2NYJA

Crystal structure of the ankyrin repeat domain of trpv1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
250
structure length
244
Chain Sequence
b'RLYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTKFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title The Ankyrin Repeats of TRPV1 Bind Multiple Ligands and Modulate Channel Sensitivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 58
structure length 244
sequence length 250
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2nyjA00
5AQ9A 2F8XK 4BESA 3JXIA 2BKKB 4YDYA 4LSZE 4DX1A 3ZKJA 4HRLA 1YCSB 5ENOD 5ENTD 3TWRA 4ATZD 1NFIE 3Q9UC 4QQIA 2RFAA 5ITZF 2VGEA 5CBNA 4YDWA 1K1AA 4N5QA 4U8VD 5CEDB 2ETCA 3B7BA 3IXEA 2XENA 4HB5A 4DX6D 1DCQA 1WG0A 2QC9A 1BU9A 3Q9NC 2ZGGA 2DZOA 2XEEA 4G8LA 4F6RD 3W9FA 2XZTG 5AQ7A 3NOGD 3JUEA 3UXGA 5HKPA 3TWWA 2NYJA 5EIDA 5AARA 5KBAA 1BI7B 3AAAC 3TWUA 4G8KA 2B0OE 5CEAA 4BEPA 3ZNGA 1N0QA 3NOCD 5EYPF 4BSZB 3AJIA 3TWTA 2BKGA 2F37A 4J8YA 3ZU7B 4U95D 1IKND 3V30A 1UOHA 4U8YD 4TUMA 5EN5D 4ZFHA 1YYHA 4BETA 4HI8A 3ZUVB 5EIBE 4NIKA 4HQDA 3V31A 1BLXB 2ETAA 4GMRA 3T8KA 4DX2A 4O1OA 5JA4D 2J8SD 4OAVB 5ENPD 3EHRA 5HS0A 3EU9A 4LG6A 1OY3D 3V2XA 1A5EA 2V4HC 4DRXE 4K5BA 3SO8A 3C5RA 4LNUD 2JABA 3F6QA 2DVWA 4GPMA 4HLLA 5ENRD 1IXVA 2Y1LE 5CERB 2Y0BG 2ZGDA 1K3ZD 5EILA 4JB8P 1K1BA 2DWZA 4HNAD 3V2OA 4Z68A 1SW6A 3TWXA 2QYJA 5ENSD 1MX2A 4J7WA 3DEPA 1DC2A 2KXPC 1OT8A 2PNNA 5FINA 5BXUA 4B93B 4A63B 4RLYA 3B95A 4C48B 4DX5D 3DEOA 4ZHBA 2AJAA 1MX4A 3JXJA 5D66A 2KBXA 2MYOA 4U96D 5AQAA 2HE0A 3D9HA 5KWDA 4HBDA 2L6BA 1S70B 2XZDG 3J5QB 4K5CA 1WDYA 4UUCA 5FIOA 5HRYA 4OAUC 3TWSA 1YMPA 4DX7D 5KNGA 1D9SA 4BERA 3UI2A 4CYMD 5KNHD 3NBNB 4CZ2D 1N0RA 2RFMA 2V5QC 1N11A 2ETBA 4HI9A 4HRNA 4K5AB 4O60A 1G3NB 5BXOA 1SVXA 1AP7A 1QYMA 4DUIA 2F8YA 5EYLA 3TWQA 3J5PA 4O1PA 3EHQA 5AAOA 2A5EA 2FO1E 4HRMB 2P2CP 5JMND 2DZNA 1MJ0A 3KEAA 1MYOA 3HG0D 3V79K 5AN8A 1MX6A 5AQBA 1AWCB 3TWVA 1IHBA 3HRAA 2XEHA 3W9GA 4F1PA 5ENQD 5CECB 4QFVA 3UTMA 1BD8A 3LJNA 3T9KA 1BI8B 5CBOA 1TR4A
chains in the Genus database with same CATH superfamily
3X2QE 2YINA 4MLPA 4YDYA 2ILRA 5KCMA 1GW6A 1YCSB 5ITZF 5CBNA 1DCQA 2QC9A 1HU3A 3WXXA 4BY6A 2H6FA 3L82A 3L17A 3S7DA 1N0QA 3AJIA 3AS4A 4DK5A 3D3MA 3AG2E 4U95D 4ANXA 1E7UA 3CVYA 2LXLA 3AG3E 1OCCE 4TUMA 3QAQA 3EIQC 4EPZA 2V4LA 3CQCB 3CSFA 4DX2A 2J08A 3U66A 3GYZA 4M7CA 2IF4A 4FP7A 4DRXE 3G2WA 3UKRG 4AY6A 2DVWA 2EILE 3TG5A 4K0RA 3AS8A 3HVEA 3CVVA 4JB8P 3I4GA 1K1BA 4HNAD 1N4SA 3V2OA 3BEEA 5ENSD 3LCAA 3SFYA 4G1TA 1N9AA 5FINA 1E96B 4A63B 1FT2A 1KT1A 2EIME 3RK6A 4GTOA 3D9PA 1U3CA 4JA7A 2MYOA 5AQAA 1ELKA 3FEYA 3FTSA 3CGHA 1YMPA 3ZPJA 5FQ6A 3ZEFA 2DYRE 4FJZA 4HI9A 5BXOA 3IHYA 4I6GA 3PH0C 5EYLA 2FO7A 3ULQA 3EHQA 5AAOA 4U63A 1Q2ZA 1OWNA 3B7UX 2UWJG 5ARFA 3PDNA 4JZYA 5CBOA 2IOSA 3PNTB 3CVPA 4E85A 2DBAA 2V8SE 2KM4A 2MHKA 1H2TC 3BUAA 2XCBA 2NYJA 5ANLA 5FT9A 4TV3A 2WXNA 4OVVA 3ML8A 1IKND 3Q49B 4N2QA 2XRZA 3SGHA 1HH8A 4I1OB 2XGSA 4H7YA 4I43A 3SFXA 5JA4D 2J8SD 3T5XA 1HFAA 2MRIA 1XGWA 4APOA 3MCXA 4FLBA 2L0TB 2F0YA 3FTYA 3T5VA 2Y0BG 2DIWA 3I4RB 4DPRA 4G26A 1OT8A 4GYWA 2WXJA 4C48B 3ABME 2XHEA 2HR2A 3VLEA 3CHSA 3LYAA 4CYMD 4WNDA 3SNXA 2LUHA 1SZAA 1A17A 4O1PA 4HRMB 1UJKA 1MX6A 1OUVA 2OOEA 2F8XK 3U3WA 3LXUX 4J8DA 3I3NA 4WWNA 3ZYLA 1SA4A 1TN8A 4WAFA 4TXRA 4ANUA 4GZ5A 3LS8A 2I9CA 2P9KG 2ZGGA 2Q7FA 2LNIA 3CVNA 3TWWA 1N4QA 3TWUA 3ZXPA 3NOCD 3UKUG 3RO3A 2FBNA 4NACA 3NF1A 3V30A 3UM2A 4HQDA 2R2LA 3T8KA 3MV3B 1DNPA 3EU9A 2FF4A 3SZ7A 1H0AA 4KYOB 4U04A 3LKUA 1LD8A 3JQ1A 3KAEA 3C72A 4L9PA 2CG2A 3FTVA 3HXCA 4JEHA 3DEPA 2R59A 3NB2A 4ME2A 3G2VA 5BXUA 1Z3YA 3FFLA 2JLBA 2PZIA 3JXJA 3ASGA 4BTBA 4TRQA 4DLOA 4JHJA 4HBDA 2XZDG 5FIOA 1TJFA 3PNLB 1NZNA 3CHRA 2V5QC 3FU5A 3FU0A 4GTVA 3LVQE 3L22A 1MQSA 2RKKA 4EHMA 2IFUA 1BD8A 4AY5A 5ARGA 1KZPA 5BV1A 2KZTA 3JCKC 4LSZE 2ONDA 4HRLA 5ENTD 1NFIE 3EHMA 5CRVA 5JHBA 1HE8A 5CEDB 2AXVA 3NZUA 2Y4TA 3SY2A 4G8LA 4UQXA 1OCOE 5EIDA 3CKBA 3ZNGA 3FU3A 4LNBA 3PS6A 2R02A 1O1RA 1O1TA 3G2UA 3FUEA 2KC7A 2OV8A 4NRHB 2LAHA 5EN5D 1RW2A 4O1OA 4YDEA 2A4ZA 2P58C 3ZFWA 4LNUD 2JABA 4GPMA 3CEQA 3HXDA 5CERB 1FCHA 4NQ0A 3DSXA 3O48A 2YHCA 4HOQA 1MX2A 3FUMA 4EBAG 4RLYA 4GCNA 3EHNA 3N71A 1E7VA 4IN3B 1Y8MA 3KSLA 2XPIA 5A23A 3FTXA 1ZU2A 3PEUB 3QWPA 4W9RA 1TNYA 4DX7D 1B89A 4MS6A 1E8YA 2VSOE 5AYWD 1QYMA 4DUIA 4AOFA 1H6KA 3L54A 2X38A 3CQGB 5LP0A 3D9MA 2DZNA 4XI9A 1MYOA 5AQBA 3TWVA 5BNWA 3TJPA 3MKQB 4UI9K 4A3TA 1V55E 2VGEA 3P2BA 4PDXA 3FWVA 2ZU6B 1NI1A 3Q9NC 3TAXA 4EECA 3RJVA 3RAUA 1JWFA 2XGMA 4BSZB 3UM1A 3VTXA 4GCOA 2WQ7A 5BW8C 1X81A 2AWIA 1MZCA 3APCA 2C2LA 2PM6A 2WPVA 2M63A 5ENPD 4ATGA 4K5BA 5T3RA 3CHMA 4J8FA 4A3VA 2XPYA 4UWGA 2JEKA 4ACLA 2I1KA 3VLFA 2CG3A 2UY1B 3URZA 3E37A 1U2VG 4HFGA 3B13A 2WM9A 4BSXA 4D10C 4UI9J 4CDMA 2P9SG 5G05C 4O60A 4KT6B 2QY7A 5JMND 4GPKA 4HVBA 5FZQA 3Q15A 5AN8A 4PUCA 4BESA 1ELWA 4X8QA 4N5QA 1WG0A 3TGOA 3PUJA 2XZTG 3DBSA 5HKPA 5KJKA 3CHPA 4G11A 2XCCA 2FI7A 3DSSA 4U8YD 2L6JA 2VJ8A 4LUNU 4UWLA 5AIJA 4B94A 5J90A 3ZYKA 1IQUA 3WG7E 1S63A 1NA0A 3CK9A 1OWLA 5BUZA 2J9QA 4LNGA 2YNQA 3Q47B 1K3ZD 3DXKG 1WAO1 3TXNA 1TJCA 2QYUA 1YA0A 1HG5A 3BU8A 4GZ6A 5AENA 4U7EB 3ASNE 2KBXA 5G2NA 1OCZE 3HXBA 2GW1A 3AU5A 1S70B 1JCSA 1FVFA 4PS7A 3MEKA 5J08A 3IBEA 2WMOA 5FTPA 1UN9A 4IULA 3AG4E 3ABKE 5JJTA 4KVMA 5ANRA 3AU4A 2YHEA 3DPDA 2XEHA 3HXFA 4UQZA 1X5BA 3UTMA 3LJNA 1BI8B 1SZ9A 1TR4A 4RSYA 4CRWA 3FUKA 4EQFA 3S2AA 4ATZD 3ZRHA 3ZHEB 3NZSA 2NXPA 4F53A 3CK8A 3AG1E 1QQEA 4IRUA 2R05A 4F6RD 3TG4A 5AQ7A 1U3DA 3MYVA 4HS2A 2BKGA 3FUDA 1HS6A 2VQ2A 3BG1B 1SA5A 1D8DA 2DCPA 4CCAA 4R7LA 3UX4A 4GA0A 1O5MA 2HO1A 5T4YA 3EHRA 3ABLE 1JCRA 4JL0A 3BQOA 2WXQA 1VDYA 3U9WA 5KJNA 3R7RA 3DWLG 4PS8A 4GTQA 3FUIA 2VTBA 4J8EA 3FUFA 4AIFA 3MJWA 3AS5A 4F7AA 3TWXA 4TXPA 4O6FA 2KXPC 1DC2A 4Y6CA 4ZHBA 4AXHA 3D9NA 3SHFA 1H2VC 3DPYA 2CFZA 1DCEA 1G3NB 3G2SA 4HOUA 3APDA 3NAWA 3UPVA 5CHEE 4L2YA 5DBKA 1PC2A 1N52A 1O1SA 2CHWA 1AWCB 3HRAA 3QJZA 3MKRA 5AARA 1JUQA 2ETCA 3LEWA 2XENA 4HB5A 1K8KG 3ZGQA 2DZOA 2FEZA 4C9BB 3MKQA 4ILGA 4KMOA 4KVOA 3FHEA 4G8KA 4U0SA 3Q73A 4DI3A 3RRNB 3ONLA 1XNFA 4AM9A 2H6HA 4FHJA 1TN7A 4ZFHA 3PVLA 4E6HA 3ZW3A 4Q69A 4FC8A 2V4HC 2KCKA 4CGWA 2WXLA 4U07A 1DVPA 4JW1A 1H19A 1QBQA 3DSTA 4Z68A 2R17C 3E34A 2DYSE 5BT1A 3SBTB 4LRZA 5B1AE 4ILHB 3PZ4A 3QK0A 3B95A 2EQXA 4RG9A 2C0LA 5KJLA 1Z5SC 3IV0A 5KWDA 3QOUA 2BTDA 4I6JA 4GA1A 5KNGA 4UWFA 3LY7A 5AJDA 3D9KA 4N3AA 1ZBPA 4K5AB 2UY1A 1HO8A 1MJ0A 4MRUA 3SI5A 1E8XA 2OCCE 4GZCA 5KJMA 4I1AA 5ENQD 3MX3A 4APFA 5FQ8A 4FHKA 5AQ9A 3TWRA 3IHVA 2RFAA 3ASDA 3Q5MA 2A5UA 3QDNA 4GZ3A 1BPOA 2XEVA 3HHMA 3C3OA 4HLEA 4DLQA 2VSXE 1Z3XA 5KBAA 3OXFA 4I2WA 4U8HA 3JYSA 5EX0A 1OCRE 5H7PA 2I2OA 4N5CA 3GZ1A 2WXMA 4OVUA 3FH5A 3ENEA 3FTWA 3R7QA 3B7SA 4GMLA 3SBSA 4GMRA 3PZDA 5HS0A 3V2XA 3LDZA 2ZISA 2HM8A 3FTUA 3ZVVA 2EINE 2V0PA 2IU1A 5ENRD 1HG2A 4GMJA 3RKVA 3CVUA 2VTBB 1SW6A 5FJYA 2VSYA 1LTXA 3Q78A 3KSQA 2VYIA 2IONA 1D8EA 2WXPA 2PQNA 5D66A 2HE0A 1L5JA 3J5QB 1N4PA 3TWSA 1E8WA 1PAQA 4GTPA 3FEXA 3UI2A 3ESLA 3ASOE 4HRNA 3R9MA 4F3VA 2I6HA 2XS1A 3NQPA 3D9OA 2A5EA 3Q75A 2OEVA 2GRMA 3K9IA 2WXGA 4F1PA 4J6IA 3RIBA 4Q96A 1OWOA 3DSWA 1TNZA 2GROB 2WXIA 3Q9UC 4QQIA 4U8VD 3IXEA 2PQRA 4KXKB 4N2SA 5JHAA 3QB2A 3ONKA 3S7JA 3GW4A 4IYPA 1LD7A 3L16A 3FU6A 3C3QA 5G04C 3SD5A 4J8YA 3ZHEA 4B8AA 4XIFA 4HI8A 4GU5A 3HIZA 4GAAA 2VSNA 1BLXB 3DRAA 4OAVB 4I2ZA 5ENNA 1N4RA 3SF4A 2I1JA 4JHKA 1QNFA 4B8CB 3CR3A 4C0EA 3C3RA 3MZLB 4JEUA 2OEWA 2P9UG 2X6IA 2IY0C 3OXGA 4L23A 3FUJA 1P5QA 4AJWA 5D2MC 3E4BA 5CRUA 5DIZA 4OAUC 5LCWC 1D9SA 4BERA 5G05J 1TN6A 1N11A 4CEMA 2P9PG 5FQ4A 3LJ3A 1IHGA 3IKOB 3UT8A 4FJYA 4CDRA 1N94A 4CT0A 3HG0D 1PY1A 5C1DA 4MKTA 2ZIRA 5JJ7A 2C0MA 3D9LA 5G55A 3UQ3A 4URKA 4CGVA 3EDTB 4DX1A 2E2EA 3FH7A 2P9NG 1K1AA 2GGFA 5FQ7A 2WXFA 4DX6D 1JCQA 4UWHA 2KCVA 2EIJE 3JUIA 3ULYA 3ZYMA 3AAAC 4XX5A 4ABNA 5CEAA 1H2UA 4EZJA 3TWTA 2F37A 3QWVA 4I9EA 1JPLA 2XGOA 3ZN3A 3FY4A 2H6IA 2AXUA 4F1SA 4AEZC 3TXMA 5EIBE 4L7TA 1ZB1A 2ETAA 3PZ2A 3U64A 3PZ1A 4WWOA 2Y3AA 4G23A 1OY3D 3CVWA 5HQ8A 2WQ6A 3SO8A 4FA6A 4CDNA 2BF0X 4HLLA 2ZGDA 5A7DB 2GRRB 2QYJA 2LAIA 2H6GA 3JQ0A 4B89A 3C98A 2GRNB 4HOSA 4HOTA 4JXTA 4XEIG 4K5CA 4WUYA 3FTZA 2RD0A 2J4BA 3S7BA 4TXQA 3NBNB 5A6CA 4LCTA 2NSZA 4J0UA 4AV7A 5FWQA 2F8YA 2EIKE 4JA9A 2FO1E 2VGXB 5FZRA 4N39A 3FP3A 3E33A 2R03A 1WM5A 1SQMA 3ASHA 3PUKA 4YDOA 3QKYA 2LXMA 2AW6A 3HYMB 2CHZA 4YDWA 3B7BA 5EDSA 1E8ZA 4KBQA 1BU9A 4GB9A 3KS2A 3JUEA 3UXGA 1KPSB 3UIOC 2IEJA 5T8IA 4AVXA 3U4TA 1YYHA 2X6JA 4XKCA 3ZUVB 3LY8A 3VTYA 2XRYA 3D9JA 4I17A 2WXKA 2LSVA 3F6QA 5E76A 2J07A 2P9LG 4JPSA 4I1MA 5EILA 4BX9A 1S0PA 2DWZA 4XZ4A 4HXIA 3L9TA 5C2YA 2AJAA 3ML9A 3L6AA 5BV0A 4A55A 3DSVA 4G25A 3S7FA 2GRPB 3L08A 3HXEA 3ZIMA 3PE3A 1AP7A 3ASFA 4GYOA 4GTMA 3GZSA 3KEAA 2BEDA 4OYSA 3ESKA 2HYZA 2R5SA 1TNUA 2IO3C 1FVHA 4EBAA 3QARA 3ZKJA 4EZKA 4FLHA 3CKCA 3CHOA 1H6PA 2VGYA 3T8MA 1E90A 1Y6IA 1UW4B 4L1BA 3CLJA 4UQYA 3PZ3A 3NOGD 4RQIA 3CSTA 4G24A 4GTTA 3ULEG 2WB2A 2GRQB 5D0QD 1OXJA 4PH4B 3UT4A 3G2TA 4FADA 3EJNA 3Q7AA 3V31A 2J4DA 3FUHA 2Y4UA 4I6EA 3ZXSA 4C0MA 3UMVA 1RZ4A 3CVLA 1IXVA 4HORA 3MV2B 5IY5E 4GYYA 1ELRA 4LERA 3QC1A 3Q7FA 2ZXWE 3L13A 5CCLA 3TL5A 1HX8A 4ANWA 2NC9A 3CVXA 2OVFA 5HRYA 4BTAA 2L9BA 3Q4AB 4DI4A 4Y6WA 3RO2A 4ACKA 4BX8A 2X6KA 1HZ4A 3UIPC 3J5PA 2WVIA 3CV0A 3UUXA 5B1BE 5LOZA 3LVRE 3EIJA 1EPUA 3KD7A 4JD2G 3T9KA 3UM3A 3MGBA 3FUNA 4MBGA 2BKKB 4H7XA 4M3OA 4JC8A 1TEZA 1OWMA 1KLXA 2XEEA 3W9FA 1V54E 2LO6A 1S64A 4RVBA 4CT4A 3UINC 3ZU7B 1EF1C 4WNGA 3HVEB 2XS8A 1FPPA 4ILIA 2Y69E 3SQVA 3RRUA 2IQCA 1N54A 4N3BA 2V5FA 2QFCA 4LG6A 1A5EA 2MOWA 3C5RA 2J09A 4BWRA 3CVQA 3CHQA 3VLDA 4U0UA 5CMYA 3UT7A 4YVOA 1NL4A 4DX5D 5FZSA 3P1UA 2XPZA 4EZLA 5EKQD 2IOLA 3BG0B 3CK7A 3FDHA 5KNHD 2AXZA 1N95A 2OVBA 2RFMA 2QZAA 3UM0A 2ETBA 3E32A 3TWQA 4GTRA 1UG3A 4ANVA 4XE0A 2WQHA 2RG8A 2KCLA 3W9GA 4QFVA 2YQ8A 1LF8A 3FULA 5CMWA 1TNOA 2E0IA 4I9CA 3QNKA 4AP2A 1EYHA 5B3SE 4A1SA 2WMNA 4U0ZA 3SFZA 4WNFA 2VGXA 4GTSA 1NP7A 2BUGA 2XQ0A 1H6OA 1W3BA 4TUUA 4YNDA 1BI7B 3CIAA 5G04J 4BEPA 3ISMC 5LFAA 4V3IA 1UOHA 1IYGA 1HF8A 5JJ6A 4NIKA 2KATA 2LSUA 1FT1A 3I5PA 4K03A 2WXOA 4FULA 1KT0A 4WWPA 4J8SA 4WNEA 3DXMG 2X6HA 3PREA 2WXHA 4XI0A 3R9AB 4A1GA 4J7WA 3B7TA 2PNNA 3IEGA 4B93B 4DJAA 5LX8A 1MX4A 5EX3A 4U96D 5AJLA 5M72A 2L6BA 5LCWJ 3RSEG 4UUCA 1UN8A 1Z6TA 2PM7A 4P29A 4GA2A 2CHXA 3KEZA 5HI7A 2J49A 1JWGA 1SVXA 3LPZA 2AVPA 3RRMB 1NA3A 3D9IA 4RG6A 1IQRA 5CECB 4FU3A 4JVSA 4PS3A 3JXIA 4BT8A 2P9IG 4G2VA 5ENOD 3LY9A 1UJJA 3Q79A 4NURA 4YVQC 1HXIA 1MHQA 2GRLA 3GZ2A 2X6FA 3ZYQA 5E75A 2B0OE 2FULA 5EYPF 3PE4A 2B6CA 3DSUA 4N3CA 4XKBA 3OAWA 3RU0A 4BETA 3O4ZA 4KZCA 4UWKA 2L0IA 3PEVB 4GZDA 1OWPA 3APFA 3FH8A 1EDUA 3B7RL 2WXRA 2Y1LE 4BFRA 1INZA 4JHRA 3QWWA 3EU5A 2CFUA 3DEOA 1TNBA 5BPPA 2X3MA 1TYQG 3D9HA 3HDXA 4L2LA 5D0OD 4Q94A 1WDYA 3PRZA 2IO2C 2KZTB 1WY6A 4KZ0A 4CZ2D 3MA5A 1N0RA 4UI9C 1QZ2A 1KZOA 2PL2A 2IJGX 2P2CP 4LEUA 3OXLA 3EUVA 5CCMA 3V79K 1IHBA 3E30A 4BT9A 3OTNA 4B0ZA
chains in the Genus database with same CATH topology
5AQ9A 2F8XK 4BESA 3JXIA 2BKKB 4YDYA 4LSZE 4DX1A 3ZKJA 4HRLA 1YCSB 5ENOD 5ENTD 3TWRA 4ATZD 1NFIE 3Q9UC 4QQIA 2RFAA 5ITZF 2VGEA 5CBNA 4YDWA 1K1AA 4N5QA 4U8VD 5CEDB 2ETCA 3B7BA 3IXEA 2XENA 4HB5A 4DX6D 1DCQA 1WG0A 2QC9A 1BU9A 3Q9NC 2ZGGA 2DZOA 2XEEA 4G8LA 4F6RD 3W9FA 2XZTG 5AQ7A 3NOGD 3JUEA 3UXGA 5HKPA 3TWWA 2NYJA 5EIDA 5AARA 5KBAA 1BI7B 3AAAC 3TWUA 4G8KA 2B0OE 5CEAA 4BEPA 3ZNGA 1N0QA 3NOCD 5EYPF 4BSZB 3AJIA 3TWTA 2BKGA 2F37A 4J8YA 3ZU7B 4U95D 1IKND 3V30A 1UOHA 4U8YD 4TUMA 5EN5D 4ZFHA 1YYHA 4BETA 4HI8A 3ZUVB 5EIBE 4NIKA 4HQDA 3V31A 1BLXB 2ETAA 4GMRA 3T8KA 4DX2A 4O1OA 5JA4D 2J8SD 4OAVB 5ENPD 3EHRA 5HS0A 3EU9A 4LG6A 1OY3D 3V2XA 1A5EA 2V4HC 4DRXE 4K5BA 3SO8A 3C5RA 4LNUD 2JABA 3F6QA 2DVWA 4GPMA 4HLLA 5ENRD 1IXVA 2Y1LE 5CERB 2Y0BG 2ZGDA 1K3ZD 5EILA 4JB8P 1K1BA 2DWZA 4HNAD 3V2OA 4Z68A 1SW6A 3TWXA 2QYJA 5ENSD 1MX2A 4J7WA 3DEPA 1DC2A 2KXPC 1OT8A 2PNNA 5FINA 5BXUA 4B93B 4A63B 4RLYA 3B95A 4C48B 4DX5D 3DEOA 4ZHBA 2AJAA 1MX4A 3JXJA 5D66A 2KBXA 2MYOA 4U96D 5AQAA 2HE0A 3D9HA 5KWDA 4HBDA 2L6BA 1S70B 2XZDG 3J5QB 4K5CA 1WDYA 4UUCA 5FIOA 5HRYA 4OAUC 3TWSA 1YMPA 4DX7D 5KNGA 1D9SA 4BERA 3UI2A 4CYMD 5KNHD 3NBNB 4CZ2D 1N0RA 2RFMA 2V5QC 1N11A 2ETBA 4HI9A 4HRNA 4K5AB 4O60A 1G3NB 5BXOA 1SVXA 1AP7A 1QYMA 4DUIA 2F8YA 5EYLA 3TWQA 3J5PA 4O1PA 3EHQA 5AAOA 2A5EA 2FO1E 4HRMB 2P2CP 5JMND 2DZNA 1MJ0A 3KEAA 1MYOA 3HG0D 3V79K 5AN8A 1MX6A 5AQBA 1AWCB 3TWVA 1IHBA 3HRAA 2XEHA 3W9GA 4F1PA 5ENQD 5CECB 4QFVA 3UTMA 1BD8A 3LJNA 3T9KA 1BI8B 5CBOA 1TR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQ9 A;  2F8X K;  4BES A;  3JXI A;  2BKK B;  4YDY A;  4LSZ E;  4DX1 A;  3ZKJ A;  4HRL A;  1YCS B;  5ENO D;  5ENT D;  3TWR A;  4ATZ D;  1NFI E;  3Q9U C;  4QQI A;  2RFA A;  5ITZ F;  2VGE A;  5CBN A;  4YDW A;  1K1A A;  4N5Q A;  4U8V D;  5CED B;  2ETC A;  3B7B A;  3IXE A;  2XEN A;  4HB5 A;  4DX6 D;  1DCQ A;  1WG0 A;  2QC9 A;  1BU9 A;  3Q9N C;  2ZGG A;  2DZO A;  2XEE A;  4G8L A;  4F6R D;  3W9F A;  2XZT G;  5AQ7 A;  3NOG D;  3JUE A;  3UXG A;  5HKP A;  3TWW A;  2NYJ A;  5EID A;  5AAR A;  5KBA A;  1BI7 B;  3AAA C;  3TWU A;  4G8K A;  2B0O E;  5CEA A;  4BEP A;  3ZNG A;  1N0Q A;  3NOC D;  5EYP F;  4BSZ B;  3AJI A;  3TWT A;  2BKG A;  2F37 A;  4J8Y A;  3ZU7 B;  4U95 D;  1IKN D;  3V30 A;  1UOH A;  4U8Y D;  4TUM A;  5EN5 D;  4ZFH A;  1YYH A;  4BET A;  4HI8 A;  3ZUV B;  5EIB E;  4NIK A;  4HQD A;  3V31 A;  1BLX B;  2ETA A;  4GMR A;  3T8K A;  4DX2 A;  4O1O A;  5JA4 D;  2J8S D;  4OAV B;  5ENP D;  3EHR A;  5HS0 A;  3EU9 A;  4LG6 A;  1OY3 D;  3V2X A;  1A5E A;  2V4H C;  4DRX E;  4K5B A;  3SO8 A;  3C5R A;  4LNU D;  2JAB A;  3F6Q A;  2DVW A;  4GPM A;  4HLL A;  5ENR D;  1IXV A;  2Y1L E;  5CER B;  2Y0B G;  2ZGD A;  1K3Z D;  5EIL A;  4JB8 P;  1K1B A;  2DWZ A;  4HNA D;  3V2O A;  4Z68 A;  1SW6 A;  3TWX A;  2QYJ A;  5ENS D;  1MX2 A;  4J7W A;  3DEP A;  1DC2 A;  2KXP C;  1OT8 A;  2PNN A;  5FIN A;  5BXU A;  4B93 B;  4A63 B;  4RLY A;  3B95 A;  4C48 B;  4DX5 D;  3DEO A;  4ZHB A;  2AJA A;  1MX4 A;  3JXJ A;  5D66 A;  2KBX A;  2MYO A;  4U96 D;  5AQA A;  2HE0 A;  3D9H A;  5KWD A;  4HBD A;  2L6B A;  1S70 B;  2XZD G;  3J5Q B;  4K5C A;  1WDY A;  4UUC A;  5FIO A;  5HRY A;  4OAU C;  3TWS A;  1YMP A;  4DX7 D;  5KNG A;  1D9S A;  4BER A;  3UI2 A;  4CYM D;  5KNH D;  3NBN B;  4CZ2 D;  1N0R A;  2RFM A;  2V5Q C;  1N11 A;  2ETB A;  4HI9 A;  4HRN A;  4K5A B;  4O60 A;  1G3N B;  5BXO A;  1SVX A;  1AP7 A;  1QYM A;  4DUI A;  2F8Y A;  5EYL A;  3TWQ A;  3J5P A;  4O1P A;  3EHQ A;  5AAO A;  2A5E A;  2FO1 E;  4HRM B;  2P2C P;  5JMN D;  2DZN A;  1MJ0 A;  3KEA A;  1MYO A;  3HG0 D;  3V79 K;  5AN8 A;  1MX6 A;  5AQB A;  1AWC B;  3TWV A;  1IHB A;  3HRA A;  2XEH A;  3W9G A;  4F1P A;  5ENQ D;  5CEC B;  4QFV A;  3UTM A;  1BD8 A;  3LJN A;  3T9K A;  1BI8 B;  5CBO A;  1TR4 A; 
#chains in the Genus database with same CATH topology
 3X2Q E;  2YIN A;  4MLP A;  4YDY A;  2ILR A;  5KCM A;  1GW6 A;  1YCS B;  5ITZ F;  5CBN A;  1DCQ A;  2QC9 A;  1HU3 A;  3WXX A;  4BY6 A;  2H6F A;  3L82 A;  3L17 A;  3S7D A;  1N0Q A;  3AJI A;  3AS4 A;  4DK5 A;  3D3M A;  3AG2 E;  4U95 D;  4ANX A;  1E7U A;  3CVY A;  2LXL A;  3AG3 E;  1OCC E;  4TUM A;  3QAQ A;  3EIQ C;  4EPZ A;  2V4L A;  3CQC B;  3CSF A;  4DX2 A;  2J08 A;  3U66 A;  3GYZ A;  4M7C A;  2IF4 A;  4FP7 A;  4DRX E;  3G2W A;  3UKR G;  4AY6 A;  2DVW A;  2EIL E;  3TG5 A;  4K0R A;  3AS8 A;  3HVE A;  3CVV A;  4JB8 P;  3I4G A;  1K1B A;  4HNA D;  1N4S A;  3V2O A;  3BEE A;  5ENS D;  3LCA A;  3SFY A;  4G1T A;  1N9A A;  5FIN A;  1E96 B;  4A63 B;  1FT2 A;  1KT1 A;  2EIM E;  3RK6 A;  4GTO A;  3D9P A;  1U3C A;  4JA7 A;  2MYO A;  5AQA A;  1ELK A;  3FEY A;  3FTS A;  3CGH A;  1YMP A;  3ZPJ A;  5FQ6 A;  3ZEF A;  2DYR E;  4FJZ A;  4HI9 A;  5BXO A;  3IHY A;  4I6G A;  3PH0 C;  5EYL A;  2FO7 A;  3ULQ A;  3EHQ A;  5AAO A;  4U63 A;  1Q2Z A;  1OWN A;  3B7U X;  2UWJ G;  5ARF A;  3PDN A;  4JZY A;  5CBO A;  2IOS A;  3PNT B;  3CVP A;  4E85 A;  2DBA A;  2V8S E;  2KM4 A;  2MHK A;  1H2T C;  3BUA A;  2XCB A;  2NYJ A;  5ANL A;  5FT9 A;  4TV3 A;  2WXN A;  4OVV A;  3ML8 A;  1IKN D;  3Q49 B;  4N2Q A;  2XRZ A;  3SGH A;  1HH8 A;  4I1O B;  2XGS A;  4H7Y A;  4I43 A;  3SFX A;  5JA4 D;  2J8S D;  3T5X A;  1HFA A;  2MRI A;  1XGW A;  4APO A;  3MCX A;  4FLB A;  2L0T B;  2F0Y A;  3FTY A;  3T5V A;  2Y0B G;  2DIW A;  3I4R B;  4DPR A;  4G26 A;  1OT8 A;  4GYW A;  2WXJ A;  4C48 B;  3ABM E;  2XHE A;  2HR2 A;  3VLE A;  3CHS A;  3LYA A;  4CYM D;  4WND A;  3SNX A;  2LUH A;  1SZA A;  1A17 A;  4O1P A;  4HRM B;  1UJK A;  1MX6 A;  1OUV A;  2OOE A;  2F8X K;  3U3W A;  3LXU X;  4J8D A;  3I3N A;  4WWN A;  3ZYL A;  1SA4 A;  1TN8 A;  4WAF A;  4TXR A;  4ANU A;  4GZ5 A;  3LS8 A;  2I9C A;  2P9K G;  2ZGG A;  2Q7F A;  2LNI A;  3CVN A;  3TWW A;  1N4Q A;  3TWU A;  3ZXP A;  3NOC D;  3UKU G;  3RO3 A;  2FBN A;  4NAC A;  3NF1 A;  3V30 A;  3UM2 A;  4HQD A;  2R2L A;  3T8K A;  3MV3 B;  1DNP A;  3EU9 A;  2FF4 A;  3SZ7 A;  1H0A A;  4KYO B;  4U04 A;  3LKU A;  1LD8 A;  3JQ1 A;  3KAE A;  3C72 A;  4L9P A;  2CG2 A;  3FTV A;  3HXC A;  4JEH A;  3DEP A;  2R59 A;  3NB2 A;  4ME2 A;  3G2V A;  5BXU A;  1Z3Y A;  3FFL A;  2JLB A;  2PZI A;  3JXJ A;  3ASG A;  4BTB A;  4TRQ A;  4DLO A;  4JHJ A;  4HBD A;  2XZD G;  5FIO A;  1TJF A;  3PNL B;  1NZN A;  3CHR A;  2V5Q C;  3FU5 A;  3FU0 A;  4GTV A;  3LVQ E;  3L22 A;  1MQS A;  2RKK A;  4EHM A;  2IFU A;  1BD8 A;  4AY5 A;  5ARG A;  1KZP A;  5BV1 A;  2KZT A;  3JCK C;  4LSZ E;  2OND A;  4HRL A;  5ENT D;  1NFI E;  3EHM A;  5CRV A;  5JHB A;  1HE8 A;  5CED B;  2AXV A;  3NZU A;  2Y4T A;  3SY2 A;  4G8L A;  4UQX A;  1OCO E;  5EID A;  3CKB A;  3ZNG A;  3FU3 A;  4LNB A;  3PS6 A;  2R02 A;  1O1R A;  1O1T A;  3G2U A;  3FUE A;  2KC7 A;  2OV8 A;  4NRH B;  2LAH A;  5EN5 D;  1RW2 A;  4O1O A;  4YDE A;  2A4Z A;  2P58 C;  3ZFW A;  4LNU D;  2JAB A;  4GPM A;  3CEQ A;  3HXD A;  5CER B;  1FCH A;  4NQ0 A;  3DSX A;  3O48 A;  2YHC A;  4HOQ A;  1MX2 A;  3FUM A;  4EBA G;  4RLY A;  4GCN A;  3EHN A;  3N71 A;  1E7V A;  4IN3 B;  1Y8M A;  3KSL A;  2XPI A;  5A23 A;  3FTX A;  1ZU2 A;  3PEU B;  3QWP A;  4W9R A;  1TNY A;  4DX7 D;  1B89 A;  4MS6 A;  1E8Y A;  2VSO E;  5AYW D;  1QYM A;  4DUI A;  4AOF A;  1H6K A;  3L54 A;  2X38 A;  3CQG B;  5LP0 A;  3D9M A;  2DZN A;  4XI9 A;  1MYO A;  5AQB A;  3TWV A;  5BNW A;  3TJP A;  3MKQ B;  4UI9 K;  4A3T A;  1V55 E;  2VGE A;  3P2B A;  4PDX A;  3FWV A;  2ZU6 B;  1NI1 A;  3Q9N C;  3TAX A;  4EEC A;  3RJV A;  3RAU A;  1JWF A;  2XGM A;  4BSZ B;  3UM1 A;  3VTX A;  4GCO A;  2WQ7 A;  5BW8 C;  1X81 A;  2AWI A;  1MZC A;  3APC A;  2C2L A;  2PM6 A;  2WPV A;  2M63 A;  5ENP D;  4ATG A;  4K5B A;  5T3R A;  3CHM A;  4J8F A;  4A3V A;  2XPY A;  4UWG A;  2JEK A;  4ACL A;  2I1K A;  3VLF A;  2CG3 A;  2UY1 B;  3URZ A;  3E37 A;  1U2V G;  4HFG A;  3B13 A;  2WM9 A;  4BSX A;  4D10 C;  4UI9 J;  4CDM A;  2P9S G;  5G05 C;  4O60 A;  4KT6 B;  2QY7 A;  5JMN D;  4GPK A;  4HVB A;  5FZQ A;  3Q15 A;  5AN8 A;  4PUC A;  4BES A;  1ELW A;  4X8Q A;  4N5Q A;  1WG0 A;  3TGO A;  3PUJ A;  2XZT G;  3DBS A;  5HKP A;  5KJK A;  3CHP A;  4G11 A;  2XCC A;  2FI7 A;  3DSS A;  4U8Y D;  2L6J A;  2VJ8 A;  4LUN U;  4UWL A;  5AIJ A;  4B94 A;  5J90 A;  3ZYK A;  1IQU A;  3WG7 E;  1S63 A;  1NA0 A;  3CK9 A;  1OWL A;  5BUZ A;  2J9Q A;  4LNG A;  2YNQ A;  3Q47 B;  1K3Z D;  3DXK G;  1WAO 1;  3TXN A;  1TJC A;  2QYU A;  1YA0 A;  1HG5 A;  3BU8 A;  4GZ6 A;  5AEN A;  4U7E B;  3ASN E;  2KBX A;  5G2N A;  1OCZ E;  3HXB A;  2GW1 A;  3AU5 A;  1S70 B;  1JCS A;  1FVF A;  4PS7 A;  3MEK A;  5J08 A;  3IBE A;  2WMO A;  5FTP A;  1UN9 A;  4IUL A;  3AG4 E;  3ABK E;  5JJT A;  4KVM A;  5ANR A;  3AU4 A;  2YHE A;  3DPD A;  2XEH A;  3HXF A;  4UQZ A;  1X5B A;  3UTM A;  3LJN A;  1BI8 B;  1SZ9 A;  1TR4 A;  4RSY A;  4CRW A;  3FUK A;  4EQF A;  3S2A A;  4ATZ D;  3ZRH A;  3ZHE B;  3NZS A;  2NXP A;  4F53 A;  3CK8 A;  3AG1 E;  1QQE A;  4IRU A;  2R05 A;  4F6R D;  3TG4 A;  5AQ7 A;  1U3D A;  3MYV A;  4HS2 A;  2BKG A;  3FUD A;  1HS6 A;  2VQ2 A;  3BG1 B;  1SA5 A;  1D8D A;  2DCP A;  4CCA A;  4R7L A;  3UX4 A;  4GA0 A;  1O5M A;  2HO1 A;  5T4Y A;  3EHR A;  3ABL E;  1JCR A;  4JL0 A;  3BQO A;  2WXQ A;  1VDY A;  3U9W A;  5KJN A;  3R7R A;  3DWL G;  4PS8 A;  4GTQ A;  3FUI A;  2VTB A;  4J8E A;  3FUF A;  4AIF A;  3MJW A;  3AS5 A;  4F7A A;  3TWX A;  4TXP A;  4O6F A;  2KXP C;  1DC2 A;  4Y6C A;  4ZHB A;  4AXH A;  3D9N A;  3SHF A;  1H2V C;  3DPY A;  2CFZ A;  1DCE A;  1G3N B;  3G2S A;  4HOU A;  3APD A;  3NAW A;  3UPV A;  5CHE E;  4L2Y A;  5DBK A;  1PC2 A;  1N52 A;  1O1S A;  2CHW A;  1AWC B;  3HRA A;  3QJZ A;  3MKR A;  5AAR A;  1JUQ A;  2ETC A;  3LEW A;  2XEN A;  4HB5 A;  1K8K G;  3ZGQ A;  2DZO A;  2FEZ A;  4C9B B;  3MKQ A;  4ILG A;  4KMO A;  4KVO A;  3FHE A;  4G8K A;  4U0S A;  3Q73 A;  4DI3 A;  3RRN B;  3ONL A;  1XNF A;  4AM9 A;  2H6H A;  4FHJ A;  1TN7 A;  4ZFH A;  3PVL A;  4E6H A;  3ZW3 A;  4Q69 A;  4FC8 A;  2V4H C;  2KCK A;  4CGW A;  2WXL A;  4U07 A;  1DVP A;  4JW1 A;  1H19 A;  1QBQ A;  3DST A;  4Z68 A;  2R17 C;  3E34 A;  2DYS E;  5BT1 A;  3SBT B;  4LRZ A;  5B1A E;  4ILH B;  3PZ4 A;  3QK0 A;  3B95 A;  2EQX A;  4RG9 A;  2C0L A;  5KJL A;  1Z5S C;  3IV0 A;  5KWD A;  3QOU A;  2BTD A;  4I6J A;  4GA1 A;  5KNG A;  4UWF A;  3LY7 A;  5AJD A;  3D9K A;  4N3A A;  1ZBP A;  4K5A B;  2UY1 A;  1HO8 A;  1MJ0 A;  4MRU A;  3SI5 A;  1E8X A;  2OCC E;  4GZC A;  5KJM A;  4I1A A;  5ENQ D;  3MX3 A;  4APF A;  5FQ8 A;  4FHK A;  5AQ9 A;  3TWR A;  3IHV A;  2RFA A;  3ASD A;  3Q5M A;  2A5U A;  3QDN A;  4GZ3 A;  1BPO A;  2XEV A;  3HHM A;  3C3O A;  4HLE A;  4DLQ A;  2VSX E;  1Z3X A;  5KBA A;  3OXF A;  4I2W A;  4U8H A;  3JYS A;  5EX0 A;  1OCR E;  5H7P A;  2I2O A;  4N5C A;  3GZ1 A;  2WXM A;  4OVU A;  3FH5 A;  3ENE A;  3FTW A;  3R7Q A;  3B7S A;  4GML A;  3SBS A;  4GMR A;  3PZD A;  5HS0 A;  3V2X A;  3LDZ A;  2ZIS A;  2HM8 A;  3FTU A;  3ZVV A;  2EIN E;  2V0P A;  2IU1 A;  5ENR D;  1HG2 A;  4GMJ A;  3RKV A;  3CVU A;  2VTB B;  1SW6 A;  5FJY A;  2VSY A;  1LTX A;  3Q78 A;  3KSQ A;  2VYI A;  2ION A;  1D8E A;  2WXP A;  2PQN A;  5D66 A;  2HE0 A;  1L5J A;  3J5Q B;  1N4P A;  3TWS A;  1E8W A;  1PAQ A;  4GTP A;  3FEX A;  3UI2 A;  3ESL A;  3ASO E;  4HRN A;  3R9M A;  4F3V A;  2I6H A;  2XS1 A;  3NQP A;  3D9O A;  2A5E A;  3Q75 A;  2OEV A;  2GRM A;  3K9I A;  2WXG A;  4F1P A;  4J6I A;  3RIB A;  4Q96 A;  1OWO A;  3DSW A;  1TNZ A;  2GRO B;  2WXI A;  3Q9U C;  4QQI A;  4U8V D;  3IXE A;  2PQR A;  4KXK B;  4N2S A;  5JHA A;  3QB2 A;  3ONK A;  3S7J A;  3GW4 A;  4IYP A;  1LD7 A;  3L16 A;  3FU6 A;  3C3Q A;  5G04 C;  3SD5 A;  4J8Y A;  3ZHE A;  4B8A A;  4XIF A;  4HI8 A;  4GU5 A;  3HIZ A;  4GAA A;  2VSN A;  1BLX B;  3DRA A;  4OAV B;  4I2Z A;  5ENN A;  1N4R A;  3SF4 A;  2I1J A;  4JHK A;  1QNF A;  4B8C B;  3CR3 A;  4C0E A;  3C3R A;  3MZL B;  4JEU A;  2OEW A;  2P9U G;  2X6I A;  2IY0 C;  3OXG A;  4L23 A;  3FUJ A;  1P5Q A;  4AJW A;  5D2M C;  3E4B A;  5CRU A;  5DIZ A;  4OAU C;  5LCW C;  1D9S A;  4BER A;  5G05 J;  1TN6 A;  1N11 A;  4CEM A;  2P9P G;  5FQ4 A;  3LJ3 A;  1IHG A;  3IKO B;  3UT8 A;  4FJY A;  4CDR A;  1N94 A;  4CT0 A;  3HG0 D;  1PY1 A;  5C1D A;  4MKT A;  2ZIR A;  5JJ7 A;  2C0M A;  3D9L A;  5G55 A;  3UQ3 A;  4URK A;  4CGV A;  3EDT B;  4DX1 A;  2E2E A;  3FH7 A;  2P9N G;  1K1A A;  2GGF A;  5FQ7 A;  2WXF A;  4DX6 D;  1JCQ A;  4UWH A;  2KCV A;  2EIJ E;  3JUI A;  3ULY A;  3ZYM A;  3AAA C;  4XX5 A;  4ABN A;  5CEA A;  1H2U A;  4EZJ A;  3TWT A;  2F37 A;  3QWV A;  4I9E A;  1JPL A;  2XGO A;  3ZN3 A;  3FY4 A;  2H6I A;  2AXU A;  4F1S A;  4AEZ C;  3TXM A;  5EIB E;  4L7T A;  1ZB1 A;  2ETA A;  3PZ2 A;  3U64 A;  3PZ1 A;  4WWO A;  2Y3A A;  4G23 A;  1OY3 D;  3CVW A;  5HQ8 A;  2WQ6 A;  3SO8 A;  4FA6 A;  4CDN A;  2BF0 X;  4HLL A;  2ZGD A;  5A7D B;  2GRR B;  2QYJ A;  2LAI A;  2H6G A;  3JQ0 A;  4B89 A;  3C98 A;  2GRN B;  4HOS A;  4HOT A;  4JXT A;  4XEI G;  4K5C A;  4WUY A;  3FTZ A;  2RD0 A;  2J4B A;  3S7B A;  4TXQ A;  3NBN B;  5A6C A;  4LCT A;  2NSZ A;  4J0U A;  4AV7 A;  5FWQ A;  2F8Y A;  2EIK E;  4JA9 A;  2FO1 E;  2VGX B;  5FZR A;  4N39 A;  3FP3 A;  3E33 A;  2R03 A;  1WM5 A;  1SQM A;  3ASH A;  3PUK A;  4YDO A;  3QKY A;  2LXM A;  2AW6 A;  3HYM B;  2CHZ A;  4YDW A;  3B7B A;  5EDS A;  1E8Z A;  4KBQ A;  1BU9 A;  4GB9 A;  3KS2 A;  3JUE A;  3UXG A;  1KPS B;  3UIO C;  2IEJ A;  5T8I A;  4AVX A;  3U4T A;  1YYH A;  2X6J A;  4XKC A;  3ZUV B;  3LY8 A;  3VTY A;  2XRY A;  3D9J A;  4I17 A;  2WXK A;  2LSV A;  3F6Q A;  5E76 A;  2J07 A;  2P9L G;  4JPS A;  4I1M A;  5EIL A;  4BX9 A;  1S0P A;  2DWZ A;  4XZ4 A;  4HXI A;  3L9T A;  5C2Y A;  2AJA A;  3ML9 A;  3L6A A;  5BV0 A;  4A55 A;  3DSV A;  4G25 A;  3S7F A;  2GRP B;  3L08 A;  3HXE A;  3ZIM A;  3PE3 A;  1AP7 A;  3ASF A;  4GYO A;  4GTM A;  3GZS A;  3KEA A;  2BED A;  4OYS A;  3ESK A;  2HYZ A;  2R5S A;  1TNU A;  2IO3 C;  1FVH A;  4EBA A;  3QAR A;  3ZKJ A;  4EZK A;  4FLH A;  3CKC A;  3CHO A;  1H6P A;  2VGY A;  3T8M A;  1E90 A;  1Y6I A;  1UW4 B;  4L1B A;  3CLJ A;  4UQY A;  3PZ3 A;  3NOG D;  4RQI A;  3CST A;  4G24 A;  4GTT A;  3ULE G;  2WB2 A;  2GRQ B;  5D0Q D;  1OXJ A;  4PH4 B;  3UT4 A;  3G2T A;  4FAD A;  3EJN A;  3Q7A A;  3V31 A;  2J4D A;  3FUH A;  2Y4U A;  4I6E A;  3ZXS A;  4C0M A;  3UMV A;  1RZ4 A;  3CVL A;  1IXV A;  4HOR A;  3MV2 B;  5IY5 E;  4GYY A;  1ELR A;  4LER A;  3QC1 A;  3Q7F A;  2ZXW E;  3L13 A;  5CCL A;  3TL5 A;  1HX8 A;  4ANW A;  2NC9 A;  3CVX A;  2OVF A;  5HRY A;  4BTA A;  2L9B A;  3Q4A B;  4DI4 A;  4Y6W A;  3RO2 A;  4ACK A;  4BX8 A;  2X6K A;  1HZ4 A;  3UIP C;  3J5P A;  2WVI A;  3CV0 A;  3UUX A;  5B1B E;  5LOZ A;  3LVR E;  3EIJ A;  1EPU A;  3KD7 A;  4JD2 G;  3T9K A;  3UM3 A;  3MGB A;  3FUN A;  4MBG A;  2BKK B;  4H7X A;  4M3O A;  4JC8 A;  1TEZ A;  1OWM A;  1KLX A;  2XEE A;  3W9F A;  1V54 E;  2LO6 A;  1S64 A;  4RVB A;  4CT4 A;  3UIN C;  3ZU7 B;  1EF1 C;  4WNG A;  3HVE B;  2XS8 A;  1FPP A;  4ILI A;  2Y69 E;  3SQV A;  3RRU A;  2IQC A;  1N54 A;  4N3B A;  2V5F A;  2QFC A;  4LG6 A;  1A5E A;  2MOW A;  3C5R A;  2J09 A;  4BWR A;  3CVQ A;  3CHQ A;  3VLD A;  4U0U A;  5CMY A;  3UT7 A;  4YVO A;  1NL4 A;  4DX5 D;  5FZS A;  3P1U A;  2XPZ A;  4EZL A;  5EKQ D;  2IOL A;  3BG0 B;  3CK7 A;  3FDH A;  5KNH D;  2AXZ A;  1N95 A;  2OVB A;  2RFM A;  2QZA A;  3UM0 A;  2ETB A;  3E32 A;  3TWQ A;  4GTR A;  1UG3 A;  4ANV A;  4XE0 A;  2WQH A;  2RG8 A;  2KCL A;  3W9G A;  4QFV A;  2YQ8 A;  1LF8 A;  3FUL A;  5CMW A;  1TNO A;  2E0I A;  4I9C A;  3QNK A;  4AP2 A;  1EYH A;  5B3S E;  4A1S A;  2WMN A;  4U0Z A;  3SFZ A;  4WNF A;  2VGX A;  4GTS A;  1NP7 A;  2BUG A;  2XQ0 A;  1H6O A;  1W3B A;  4TUU A;  4YND A;  1BI7 B;  3CIA A;  5G04 J;  4BEP A;  3ISM C;  5LFA A;  4V3I A;  1UOH A;  1IYG A;  1HF8 A;  5JJ6 A;  4NIK A;  2KAT A;  2LSU A;  1FT1 A;  3I5P A;  4K03 A;  2WXO A;  4FUL A;  1KT0 A;  4WWP A;  4J8S A;  4WNE A;  3DXM G;  2X6H A;  3PRE A;  2WXH A;  4XI0 A;  3R9A B;  4A1G A;  4J7W A;  3B7T A;  2PNN A;  3IEG A;  4B93 B;  4DJA A;  5LX8 A;  1MX4 A;  5EX3 A;  4U96 D;  5AJL A;  5M72 A;  2L6B A;  5LCW J;  3RSE G;  4UUC A;  1UN8 A;  1Z6T A;  2PM7 A;  4P29 A;  4GA2 A;  2CHX A;  3KEZ A;  5HI7 A;  2J49 A;  1JWG A;  1SVX A;  3LPZ A;  2AVP A;  3RRM B;  1NA3 A;  3D9I A;  4RG6 A;  1IQR A;  5CEC B;  4FU3 A;  4JVS A;  4PS3 A;  3JXI A;  4BT8 A;  2P9I G;  4G2V A;  5ENO D;  3LY9 A;  1UJJ A;  3Q79 A;  4NUR A;  4YVQ C;  1HXI A;  1MHQ A;  2GRL A;  3GZ2 A;  2X6F A;  3ZYQ A;  5E75 A;  2B0O E;  2FUL A;  5EYP F;  3PE4 A;  2B6C A;  3DSU A;  4N3C A;  4XKB A;  3OAW A;  3RU0 A;  4BET A;  3O4Z A;  4KZC A;  4UWK A;  2L0I A;  3PEV B;  4GZD A;  1OWP A;  3APF A;  3FH8 A;  1EDU A;  3B7R L;  2WXR A;  2Y1L E;  4BFR A;  1INZ A;  4JHR A;  3QWW A;  3EU5 A;  2CFU A;  3DEO A;  1TNB A;  5BPP A;  2X3M A;  1TYQ G;  3D9H A;  3HDX A;  4L2L A;  5D0O D;  4Q94 A;  1WDY A;  3PRZ A;  2IO2 C;  2KZT B;  1WY6 A;  4KZ0 A;  4CZ2 D;  3MA5 A;  1N0R A;  4UI9 C;  1QZ2 A;  1KZO A;  2PL2 A;  2IJG X;  2P2C P;  4LEU A;  3OXL A;  3EUV A;  5CCM A;  3V79 K;  1IHB A;  3E30 A;  4BT9 A;  3OTN A;  4B0Z A; 
#chains in the Genus database with same CATH homology
 5AQ9 A;  2F8X K;  4BES A;  3JXI A;  2BKK B;  4YDY A;  4LSZ E;  4DX1 A;  3ZKJ A;  4HRL A;  1YCS B;  5ENO D;  5ENT D;  3TWR A;  4ATZ D;  1NFI E;  3Q9U C;  4QQI A;  2RFA A;  5ITZ F;  2VGE A;  5CBN A;  4YDW A;  1K1A A;  4N5Q A;  4U8V D;  5CED B;  2ETC A;  3B7B A;  3IXE A;  2XEN A;  4HB5 A;  4DX6 D;  1DCQ A;  1WG0 A;  2QC9 A;  1BU9 A;  3Q9N C;  2ZGG A;  2DZO A;  2XEE A;  4G8L A;  4F6R D;  3W9F A;  2XZT G;  5AQ7 A;  3NOG D;  3JUE A;  3UXG A;  5HKP A;  3TWW A;  2NYJ A;  5EID A;  5AAR A;  5KBA A;  1BI7 B;  3AAA C;  3TWU A;  4G8K A;  2B0O E;  5CEA A;  4BEP A;  3ZNG A;  1N0Q A;  3NOC D;  5EYP F;  4BSZ B;  3AJI A;  3TWT A;  2BKG A;  2F37 A;  4J8Y A;  3ZU7 B;  4U95 D;  1IKN D;  3V30 A;  1UOH A;  4U8Y D;  4TUM A;  5EN5 D;  4ZFH A;  1YYH A;  4BET A;  4HI8 A;  3ZUV B;  5EIB E;  4NIK A;  4HQD A;  3V31 A;  1BLX B;  2ETA A;  4GMR A;  3T8K A;  4DX2 A;  4O1O A;  5JA4 D;  2J8S D;  4OAV B;  5ENP D;  3EHR A;  5HS0 A;  3EU9 A;  4LG6 A;  1OY3 D;  3V2X A;  1A5E A;  2V4H C;  4DRX E;  4K5B A;  3SO8 A;  3C5R A;  4LNU D;  2JAB A;  3F6Q A;  2DVW A;  4GPM A;  4HLL A;  5ENR D;  1IXV A;  2Y1L E;  5CER B;  2Y0B G;  2ZGD A;  1K3Z D;  5EIL A;  4JB8 P;  1K1B A;  2DWZ A;  4HNA D;  3V2O A;  4Z68 A;  1SW6 A;  3TWX A;  2QYJ A;  5ENS D;  1MX2 A;  4J7W A;  3DEP A;  1DC2 A;  2KXP C;  1OT8 A;  2PNN A;  5FIN A;  5BXU A;  4B93 B;  4A63 B;  4RLY A;  3B95 A;  4C48 B;  4DX5 D;  3DEO A;  4ZHB A;  2AJA A;  1MX4 A;  3JXJ A;  5D66 A;  2KBX A;  2MYO A;  4U96 D;  5AQA A;  2HE0 A;  3D9H A;  5KWD A;  4HBD A;  2L6B A;  1S70 B;  2XZD G;  3J5Q B;  4K5C A;  1WDY A;  4UUC A;  5FIO A;  5HRY A;  4OAU C;  3TWS A;  1YMP A;  4DX7 D;  5KNG A;  1D9S A;  4BER A;  3UI2 A;  4CYM D;  5KNH D;  3NBN B;  4CZ2 D;  1N0R A;  2RFM A;  2V5Q C;  1N11 A;  2ETB A;  4HI9 A;  4HRN A;  4K5A B;  4O60 A;  1G3N B;  5BXO A;  1SVX A;  1AP7 A;  1QYM A;  4DUI A;  2F8Y A;  5EYL A;  3TWQ A;  3J5P A;  4O1P A;  3EHQ A;  5AAO A;  2A5E A;  2FO1 E;  4HRM B;  2P2C P;  5JMN D;  2DZN A;  1MJ0 A;  3KEA A;  1MYO A;  3HG0 D;  3V79 K;  5AN8 A;  1MX6 A;  5AQB A;  1AWC B;  3TWV A;  1IHB A;  3HRA A;  2XEH A;  3W9G A;  4F1P A;  5ENQ D;  5CEC B;  4QFV A;  3UTM A;  1BD8 A;  3LJN A;  3T9K A;  1BI8 B;  5CBO A;  1TR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...