHQ A;  1SA4 A;  4U63 A;  1UJK A;  2DIW A;  3QAQ A;  3C3O A;  1KZP A;  4OVU A;  3UIO C;  3PRE A;  1TNY A;  2VGE A;  3E4B A;  2VJ8 A;  5FIO A;  2X6I A;  4Z68 A;  3PUK A;  5FZQ A;  2EQX A;  4DX5 D;  4K5C A;  3GYZ A;  2EIL E;  3AS5 A;  3APF A;  3FUD A;  1BI7 B;  2XEE A;  5EIB E;  4FJZ A;  3MGB A;  2XPZ A;  5KBA A;  1E8W A;  4PS8 A;  4EPZ A;  1KLX A;  5KNH D;  1E8Z A;  4NRH B;  4A1S A;  3UTM A;  2LSV A;  4FP7 A;  2PNN A;  3QAR A;  1UW4 B;  2XRY A;  2C2L A;  2RD0 A;  4I6G A;  3DSU A;  1JCQ A;  1JCR A;  2PL2 A;  3Q9U C;  4F1P A;  3LCA A;  4GZ6 A;  3PZD A;  1N94 A;  2X6J A;  1ZBP A;  1IHB A;  1LD8 A;  1UN8 A;  3UM3 A;  4CDM A;  4APO A;  4KT6 B;  2DYS E;  3QC1 A;  2VSN A;  3E34 A;  4LSZ E;  5FQ8 A;  3E32 A;  3DPD A;  1Z6T A;  3TWR A;  3BUA A;  4JHJ A;  1E7U A;  4H7X A;  2P9I G;  2EIM E;  4O6F A;  1EPU A;  1U3C A;  4J0U A;  4DX1 A;  3IV0 A;  4Q96 A;  1YMP A;  1TN6 A;  5JMN D;  2Y4T A;  1L5J A;  4TUU A;  2XEN A;  1Q2Z A;  3CK9 A;  4I9E A;  4LNG A;  4QFV A;  3SZ7 A;  4G23 A;  1UOH A;  4HOQ A;  4ACK A;  4NAC A;  4L23 A;  3CR3 A;  5B3S E;  5HKP A;  3E30 A;  3PNL B;  2NYJ A;  3T5V A;  2WXG A;  4XX5 A;  5AQ7 A;  4DJA A;  3X2Q E;  2ZIR A;  5CBN A;  3ONK A;  3DEO A;  5EIL A;  4HS2 A;  1O5M A;  4GA1 A;  4M3O A;  4K5B A;  4L7T A;  3AG3 E;  3HRA A;  2VTB A;  1QBQ A;  2GW1 A;  2GRR B;  5FQ7 A;  1PAQ A;  3ML8 A;  2MHK A;  5LCW J;  3JQ1 A;  4ACL A;  5T3R A;  1SQM A;  2DCP A;  2OND A;  4WNE A;  3HXD A;  5CBO A;  3NAW A;  3Q75 A;  1EF1 C;  3HVE A;  3ABL E;  2V5F A;  3LEW A;  1TEZ A;  3I5P A;  4KVO A;  3UX4 A;  3OXG A;  5EYP F;  3BQO A;  4JB8 P;  3ZW3 A;  1H6O A;  4GPK A;  3RAU A;  2C0L A;  1VDY A;  4HXI A;  3DPY A;  1QNF A;  2R02 A;  4HNA D;  2XHE A;  3ZYQ A;  1AP7 A;  4JA7 A;  1N52 A;  5BT1 A;  4NUR A;  2ZXW E;  3Q15 A;  4JHR A;  5FIN A;  3ISM C;  4CGW A;  4PDX A;  3FUI A;  3TXM A;  3EHN A;  4A63 B;  1D8E A;  4V3I A;  4GTT A;  3LS8 A;  2XEH A;  4GCO A;  5ENS D;  1H19 A;  2OEW A;  3SI5 A;  4A3V A;  3FEX A;  2I9C A;  1HG5 A;  3VLD A;  4FU3 A;  2PQN A;  1ZU2 A;  5G2N A;  2YIN A;  2L0T B;  1O1S A;  4I6J A;  3D9J A;  4GYW A;  3C3Q A;  5FZR A;  3UKU G;  2KM4 A;  2NC9 A;  3QK0 A;  2XEV A;  3FH5 A;  3FUH A;  2WXJ A;  3TWW A;  4ANV A;  4UWF A;  4TXQ A;  2KAT A;  4FC8 A;  3JCK C;  1SA5 A;  1H6K A;  3RK6 A;  2WVI A;  2R17 C;  3PNT B;  4CDR A;  4K03 A;  1DCE A;  1HG2 A;  1MYO A;  1OXJ A;  1FT1 A;  2V4L A;  3ASF A;  4XZ4 A;  3FTU A;  2NSZ A;  3NF1 A;  2IO2 C;  2X6H A;  1Z3X A;  2P58 C;  1TJF A;  4CRW A;  3ESK A;  1IQR A;  5LCW C;  3MKR A;  2BKK B;  3MA5 A;  3TGO A;  3SFZ A;  1EYH A;  1MX2 A;  4I17 A;  4LG6 A;  3Q73 A;  1TR4 A;  1W3B A;  4UQZ A;  4FAD A;  2ZIS A;  2J8S D;  2E2E A;  4FA6 A;  2LSU A;  2FI7 A;  5AJD A;  2WXR A;  4WNF A;  4JW1 A;  3DWL G;  2KZT A;  3HXB A;  5AQ9 A;  5G05 C;  1IKN D;  3ZHE A;  3DSV A;  4EHM A;  3FH7 A;  3PE3 A;  2F0Y A;  5BXO A;  2IF4 A;  3QOU A;  2F8Y A;  3CVL A;  3RJV A;  2P9K G;  2R59 A;  3S2A A;  3ESL A;  4GZ5 A;  4U07 A;  1QYM A;  3RRM B;  3CHR A;  4AY6 A;  1RW2 A;  2C0M A;  3S7F A;  3T8K A;  5EDS A;  1FCH A;  4A3T A;  3I4G A;  2XQ0 A;  4GTR A;  1NI1 A;  4J8F A;  1KT1 A;  2AXZ A;  3I4R B;  3WXX A;  4A1G A;  3QWP A;  2V4H C;  5CMY A;  2UY1 A;  2ETA A;  1O1T A;  4PH4 B;  4U95 D;  3CVU A;  2XRZ A;  1E7V A;  2X3M A;  1YCS B;  2QFC A;  4GB9 A;  1H6P A;  5B1B E;  2WM9 A;  2WQH A;  4XI0 A;  4Y6C A;  3NOG D;  3QKY A;  1IHG A;  2QY7 A;  1LTX A;  5AEN A;  3LPZ A;  3UIN C;  2WXL A;  5ENP D;  4OAU C;  2EIN E;  5DBK A;  1WG0 A;  4ILH B;  1OCZ E;  2IY0 C;  3NQP A;  5FQ6 A;  4MBG A;  4XEI G;  2LO6 A;  5EX3 A;  5ANR A;  2ILR A;  2MYO A;  1MHQ A;  3SY2 A;  3CLJ A;  1QQE A;  4RQI A;  3TG5 A;  4BT9 A;  4BWR A;  2P9L G;  5LOZ A;  3FU5 A;  1KT0 A;  2OVB A;  4AXH A;  5AYW D;  3WG7 E;  2HM8 A;  3UM2 A;  3F6Q A;  2ZGD A;  3DXM G;  3S7B A;  5LFA A;  3G2V A;  4BSX A;  4ATG A;  4WWO A;  3Q5M A;  3HVE B;  1WDY A;  2V0P A;  5CHE E;  2F8X K;  4GTS A;  2I1J A;  4RVB A;  4EBA A;  1N4R A;  4Y6W A;  5EN5 D;  4L2L A;  3DST A;  3QJZ A;  4LCT A;  3ABM E;  2FO1 E;  4DLO A;  3NZS A;  1JCS A;  2P2C P;  5CRU A;  3TL5 A;  2XPY A;  4BX9 A;  5KJL A;  3B7B A;  2XCC A;  4N3B A;  1OWL A;  4G11 A;  2CG2 A;  4I1O B;  5KJK A;  4HLE A;  3C98 A;  2QYJ A;  3ABK E;  2JEK A;  3LY9 A;  4GTO A;  4EZK A;  4B93 B;  4AJW A;  1UG3 A;  4CEM A;  1SZA A;  1BI8 B;  2WXQ A;  1HX8 A;  4HRN A;  2R2L A;  4U0S A;  2GRP B;  2PM7 A;  3UM0 A;  3QB2 A;  3NZU A;  2ZU6 B;  1OWN A;  1E96 B;  1TNB A;  2E0I A;  4TXR A;  2M63 A;  1YA0 A;  3D9I A;  3HG0 D;  2MOW A;  3LVR E;  2WXP A;  3U64 A;  3PZ2 A;  3LJN A;  3T9K A;  1O1R A;  3D9M A;  3ULQ A;  3Q47 B;  3MYV A;  2QYU A;  2L6J A;  4A55 A;  3EU9 A;  3IXE A;  3TXN A;  1N9A A;  3J5Q B;  2FBN A;  5JHA A;  4FJY A;  1K1A A;  2CHX A;  2IEJ A;  3TAX A;  4DX2 A;  4J6I A;  4J8S A;  5AIJ A;  3RRN B;  3RSE G;  3BU8 A;  4MKT A;  2XS8 A;  4F6R D;  2J07 A;  3KS2 A;  4G24 A;  2WQ7 A;  2VSX E;  3AU4 A;  4JPS A;  1V54 E;  4E6H A;  3ASG A;  1K3Z D;  5G04 J;  4AIF A;  2R05 A;  4JA9 A;  5KJM A;  3FFL A;  4Q69 A;  4U04 A;  1A5E A;  2QZA A;  1HZ4 A;  2JAB A;  5A7D B;  3SFX A;  1BU9 A;  4DPR A;  1OUV A;  3FTV A;  2R03 A;  3SF4 A;  2Y0B G;  1NP7 A;  1JWG A;  4UQY A;  4MLP A;  1N95 A;  4HVB A;  1E8Y A;  4XKB A;  2YHE A;  1WAO 1;  3PDN A;  1LD7 A;  4MS6 A;  1BLX B;  1PC2 A;  4TUM A;  3FWV A;  1S63 A;  2Y3A A;  3UT4 A;  5T8I A;  4N5Q A;  3ZUV B;  4IUL A;  4JZY A;  2VSY A;  3BEE A;  3W9G A;  3CVV A;  1ZB1 A;  4ANW A;  3QWV A;  5ITZ F;  3ZYM A;  2KZT B;  2Q7F A;  5EX0 A;  4QQI A;  5BNW A;  2WXI A;  1PY1 A;  3APC A;  4ME2 A;  3UPV A;  2A5E A;  4AP2 A;  5JHB A;  4JXT A;  1OCO E;  5AN8 A;  3DSX A;  4RG6 A;  2WXF A;  3Q49 B;  1OT8 A;  3HXE A;  3LJ3 A;  2FO7 A;  1MZC A;  5BW8 C;  4BFR A;  4WWP A;  3GZS A;  1UJJ A;  3B95 A;  3ASO E;  3TWV A;  1X5B A;  3DSW A;  5KJN A;  4CT4 A;  4C48 B;  3QNK A;  2Y69 E;  3D9N A;  3EU5 A;  4YDE A;  5M72 A;  1HU3 A;  4L2Y A;  2X38 A;  4BSZ B;  1TNZ A;  3R7Q A;  3V2X A;  3FTW A;  5FT9 A;  3BG0 B;  5E76 A;  3RU0 A;  3CVP A;  4J8E A;  2UWJ G;  4XKC A;  3K9I A;  3CK8 A;  1GW6 A;  3C3R A;  2P9U G;  2J9Q A;  4BTB A;  5AAR A;  4UWK A;  5CCM A;  1OWP A;  5HRY A;  3LY8 A;  3DRA A;  5AQA A;  3ZFW A;  2LUH A;  3E33 A;  4WAF A;  3ZPJ A;  1TN8 A;  4N39 A;  4AM9 A;  3RO2 A;  3FU3 A;  1Y8M A;  2RFA A;  4ILI A;  4HQD A;  3ASD A;  3FU6 A;  3ZHE B;  2L0I A;  2V5Q C;  3MJW A;  1XNF A;  4UUC A;  1YYH A;  1P5Q A;  2RFM A;  4TV3 A;  3UT7 A;  4N3C A;  5AJL A;  2XZD G;  3HXF A;  4CZ2 D;  4UWL A;  3RRU A;  5AQB A;  4W9R A;  3CVQ A;  3T5X A;  2OEV A;  1TNU A;  5JJT A;  3MKQ A;  2BKG A;  5A6C A;  2CHZ A;  4HBD A;  3PE4 A;  1NA0 A;  2KCV A;  3ZN3 A;  1N4P A;  3JYS A;  4BT8 A;  5BPP A;  1S64 A;  4CYM D;  3E37 A;  2CG3 A;  4C0E A;  4I2W A;  2PQR A;  3ZEF A;  1TN7 A;  3MEK A;  3U66 A;  4YND A;  2DZO A;  4PS7 A;  5BV1 A;  3UMV A;  1K1B A;  3L22 A;  3KD7 A;  3CSF A;  3HYM B;  3UM1 A;  3HDX A;  3S7D A;  3VLF A;  4G8L A;  1N4Q A;  3JXI A;  3FUN A;  3FUM A;  1MX6 A;  4GA2 A;  4EZJ A;  2Y1L E;  2WXN A;  4N2Q A;  1MJ0 A;  1TNO A;  2GRQ B;  2EIK E;  1B89 A;  4GTP A;  2XGS A;  4UI9 C;  5ENO D;  4NIK A;  2VTB B;  4AEZ C;  1NL4 A;  3CV0 A;  3ML9 A;  3PZ1 A;  3TJP A;  1D8D A;  4IN3 B;  4YDY A;  4YVO A;  2P9S G;  2L9B A;  4P29 A;  2J4D A;  3U4T A;  2DVW A;  4GMR A;  3SO8 A;  2I2O A;  4B94 A;  1HH8 A;  3BG1 B;  3JQ0 A;  4BTA A;  2WMO A;  3MX3 A;  4CDN A;  2KC7 A;  4PUC A;  4RLY A;  2RG8 A;  3UKR G;  3C72 A;  4HI8 A;  3QDN A;  2NXP A;  2FUL A;  4GYY A;  4UWG A;  1DC2 A;  2J08 A;  4HRL A;  3D9P A;  4GCN A;  1H2U A;  2PM6 A;  3L17 A;  1OCR E;  3CHS A;  3URZ A;  4AOF A;  2J09 A;  3CIA A;  3AG4 E;  3NBN B;  5T4Y A;  4F7A A;  3TWT A;  2FF4 A;  3KSL A;  4UI9 K;  3N71 A;  5E75 A;  3MZL B;  3PUJ A;  4BX8 A;  3EHM A;  4L1B A;  4CCA A;  3B7R L;  3Q9N C;  1D9S A;  4JHK A;  2H6F A;  3PVL A;  2ETC A;  4HOU A;  2HO1 A;  4F53 A;  5ENR D;  4Q94 A;  2IOL A;  5KCM A;  3B7U X;  1NA3 A;  1G3N B;  5C2Y A;  2CFZ A;  4ANU A;  2VSO E;  4JD2 G;  3R7R A;  3TWU A;  3PZ4 A;  2KCL A;  4GTV A;  4U7E B;  4KVM A;  3EHR A;  4O1P A;  4GTQ A;  3R9A B;  4GPM A;  3CQG B;  2IFU A;  3SHF A;  2I1K A;  4JVS A;  1N11 A;  1OWM A;  4BY6 A;  2LNI A;  4GTM A;  3TWX A;  2VGX A;  4BER A;  3UQ3 A;  1S70 B;  2DZN A;  3LYA A;  1HF8 A;  1NFI E;  3G2S A;  5J90 A;  3FUK A;  5CEA A;  3ZIM A;  4I1M A;  4HOS A;  2WB2 A;  4B89 A;  2WXM A;  3B13 A;  1MX4 A;  5D2M C;  2AJA A;  2H6I A;  4KBQ A;  4EBA G;  3OAW A;  1AWC B;  1H2V C;  2H6G A;  4U0Z A;  3APD A;  2J49 A;  3V30 A;  3DSS A;  4LEU A;  2KBX A;  3IHY A;  5J08 A;  2V8S E;  5AAO A;  1SVX A;  1OY3 D;  3AAA C;  5LX8 A;  4U96 D;  1QZ2 A;  2FEZ A;  3ZXP A;  3P1U A;  4U0U A;  3TWQ A;  1ELK A;  1H0A A;  1Y6I A;  2GRO B;  3Q7A A;  1V55 E;  1MQS A;  5DIZ A;  4CGV A;  4M7C A;  4FHJ A;  3ZGQ A;  2WQ6 A;  2IU1 A;  2LAH A;  5KNG A;  1HFA A;  1UN9 A;  3UUX A;  3FUE A;  3CKB A;  4G25 A;  3ZYL A;  4URK A;  4J7W A;  4HLL A;  3OXF A;  3NB2 A;  4HOT A;  1FPP A;  4YDW A;  1U3D A;  2H6H A;  5JJ7 A;  2F37 A;  1JUQ A;  4AVX A;  4GML A;  1IXV A;  5HI7 A;  1N54 A;  4GAA A;  3CHM A;  1FVF A;  2HE0 A;  3V31 A;  3L9T A;  2RKK A;  3SFY A;  4UWH A;  4HOR A;  1H2T C;  4LUN U;  3CQC B;  1FT2 A;  3D9L A;  2LAI A;  3UT8 A;  3ZRH A;  3QWW A;  3ZYK A;  3CKC A;  3J5P A;  3EDT B;  1TYQ G;  3PEU B;  2LXL A;  4DUI A;  1Z5S C;  4HFG A;  4O1O A;  2AXV A;  4TXP A;  3Q7F A;  2VGY A;  3AS8 A;  1NZN A;  4DX6 D;  3GW4 A;  2OVF A;  3DBS A;  2PZI A;  5LP0 A;  3PZ3 A;  3P2B A;  3GZ1 A;  3EJN A;  2EIJ E;  3JUE A;  3MKQ B;  3ULE G;  2IOS A;  4BEP A;  4IYP A;  2XGO A;  3L54 A;  4WWN A;  5EID A;  5ENT D;  3HIZ A;  1JWF A;  4I2Z A;  3SBS A;  2XGM A;  4BES A;  5BXU A;  4HRM B;  2OV8 A;  3FTZ A;  3G2U A;  3FEY A;  3KAE A;  4JC8 A;  2ZGG A;  2IJG X;  3ASH A;  5IY5 E;  4DI3 A;  3JXJ A;  5FTP A;  3SBT B;  4GYO A;  4MRU A;  4ATZ D;  5JJ6 A;  4RSY A;  3ZKJ A;  4X8Q A;  3FUJ A;  3EHQ A;  3B7T A;  3D3M A;  3UI2 A;  1KPS B;  4K0R A;  3L13 A;  3V79 K;  4KYO B;  1KZO A;  3ULY A;  3EIQ C;  4OYS A;  4U8H A;  2BTD A; 
#chains in the Genus database with same CATH homology
 4BER A;  1S70 B;  1BI8 B;  2DZN A;  1A5E A;  4DRX E;  4K5B A;  5AQ9 A;  1WG0 A;  4U8V D;  2JAB A;  1NFI E;  5D66 A;  3HRA A;  3UTM A;  1IKN D;  4BSZ B;  4U8Y D;  4HRN A;  3V2X A;  3J5P A;  4CYM D;  1BU9 A;  2PNN A;  5CEA A;  2XZT G;  4RLY A;  4DUI A;  2KXP C;  5ENQ D;  2Y0B G;  4HI8 A;  3NOC D;  1MX4 A;  4O1O A;  2MYO A;  5HS0 A;  5CEC B;  3Q9U C;  5BXO A;  2AJA A;  4F1P A;  1AWC B;  2F8Y A;  4DX6 D;  5CBO A;  3TWW A;  4O60 A;  3V30 A;  2DZO A;  1DC2 A;  1BD8 A;  5AAR A;  2KBX A;  5AAO A;  4HRL A;  1SVX A;  1OY3 D;  3AAA C;  3HG0 D;  4BET A;  4U96 D;  4DX7 D;  1IHB A;  1N0R A;  1QYM A;  3F6Q A;  1K1B A;  1BLX B;  5HRY A;  2ZGD A;  3LJN A;  3TWQ A;  4TUM A;  3T9K A;  3T8K A;  3W9F A;  5EIB E;  3JUE A;  4LNU D;  5EYP F;  5JA4 D;  4JB8 P;  4N5Q A;  4BEP A;  3D9H A;  4ZHB A;  5AQA A;  3NBN B;  3ZUV B;  3ZNG A;  5EID A;  3TWT A;  4ZFH A;  3EU9 A;  3ZU7 B;  5ENT D;  4G8L A;  3IXE A;  4LSZ E;  5KNG A;  3W9G A;  3JXI A;  1MYO A;  3J5Q B;  5ITZ F;  4OAV B;  2RFA A;  1MX6 A;  1WDY A;  4HQD A;  4HB5 A;  2F8X K;  4BES A;  4QQI A;  1K1A A;  2Y1L E;  4K5A B;  2V4H C;  5EN5 D;  4HRM B;  3TWR A;  5BXU A;  3Q9N C;  4HNA D;  1MJ0 A;  2V5Q C;  1D9S A;  2ETA A;  4J7W A;  4UUC A;  2VGE A;  4HLL A;  1AP7 A;  2ETC A;  4DX2 A;  2ZGG A;  2FO1 E;  2A5E A;  4U95 D;  1YYH A;  4YDW A;  5FIN A;  3V2O A;  2P2C P;  2RFM A;  5ENO D;  5ENR D;  2F37 A;  4NIK A;  5FIO A;  1YCS B;  2XZD G;  4CZ2 D;  5AN8 A;  4DX1 A;  3DEP A;  3JXJ A;  4G8K A;  2BKK B;  1IXV A;  1YMP A;  4ATZ D;  3B7B A;  4Z68 A;  1OT8 A;  1G3N B;  3ZKJ A;  4DX5 D;  5AQB A;  4K5C A;  4A63 B;  1N0Q A;  5JMN D;  2QC9 A;  3TWU A;  4F6R D;  1MX2 A;  2HE0 A;  4HI9 A;  4LG6 A;  5KWD A;  3EHQ A;  1TR4 A;  2XEH A;  2DWZ A;  3V31 A;  2XEN A;  3KEA A;  3B95 A;  5ENS D;  3EHR A;  3TWS A;  4O1P A;  1BI7 B;  2XEE A;  3NOG D;  4QFV A;  5EYL A;  3UI2 A;  1UOH A;  5CER B;  3TWV A;  4YDY A;  3UXG A;  2L6B A;  4J8Y A;  1DCQ A;  2J8S D;  3AJI A;  5KBA A;  4GPM A;  3V79 K;  2QYJ A;  5HKP A;  1K3Z D;  2BKG A;  2B0O E;  2NYJ A;  5AQ7 A;  5KNH D;  1N11 A;  2DVW A;  4HBD A;  4GMR A;  5ENP D;  3SO8 A;  4B93 B;  4C48 B;  1SW6 A;  2ETB A;  3DEO A;  3C5R A;  5EIL A;  5CED B;  4OAU C;  5CBN A;  3TWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...