2NYJA

Crystal structure of the ankyrin repeat domain of trpv1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
250
structure length
244
Chain Sequence
RLYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTKFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ankyrin Repeats of TRPV1 Bind Multiple Ligands and Modulate Channel Sensitivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords Transient receptor potential cation channel subfamily V memb
total genus 58
structure length 244
sequence length 250
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2nyjA00
3Q9UC 1IXVA 4F6RD 4QQIA 4N5QA 1MJ0A 1YMPA 4J8YA 2PNNA 4QFVA 4HRLA 5KNHD 3TWXA 3ZU7B 4Z68A 3AAAC 3NOCD 5ENRD 5EN5D 3ZNGA 1BD8A 5ENSD 4C48B 4HRMB 3W9FA 2DZOA 2XENA 1MX2A 1K1AA 4DUIA 2ETCA 1BI7B 4YDYA 5HKPA 2DZNA 4DX5D 5KBAA 2NYJA 1MYOA 3HRAA 2J8SD 5AQ9A 3D9HA 3F6QA 3B7BA 3KEAA 3NBNB 2KXPC 2ZGGA 3TWUA 4DX7D 1K1BA 3HG0D 5D66A 4HB5A 3T8KA 1MX6A 1SVXA 2A5EA 4G8LA 2XEHA 4HQDA 3UXGA 4BEPA 1OY3D 5BXUA 4ATZD 2L6BA 1WDYA 2XZTG 5BXOA 2DVWA 3V31A 3ZKJA 3B95A 3DEPA 1YCSB 4NIKA 4K5CA 5EILA 1IHBA 3TWTA 4YDWA 2B0OE 2V4HC 4GMRA 5HS0A 1WG0A 1N0RA 5EIBE 4HBDA 1A5EA 2V5QC 4LSZE 1BLXB 2FO1E 5CEDB 1AWCB 2ZGDA 4HI9A 5ENOD 2AJAA 5AQAA 2XEEA 4O1PA 2VGEA 3V2XA 4B93B 3Q9NC 1OT8A 4U95D 5ENPD 1BI8B 2ETBA 5AQBA 1G3NB 2Y0BG 3DEOA 4U96D 4BETA 2F37A 1D9SA 1NFIE 3JUEA 3NOGD 3TWRA 4F1PA 3V30A 3UI2A 4A63B 3UTMA 3TWWA 3EHQA 3EU9A 4CYMD 4ZFHA 5ENQD 3TWSA 1K3ZD 3J5PA 4HLLA 5AAOA 4UUCA 4OAUC 1UOHA 4LNUD 4DX1A 5CERB 2HE0A 3V2OA 1S70B 2F8YA 1BU9A 4U8VD 1DCQA 4TUMA 1AP7A 2P2CP 5JA4D 5EYPF 3LJNA 3TWVA 5CBNA 5CECB 3SO8A 5AARA 4BSZB 5AQ7A 3V79K 4GPMA 2BKKB 4K5AB 2Y1LE 5AN8A 1MX4A 3EHRA 1YYHA 1N0QA 2QC9A 2RFAA 2F8XK 4ZHBA 3T9KA 4DX2A 3TWQA 1IKND 4K5BA 2DWZA 2KBXA 4U8YD 4J7WA 3JXJA 3ZUVB 4BESA 4DRXE 3J5QB 4HI8A 5KNGA 1N11A 4HNAD 5CBOA 2QYJA 5ENTD 5ITZF 1SW6A 5KWDA 2XZDG 4LG6A 5FIOA 2MYOA 3AJIA 4DX6D 1QYMA 5HRYA 4OAVB 2BKGA 4JB8P 4BERA 4O1OA 5EYLA 2JABA 3C5RA 5FINA 3W9GA 5EIDA 3IXEA 3JXIA 2ETAA 4HRNA 1TR4A 4RLYA 5JMND 2RFMA 5CEAA 4O60A 4G8KA 1DC2A 4CZ2D
chains in the Genus database with same CATH superfamily
2VGXB 1TJFA 2R5SA 3NQPA 2YNQA 3MGBA 3ZNGA 3ZYLA 1BD8A 2KZTB 4C48B 3PDNA 1MX2A 4ILIA 5HKPA 2JLBA 4DX5D 2NYJA 2L0IA 4P29A 3CSFA 3KEAA 3NBNB 3CK7A 4YDEA 1FT2A 2IOSA 3KAEA 3ASGA 2XEVA 3FUDA 4ATZD 2LO6A 3C72A 4UWHA 3V31A 2XS1A 3MA5A 4NIKA 1B89A 3CVXA 1YA0A 3LEWA 5HS0A 1HXIA 2GGFA 1UN9A 3BEEA 5JHAA 2IJGX 4GTOA 3N71A 3FUKA 1D9SA 2X38A 4FLBA 3L6AA 1WM5A 3D9MA 3QB2A 5KCMA 2R17C 3QKYA 1E8YA 2C0MA 3G2VA 3UM1A 2H6GA 1UOHA 4GYWA 4MRUA 4TUMA 3AS4A 2AXVA 1V55E 4HOTA 4GTSA 3ASOE 5C2YA 3MV2B 1HU3A 4I17A 2C0LA 2EIJE 5KNGA 4FHKA 3R9AB 3CHOA 4JB8P 4BERA 3APFA 1LTXA 3SD5A 3ULQA 4GMLA 3Q7FA 1RZ4A 3QAQA 3CVLA 2LAHA 4KVMA 3FU5A 3NOCD 3SFXA 2DZOA 4DUIA 2QY7A 4FHJA 3R7RA 4FULA 4XKBA 4JC8A 3UKRG 4G24A 2ZISA 3HG0D 4WWOA 5B3SE 4GA1A 5BXOA 3G2TA 4FJYA 3ZPJA 2FEZA 4NURA 4HOQA 1LD8A 4GZCA 1HO8A 3Q4AB 4FLHA 2LSUA 4C0EA 3PVLA 4HBDA 1HH8A 2VSYA 4B93B 2XCBA 2MOWA 3ZVVA 5BUZA 4GCNA 4HLEA 3BG0B 2LXLA 3DRAA 4RG9A 2AW6A 3HIZA 4HLLA 2Y4UA 1Y6IA 1S70B 2WMOA 5JA4D 2L6JA 4FP7A 2IY0C 3CHSA 3LY8A 3E34A 3CIAA 5LX8A 3ABLE 4XEIG 3FUHA 3CVUA 3E30A 4AV7A 2XGSA 3PNTB 1IQRA 3LY9A 4RLYA 3HXBA 3PZ1A 5FQ6A 3BQOA 5G05J 3PZ2A 5KNHD 4HRLA 4J8EA 1S64A 2M63A 5ENSD 1NL4A 3WG7E 5E76A 2X6FA 3B7TA 1P5QA 2RKKA 2FO7A 5CMWA 2WMNA 1X81A 3DSUA 4HORA 2FF4A 2DCPA 2GRQB 3UXGA 2R59A 1O1RA 3CQGB 2XPZA 1UG3A 3D9IA 3ULEG 3ZKJA 4AY6A 2EINE 4JZYA 3JQ0A 2VGYA 3ZHEA 4J8SA 4O1PA 3V2XA 3CK8A 4LERA 1OT8A 2ZU6B 2XPYA 5D2MC 4YDOA 2F37A 2WB2A 3SY2A 2BF0X 1ELWA 4Y6WA 3GW4A 4BTBA 3EU5A 4JA7A 4TXQA 5LOZA 3ZRHA 3MKQB 1HE8A 4K03A 1DCQA 4GTMA 4FU3A 3FEYA 5EYPF 4APFA 5FJYA 4TUUA 3GZSA 3ML8A 3C98A 1XGWA 3L17A 3PZDA 3R7QA 3PUJA 2CG3A 1ZB1A 4ME2A 1N11A 2QYJA 3ASDA 3ABKE 1H2TC 3R9MA 2ONDA 5EX0A 1LD7A 3ZW3A 2RD0A 2PNNA 4H7XA 3QOUA 4WNFA 1O1SA 4B94A 2GRPB 3AG4E 3CEQA 1MQSA 4U0ZA 3ZIMA 2WXFA 4X8QA 1U3DA 4BT9A 4GZ3A 3I5PA 3VLFA 3FWVA 5A23A 5CRVA 2IO2C 4KT6B 1N4QA 1KPSB 4KBQA 2P9SG 5BXUA 2WXKA 2P9PG 4UWFA 2IU1A 3FTXA 4GMRA 5T8IA 2X6IA 2ILRA 4MS6A 2UY1B 2VYIA 4EQFA 1ELRA 3TGOA 2I9CA 2RG8A 5M72A 4GYYA 2NSZA 2CHWA 3ZEFA 3SFYA 3ZXPA 5LCWJ 3IV0A 3KD7A 4BETA 4F1PA 2FI7A 3T8MA 1H2UA 4NQ0A 3C3OA 3L16A 1N95A 5AQ7A 4K5AB 2H6HA 3D3MA 5KJNA 5AENA 3D9LA 4L2LA 3GZ2A 3ZUVB 4DRXE 4I9CA 4AXHA 1UJKA 1JCRA 3MEKA 4UWLA 4Y6CA 3T5VA 4O1OA 4N3AA 2WXRA 3JXIA 4JL0A 2WQ6A 4WNEA 2X6KA 4CZ2D 1IXVA 2J08A 1BPOA 3OTNA 3FUIA 4LNBA 3ULYA 3HXCA 5G2NA 4GAAA 5HI7A 1OWNA 1WAO1 4GZ6A 3CHPA 4JHKA 4L23A 4K0RA 4CRWA 3ZXSA 2J49A 1MX6A 1SVXA 3HXEA 4I1MA 3CLJA 3EHMA 4I6GA 4U07A 2J4DA 3SF4A 3ASHA 2ZGDA 4HI9A 4HVBA 4KZ0A 1BI8B 4DPRA 2NC9A 3FTVA 3FUJA 1HG2A 3PH0C 2I2OA 2I1JA 3FU3A 3TWWA 3UTMA 3QARA 3D9NA 2VQ2A 1OWMA 3D9OA 1N94A 3NAWA 3FFLA 4AY5A 2QFCA 5D0OD 5AARA 3CVVA 4YVQC 1O1TA 1XNFA 4A1SA 4N2QA 3U64A 5KJLA 3U9WA 4CGWA 4IRUA 4JHJA 2AVPA 4GYOA 4LG6A 3CVWA 4DI3A 3IXEA 3Q5MA 2P9KG 5CEAA 1N52A 1EYHA 1IQUA 2WPVA 5BW8C 2I1KA 3ZU7B 4Z68A 2JEKA 5ENRD 3FTWA 5KJKA 3VLDA 3U3WA 2DZNA 4U63A 3CVPA 2AWIA 3F6QA 2XHEA 4A3VA 4ILHB 2V8SE 2VSXE 2B6CA 3FH7A 3RKVA 3T8KA 2A5EA 1OY3D 1HZ4A 2PZIA 3VTYA 2GROB 3KS2A 4DLOA 3DXKG 3LVRE 1N4RA 1FVFA 4AOFA 2VGXA 4U8HA 3JUIA 3ZYMA 3S7BA 5EIBE 4B8AA 3U66A 3OAWA 5AQAA 1EF1C 1UN8A 3B7RL 3P1UA 3TWRA 3UI2A 5JJTA 2WXPA 1OCOE 4JVSA 5FWQA 4UUCA 5CERB 4R7LA 3KEZA 3SI5A 3V2OA 4GPKA 1TN7A 4W9RA 4I6JA 1SQMA 3DWLG 5AJDA 3EDTB 3TG5A 3V79K 4KXKB 3O4ZA 4I2ZA 3CVNA 2GRMA 4EPZA 4DX2A 3APDA 3L82A 2XGMA 3X2QE 1O5MA 4HNAD 2MYOA 5HRYA 1H0AA 5CRUA 2RFMA 4XE0A 4GB9A 1KT0A 1YMPA 5IY5E 4H7YA 1IYGA 3EIQC 4F7AA 3FU6A 4J8FA 3CHRA 2ETCA 3RJVA 2H6FA 3ESKA 3LY7A 4BWRA 2L9BA 1MYOA 4CDMA 4CGVA 2XCCA 5BNWA 1PY1A 3B13A 2VTBB 1N54A 5FZRA 4RG6A 5FQ7A 4E85A 1E90A 2C2LA 1E7VA 3RAUA 3PEUB 1OWOA 2UWJG 5ARGA 2PM6A 3UT4A 1D8EA 4L7TA 3IHYA 3JQ1A 3FUNA 3S7JA 4B8CB 4A55A 2KCKA 3TWSA 4IN3B 1K3ZD 1OXJA 3SFZA 3J5PA 2F0YA 4OAUC 4I1OB 2P2CP 1TNYA 4BT8A 2WXGA 4GZ5A 2WXHA 2XRZA 2OVBA 1TEZA 5FQ8A 3E32A 2GRRB 2P58C 4FA6A 4OVUA 3KSLA 3RO3A 2WXJA 2CHZA 2WXIA 1NA3A 1JWFA 3SNXA 3Q15A 2WQHA 3ONKA 2A4ZA 4L9PA 4J8YA 4J8DA 5CMYA 3AAAC 5FZQA 1FVHA 4BSXA 2VTBA 3QC1A 1BI7B 4M3OA 4ANVA 3SZ7A 2BUGA 4RVBA 3URZA 2LUHA 3TWUA 3G2SA 1HG5A 2OEWA 4G11A 3Q75A 2XZTG 2DIWA 3UPVA 4CEMA 2WXOA 3NB2A 1WG0A 2GW1A 4LSZE 4GTTA 4J6IA 4N2SA 3AS8A 2DYSE 3RSEG 4U95D 5ENPD 3QWVA 4GTQA 3DEOA 2L0TB 5BV0A 1H19A 5EX3A 2WVIA 4ACLA 3FHEA 4KZCA 5CECB 2FULA 2J07A 3ZFWA 1Z3XA 3JXJA 3T5XA 3NZUA 4BTAA 4TRQA 1VDYA 3LVQE 4CT0A 4HOUA 4M7CA 3MCXA 4KVOA 3AJIA 2UY1A 2XGOA 4BX8A 3S7FA 3E4BA 5FINA 2PQNA 3FH5A 2WXLA 4D10C 2IFUA 2J8SD 2LAIA 1HX8A 3FUMA 4O6FA 3UX4A 4DX7D 1K1BA 2XS8A 3D9JA 4I9EA 4HB5A 1OWLA 4XIFA 5ANLA 4RQIA 5BV1A 4EECA 2LXMA 3DEPA 1JCSA 1OCZE 4V3IA 2R02A 1N0RA 3PRZA 2V5QC 4IULA 3PE3A 2PQRA 3OXFA 1E8ZA 2KM4A 3AU4A 5G04J 5FT9A 3RU0A 1H6OA 5EDSA 4A63B 4PS8A 3DPYA 4GTPA 4DK5A 2HYZA 2V5FA 1NZNA 4JXTA 2WM9A 5LP0A 1AP7A 5DBKA 2H6IA 3IHVA 3SO8A 4GPMA 3ASNE 1TNZA 3L9TA 4UWGA 3EHRA 3RRUA 4GA2A 2GRNB 3TWQA 4U8YD 1KLXA 3DSTA 5CCLA 2BEDA 3LXUX 2KCVA 4JW1A 5CHEE 2Y4TA 2HM8A 2ETAA 2XQ0A 1KZPA 3BG1B 4F6RD 2DBAA 3QDNA 4MKTA 4FJZA 4HRMB 3W9FA 4AVXA 2P9LG 5HQ8A 1N4PA 4A3TA 4HXIA 1A17A 1OCCE 2ZGGA 3PEVB 4JD2G 2CHXA 2Q7FA 2EILE 3UMVA 2B0OE 5CEDB 3UM0A 3FTZA 2VGEA 3CVQA 2EIME 5JHBA 1QBQA 2ETBA 3FDHA 3JUEA 1OCRE 1SZAA 3EHQA 3SGHA 2YINA 2CFZA 3G2UA 4DI4A 4EZJA 3OXLA 3L13A 3ZGQA 3FTUA 4APOA 3RRMB 1LF8A 2VSOE 4BSZB 5KJMA 4NRHB 4AEZC 3WXXA 2J4BA 4ZHBA 5DIZA 3CQCB 3ESLA 4WAFA 2EQXA 2QYUA 2OOEA 4BESA 5FIOA 1TNUA 3LPZA 3DBSA 1RW2A 3LS8A 3EIJA 4TV3A 3CR3A 1MHQA 4G8KA 4YVOA 4ANXA 3SBTB 4OYSA 2WXNA 3HVEB 3TWXA 3Q49B 3GYZA 4JPSA 2OCCE 3Q79A 4JA9A 4ANUA 2VJ8A 3MKQA 3B7BA 2KXPC 3PREA 2KATA 3FY4A 4NACA 4CCAA 4AJWA 4MBGA 3AS5A 2V4HC 4YNDA 3TJPA 2LNIA 4XZ4A 4UQZA 4GU5A 4UWKA 4ABNA 4BY6A 3FP3A 2AJAA 3UKUG 2YHCA 3ASFA 4JEHA 4DJAA 4U96D 4Q96A 1H6PA 3NZSA 5ARFA 4F3VA 4CYMD 5ENQD 3ML9A 1Z5SC 4DX1A 2F8YA 3Q7AA 4U8VD 1SA4A 5B1AE 3AG2E 1L5JA 2IQCA 4PUCA 2AXUA 2F8XK 3UIPC 3DPDA 2X6HA 4K5BA 5AIJA 2V0PA 1SA5A 4U0UA 4XX5A 5ANRA 1QYMA 4LEUA 3CKBA 5EYLA 2MRIA 4BX9A 1EPUA 2P9IG 4N5CA 1U3CA 3RRNB 3DSVA 1FCHA 2CFUA 3RK6A 3LYAA 3QWWA 1HF8A 1NA0A 1HS6A 4I2WA 4N3CA 5D0QD 3I4RB 5KBAA 4KYOB 5J08A 4GMJA 4HQDA 4G8LA 2XEHA 4BEPA 2L6BA 1YCSB 3SBSA 3D9PA 5EILA 3TWTA 4GCOA 2X3MA 3IEGA 4UI9C 3UT8A 3TAXA 5C1DA 1FPPA 1DNPA 5LFAA 3CHQA 1OUVA 5AQBA 3UUXA 4I1AA 4U04A 4G26A 3UINC 4N3BA 2PM7A 3JCKC 4TXPA 5AAOA 4OVVA 3HHMA 2HE0A 4WWNA 3I3NA 4URKA 4EZLA 3LDZA 4WWPA 3QNKA 3OXGA 3UM2A 2BKKB 1Z6TA 2Y1LE 5AN8A 2QC9A 2P9UG 1E96B 3FULA 3FUFA 3E33A 4HFGA 5JJ7A 3ISMC 4EHMA 5FTPA 3U4TA 5J90A 4E6HA 5ENNA 4DX6D 3K9IA 4OAVB 3CSTA 1JPLA 3C5RA 4DLQA 5T4YA 3S7DA 5JMND 2BTDA 2V4LA 3PUKA 3AG3E 3HXDA 3RIBA 4G2VA 5A7DB 1KZOA 3ZYQA 3CKCA 3PZ3A 4Q94A 2XENA 3AG1E 3PZ4A 3O48A 3SQVA 3HRAA 5A6CA 2WXMA 1X5BA 3UT7A 5D66A 3LKUA 1TYQG 3L22A 1H2VC 4JHRA 1E7UA 2OV8A 3ONLA 4CDNA 1A5EA 1MZCA 5T3RA 2HR2A 3QK0A 3ENEA 3L08A 4G25A 4GTRA 3L54A 3TG4A 3TXMA 3S2AA 1G3NB 2Y0BG 4HS2A 1NFIE 4XI0A 3CGHA 1NI1A 3MV3B 2QZAA 1FT1A 2Y69E 2KCLA 3HYMB 3FTYA 1D8DA 4EBAA 1BU9A 2YHEA 2IEJA 3LJNA 5CCMA 1E8XA 3APCA 4ACKA 3E37A 1U2VG 3FU0A 3Q73A 3AU5A 3CK9A 2IONA 3MZLB 1TNOA 5ENTD 3ZN3A 5ITZF 2XPIA 4UI9K 2LSVA 3HXFA 2JABA 1TR4A 5EKQD 2KC7A 1JCQA 4N5QA 4PS3A 4ATGA 4N39A 1GW6A 2CG2A 3FUEA 3PE4A 1HFAA 1Y8MA 2EIKE 3JYSA 2NXPA 4MLPA 4EBAG 1S0PA 4WNGA 4FC8A 4ILGA 1WDYA 2J9QA 3GZ1A 3D9KA 2R05A 4U0SA 1AWCB 1SZ9A 2XEEA 4UQYA 3IBEA 2YQ8A 3KSQA 1V54E 3NOGD 1ZU2A 1W3BA 2MHKA 4RSYA 2P9NG 3G2WA 3MX3A 4EZKA 4JEUA 2OVFA 5H7PA 4L1BA 2DWZA 4BFRA 2I6HA 5G55A 3MKRA 5FQ4A 3DSWA 5CBOA 4L2YA 4AM9A 5KWDA 3IKOB 2XZDG 3HVEA 2IO3C 3BUAA 3EHNA 3W9GA 4LCTA 2IOLA 4TXRA 5E75A 4O60A 1DC2A 2IF4A 3Q9UC 4GTVA 3VTXA 3VLEA 3ZHEB 1E8WA 1MJ0A 3Q78A 1Z3YA 4QFVA 1NP7A 1TN6A 3FEXA 2PL2A 4XKCA 4C9BB 4YDYA 3HDXA 4KMOA 1QNFA 5AQ9A 3EUVA 2GRLA 4LRZA 3LJ3A 4PS7A 3PNLB 4LNGA 2DVWA 1S63A 1IHBA 1N9AA 2KZTA 4CT4A 4C0MA 3EJNA 1PAQA 1DVPA 2FO1E 1BLXB 4CDRA 5AJLA 5ENOD 4J0UA 1PC2A 3P2BA 4LUNU 3UQ3A 3C3QA 2VSNA 1EDUA 5AYWD 2J09A 5G04C 1ZBPA 3MJWA 1ELKA 4ZFHA 4I43A 4GZDA 4AIFA 4A1GA 2WQ7A 4LNUD 4PH4B 3CVYA 4Q69A 1QZ2A 2DYRE 3CHMA 1UW4B 1MX4A 4XI9A 4UI9J 2RFAA 2R2LA 3DSSA 3B7SA 3T9KA 1OWPA 2X6JA 2KBXA 4GA0A 3NF1A 2Y3AA 5JJ6A 4HI8A 3DXMG 1SW6A 2ZIRA 4IYPA 2BKGA 5EIDA 3TXNA 4HRNA 2FBNA 3DSXA 2R03A 2OEVA 1K8KG 3UM3A 4QQIA 5BT1A 3Q47B 4I6EA 1TJCA 5EN5D 1INZA 1K1AA 1Q2ZA 1KT1A 3ZYKA 4F1SA 2A5UA 3D9HA 3LCAA 1IHGA 5G05C 3MYVA 5FZSA 2E0IA 5B1BE 4UQXA 3B95A 3I4GA 4K5CA 4B89A 4YDWA 4ANWA 3QJZA 1N4SA 1WY6A 4AP2A 3PS6A 2AXZA 1TN8A 2WXQA 3Q9NC 4B0ZA 3SHFA 3RO2A 2E2EA 2ZXWE 3CV0A 4F53A 3QWPA 4HOSA 5LCWC 4WUYA 3V30A 3EU9A 4U7EB 4WNDA 1DCEA 4PDXA 4G1TA 3TL5A 2HO1A 3FH8A 2XRYA 3TWVA 1UJJA 5CBNA 1QQEA 1YYHA 1N0QA 3C3RA 1TNBA 3UIOC 1H6KA 3ABME 1IKND 3FTSA 4J7WA 3BU8A 3J5QB 4FADA 1JUQA 4G23A 1JWGA 5BPPA 3B7UX
chains in the Genus database with same CATH topology
3Q9UC 1IXVA 4F6RD 4QQIA 4N5QA 1MJ0A 1YMPA 4J8YA 2PNNA 4QFVA 4HRLA 5KNHD 3TWXA 3ZU7B 4Z68A 3AAAC 3NOCD 5ENRD 5EN5D 3ZNGA 1BD8A 5ENSD 4C48B 4HRMB 3W9FA 2DZOA 2XENA 1MX2A 1K1AA 4DUIA 2ETCA 1BI7B 4YDYA 5HKPA 2DZNA 4DX5D 5KBAA 2NYJA 1MYOA 3HRAA 2J8SD 5AQ9A 3D9HA 3F6QA 3B7BA 3KEAA 3NBNB 2KXPC 2ZGGA 3TWUA 4DX7D 1K1BA 3HG0D 5D66A 4HB5A 3T8KA 1MX6A 1SVXA 2A5EA 4G8LA 2XEHA 4HQDA 3UXGA 4BEPA 1OY3D 5BXUA 4ATZD 2L6BA 1WDYA 2XZTG 5BXOA 2DVWA 3V31A 3ZKJA 3B95A 3DEPA 1YCSB 4NIKA 4K5CA 5EILA 1IHBA 3TWTA 4YDWA 2B0OE 2V4HC 4GMRA 5HS0A 1WG0A 1N0RA 5EIBE 4HBDA 1A5EA 2V5QC 4LSZE 1BLXB 2FO1E 5CEDB 1AWCB 2ZGDA 4HI9A 5ENOD 2AJAA 5AQAA 2XEEA 4O1PA 2VGEA 3V2XA 4B93B 3Q9NC 1OT8A 4U95D 5ENPD 1BI8B 2ETBA 5AQBA 1G3NB 2Y0BG 3DEOA 4U96D 4BETA 2F37A 1D9SA 1NFIE 3JUEA 3NOGD 3TWRA 4F1PA 3V30A 3UI2A 4A63B 3UTMA 3TWWA 3EHQA 3EU9A 4CYMD 4ZFHA 5ENQD 3TWSA 1K3ZD 3J5PA 4HLLA 5AAOA 4UUCA 4OAUC 1UOHA 4LNUD 4DX1A 5CERB 2HE0A 3V2OA 1S70B 2F8YA 1BU9A 4U8VD 1DCQA 4TUMA 1AP7A 2P2CP 5JA4D 5EYPF 3LJNA 3TWVA 5CBNA 5CECB 3SO8A 5AARA 4BSZB 5AQ7A 3V79K 4GPMA 2BKKB 4K5AB 2Y1LE 5AN8A 1MX4A 3EHRA 1YYHA 1N0QA 2QC9A 2RFAA 2F8XK 4ZHBA 3T9KA 4DX2A 3TWQA 1IKND 4K5BA 2DWZA 2KBXA 4U8YD 4J7WA 3JXJA 3ZUVB 4BESA 4DRXE 3J5QB 4HI8A 5KNGA 1N11A 4HNAD 5CBOA 2QYJA 5ENTD 5ITZF 1SW6A 5KWDA 2XZDG 4LG6A 5FIOA 2MYOA 3AJIA 4DX6D 1QYMA 5HRYA 4OAVB 2BKGA 4JB8P 4BERA 4O1OA 5EYLA 2JABA 3C5RA 5FINA 3W9GA 5EIDA 3IXEA 3JXIA 2ETAA 4HRNA 1TR4A 4RLYA 5JMND 2RFMA 5CEAA 4O60A 4G8KA 1DC2A 4CZ2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q9U C;  1IXV A;  4F6R D;  4QQI A;  4N5Q A;  1MJ0 A;  1YMP A;  4J8Y A;  2PNN A;  4QFV A;  4HRL A;  5KNH D;  3TWX A;  3ZU7 B;  4Z68 A;  3AAA C;  3NOC D;  5ENR D;  5EN5 D;  3ZNG A;  1BD8 A;  5ENS D;  4C48 B;  4HRM B;  3W9F A;  2DZO A;  2XEN A;  1MX2 A;  1K1A A;  4DUI A;  2ETC A;  1BI7 B;  4YDY A;  5HKP A;  2DZN A;  4DX5 D;  5KBA A;  2NYJ A;  1MYO A;  3HRA A;  2J8S D;  5AQ9 A;  3D9H A;  3F6Q A;  3B7B A;  3KEA A;  3NBN B;  2KXP C;  2ZGG A;  3TWU A;  4DX7 D;  1K1B A;  3HG0 D;  5D66 A;  4HB5 A;  3T8K A;  1MX6 A;  1SVX A;  2A5E A;  4G8L A;  2XEH A;  4HQD A;  3UXG A;  4BEP A;  1OY3 D;  5BXU A;  4ATZ D;  2L6B A;  1WDY A;  2XZT G;  5BXO A;  2DVW A;  3V31 A;  3ZKJ A;  3B95 A;  3DEP A;  1YCS B;  4NIK A;  4K5C A;  5EIL A;  1IHB A;  3TWT A;  4YDW A;  2B0O E;  2V4H C;  4GMR A;  5HS0 A;  1WG0 A;  1N0R A;  5EIB E;  4HBD A;  1A5E A;  2V5Q C;  4LSZ E;  1BLX B;  2FO1 E;  5CED B;  1AWC B;  2ZGD A;  4HI9 A;  5ENO D;  2AJA A;  5AQA A;  2XEE A;  4O1P A;  2VGE A;  3V2X A;  4B93 B;  3Q9N C;  1OT8 A;  4U95 D;  5ENP D;  1BI8 B;  2ETB A;  5AQB A;  1G3N B;  2Y0B G;  3DEO A;  4U96 D;  4BET A;  2F37 A;  1D9S A;  1NFI E;  3JUE A;  3NOG D;  3TWR A;  4F1P A;  3V30 A;  3UI2 A;  4A63 B;  3UTM A;  3TWW A;  3EHQ A;  3EU9 A;  4CYM D;  4ZFH A;  5ENQ D;  3TWS A;  1K3Z D;  3J5P A;  4HLL A;  5AAO A;  4UUC A;  4OAU C;  1UOH A;  4LNU D;  4DX1 A;  5CER B;  2HE0 A;  3V2O A;  1S70 B;  2F8Y A;  1BU9 A;  4U8V D;  1DCQ A;  4TUM A;  1AP7 A;  2P2C P;  5JA4 D;  5EYP F;  3LJN A;  3TWV A;  5CBN A;  5CEC B;  3SO8 A;  5AAR A;  4BSZ B;  5AQ7 A;  3V79 K;  4GPM A;  2BKK B;  4K5A B;  2Y1L E;  5AN8 A;  1MX4 A;  3EHR A;  1YYH A;  1N0Q A;  2QC9 A;  2RFA A;  2F8X K;  4ZHB A;  3T9K A;  4DX2 A;  3TWQ A;  1IKN D;  4K5B A;  2DWZ A;  2KBX A;  4U8Y D;  4J7W A;  3JXJ A;  3ZUV B;  4BES A;  4DRX E;  3J5Q B;  4HI8 A;  5KNG A;  1N11 A;  4HNA D;  5CBO A;  2QYJ A;  5ENT D;  5ITZ F;  1SW6 A;  5KWD A;  2XZD G;  4LG6 A;  5FIO A;  2MYO A;  3AJI A;  4DX6 D;  1QYM A;  5HRY A;  4OAV B;  2BKG A;  4JB8 P;  4BER A;  4O1O A;  5EYL A;  2JAB A;  3C5R A;  5FIN A;  3W9G A;  5EID A;  3IXE A;  3JXI A;  2ETA A;  4HRN A;  1TR4 A;  4RLY A;  5JMN D;  2RFM A;  5CEA A;  4O60 A;  4G8K A;  1DC2 A;  4CZ2 D; 
#chains in the Genus database with same CATH topology
 2VGX B;  1TJF A;  2R5S A;  3NQP A;  2YNQ A;  3MGB A;  3ZNG A;  3ZYL A;  1BD8 A;  2KZT B;  4C48 B;  3PDN A;  1MX2 A;  4ILI A;  5HKP A;  2JLB A;  4DX5 D;  2NYJ A;  2L0I A;  4P29 A;  3CSF A;  3KEA A;  3NBN B;  3CK7 A;  4YDE A;  1FT2 A;  2IOS A;  3KAE A;  3ASG A;  2XEV A;  3FUD A;  4ATZ D;  2LO6 A;  3C72 A;  4UWH A;  3V31 A;  2XS1 A;  3MA5 A;  4NIK A;  1B89 A;  3CVX A;  1YA0 A;  3LEW A;  5HS0 A;  1HXI A;  2GGF A;  1UN9 A;  3BEE A;  5JHA A;  2IJG X;  4GTO A;  3N71 A;  3FUK A;  1D9S A;  2X38 A;  4FLB A;  3L6A A;  1WM5 A;  3D9M A;  3QB2 A;  5KCM A;  2R17 C;  3QKY A;  1E8Y A;  2C0M A;  3G2V A;  3UM1 A;  2H6G A;  1UOH A;  4GYW A;  4MRU A;  4TUM A;  3AS4 A;  2AXV A;  1V55 E;  4HOT A;  4GTS A;  3ASO E;  5C2Y A;  3MV2 B;  1HU3 A;  4I17 A;  2C0L A;  2EIJ E;  5KNG A;  4FHK A;  3R9A B;  3CHO A;  4JB8 P;  4BER A;  3APF A;  1LTX A;  3SD5 A;  3ULQ A;  4GML A;  3Q7F A;  1RZ4 A;  3QAQ A;  3CVL A;  2LAH A;  4KVM A;  3FU5 A;  3NOC D;  3SFX A;  2DZO A;  4DUI A;  2QY7 A;  4FHJ A;  3R7R A;  4FUL A;  4XKB A;  4JC8 A;  3UKR G;  4G24 A;  2ZIS A;  3HG0 D;  4WWO A;  5B3S E;  4GA1 A;  5BXO A;  3G2T A;  4FJY A;  3ZPJ A;  2FEZ A;  4NUR A;  4HOQ A;  1LD8 A;  4GZC A;  1HO8 A;  3Q4A B;  4FLH A;  2LSU A;  4C0E A;  3PVL A;  4HBD A;  1HH8 A;  2VSY A;  4B93 B;  2XCB A;  2MOW A;  3ZVV A;  5BUZ A;  4GCN A;  4HLE A;  3BG0 B;  2LXL A;  3DRA A;  4RG9 A;  2AW6 A;  3HIZ A;  4HLL A;  2Y4U A;  1Y6I A;  1S70 B;  2WMO A;  5JA4 D;  2L6J A;  4FP7 A;  2IY0 C;  3CHS A;  3LY8 A;  3E34 A;  3CIA A;  5LX8 A;  3ABL E;  4XEI G;  3FUH A;  3CVU A;  3E30 A;  4AV7 A;  2XGS A;  3PNT B;  1IQR A;  3LY9 A;  4RLY A;  3HXB A;  3PZ1 A;  5FQ6 A;  3BQO A;  5G05 J;  3PZ2 A;  5KNH D;  4HRL A;  4J8E A;  1S64 A;  2M63 A;  5ENS D;  1NL4 A;  3WG7 E;  5E76 A;  2X6F A;  3B7T A;  1P5Q A;  2RKK A;  2FO7 A;  5CMW A;  2WMN A;  1X81 A;  3DSU A;  4HOR A;  2FF4 A;  2DCP A;  2GRQ B;  3UXG A;  2R59 A;  1O1R A;  3CQG B;  2XPZ A;  1UG3 A;  3D9I A;  3ULE G;  3ZKJ A;  4AY6 A;  2EIN E;  4JZY A;  3JQ0 A;  2VGY A;  3ZHE A;  4J8S A;  4O1P A;  3V2X A;  3CK8 A;  4LER A;  1OT8 A;  2ZU6 B;  2XPY A;  5D2M C;  4YDO A;  2F37 A;  2WB2 A;  3SY2 A;  2BF0 X;  1ELW A;  4Y6W A;  3GW4 A;  4BTB A;  3EU5 A;  4JA7 A;  4TXQ A;  5LOZ A;  3ZRH A;  3MKQ B;  1HE8 A;  4K03 A;  1DCQ A;  4GTM A;  4FU3 A;  3FEY A;  5EYP F;  4APF A;  5FJY A;  4TUU A;  3GZS A;  3ML8 A;  3C98 A;  1XGW A;  3L17 A;  3PZD A;  3R7Q A;  3PUJ A;  2CG3 A;  1ZB1 A;  4ME2 A;  1N11 A;  2QYJ A;  3ASD A;  3ABK E;  1H2T C;  3R9M A;  2OND A;  5EX0 A;  1LD7 A;  3ZW3 A;  2RD0 A;  2PNN A;  4H7X A;  3QOU A;  4WNF A;  1O1S A;  4B94 A;  2GRP B;  3AG4 E;  3CEQ A;  1MQS A;  4U0Z A;  3ZIM A;  2WXF A;  4X8Q A;  1U3D A;  4BT9 A;  4GZ3 A;  3I5P A;  3VLF A;  3FWV A;  5A23 A;  5CRV A;  2IO2 C;  4KT6 B;  1N4Q A;  1KPS B;  4KBQ A;  2P9S G;  5BXU A;  2WXK A;  2P9P G;  4UWF A;  2IU1 A;  3FTX A;  4GMR A;  5T8I A;  2X6I A;  2ILR A;  4MS6 A;  2UY1 B;  2VYI A;  4EQF A;  1ELR A;  3TGO A;  2I9C A;  2RG8 A;  5M72 A;  4GYY A;  2NSZ A;  2CHW A;  3ZEF A;  3SFY A;  3ZXP A;  5LCW J;  3IV0 A;  3KD7 A;  4BET A;  4F1P A;  2FI7 A;  3T8M A;  1H2U A;  4NQ0 A;  3C3O A;  3L16 A;  1N95 A;  5AQ7 A;  4K5A B;  2H6H A;  3D3M A;  5KJN A;  5AEN A;  3D9L A;  4L2L A;  3GZ2 A;  3ZUV B;  4DRX E;  4I9C A;  4AXH A;  1UJK A;  1JCR A;  3MEK A;  4UWL A;  4Y6C A;  3T5V A;  4O1O A;  4N3A A;  2WXR A;  3JXI A;  4JL0 A;  2WQ6 A;  4WNE A;  2X6K A;  4CZ2 D;  1IXV A;  2J08 A;  1BPO A;  3OTN A;  3FUI A;  4LNB A;  3ULY A;  3HXC A;  5G2N A;  4GAA A;  5HI7 A;  1OWN A;  1WAO 1;  4GZ6 A;  3CHP A;  4JHK A;  4L23 A;  4K0R A;  4CRW A;  3ZXS A;  2J49 A;  1MX6 A;  1SVX A;  3HXE A;  4I1M A;  3CLJ A;  3EHM A;  4I6G A;  4U07 A;  2J4D A;  3SF4 A;  3ASH A;  2ZGD A;  4HI9 A;  4HVB A;  4KZ0 A;  1BI8 B;  4DPR A;  2NC9 A;  3FTV A;  3FUJ A;  1HG2 A;  3PH0 C;  2I2O A;  2I1J A;  3FU3 A;  3TWW A;  3UTM A;  3QAR A;  3D9N A;  2VQ2 A;  1OWM A;  3D9O A;  1N94 A;  3NAW A;  3FFL A;  4AY5 A;  2QFC A;  5D0O D;  5AAR A;  3CVV A;  4YVQ C;  1O1T A;  1XNF A;  4A1S A;  4N2Q A;  3U64 A;  5KJL A;  3U9W A;  4CGW A;  4IRU A;  4JHJ A;  2AVP A;  4GYO A;  4LG6 A;  3CVW A;  4DI3 A;  3IXE A;  3Q5M A;  2P9K G;  5CEA A;  1N52 A;  1EYH A;  1IQU A;  2WPV A;  5BW8 C;  2I1K A;  3ZU7 B;  4Z68 A;  2JEK A;  5ENR D;  3FTW A;  5KJK A;  3VLD A;  3U3W A;  2DZN A;  4U63 A;  3CVP A;  2AWI A;  3F6Q A;  2XHE A;  4A3V A;  4ILH B;  2V8S E;  2VSX E;  2B6C A;  3FH7 A;  3RKV A;  3T8K A;  2A5E A;  1OY3 D;  1HZ4 A;  2PZI A;  3VTY A;  2GRO B;  3KS2 A;  4DLO A;  3DXK G;  3LVR E;  1N4R A;  1FVF A;  4AOF A;  2VGX A;  4U8H A;  3JUI A;  3ZYM A;  3S7B A;  5EIB E;  4B8A A;  3U66 A;  3OAW A;  5AQA A;  1EF1 C;  1UN8 A;  3B7R L;  3P1U A;  3TWR A;  3UI2 A;  5JJT A;  2WXP A;  1OCO E;  4JVS A;  5FWQ A;  4UUC A;  5CER B;  4R7L A;  3KEZ A;  3SI5 A;  3V2O A;  4GPK A;  1TN7 A;  4W9R A;  4I6J A;  1SQM A;  3DWL G;  5AJD A;  3EDT B;  3TG5 A;  3V79 K;  4KXK B;  3O4Z A;  4I2Z A;  3CVN A;  2GRM A;  4EPZ A;  4DX2 A;  3APD A;  3L82 A;  2XGM A;  3X2Q E;  1O5M A;  4HNA D;  2MYO A;  5HRY A;  1H0A A;  5CRU A;  2RFM A;  4XE0 A;  4GB9 A;  1KT0 A;  1YMP A;  5IY5 E;  4H7Y A;  1IYG A;  3EIQ C;  4F7A A;  3FU6 A;  4J8F A;  3CHR A;  2ETC A;  3RJV A;  2H6F A;  3ESK A;  3LY7 A;  4BWR A;  2L9B A;  1MYO A;  4CDM A;  4CGV A;  2XCC A;  5BNW A;  1PY1 A;  3B13 A;  2VTB B;  1N54 A;  5FZR A;  4RG6 A;  5FQ7 A;  4E85 A;  1E90 A;  2C2L A;  1E7V A;  3RAU A;  3PEU B;  1OWO A;  2UWJ G;  5ARG A;  2PM6 A;  3UT4 A;  1D8E A;  4L7T A;  3IHY A;  3JQ1 A;  3FUN A;  3S7J A;  4B8C B;  4A55 A;  2KCK A;  3TWS A;  4IN3 B;  1K3Z D;  1OXJ A;  3SFZ A;  3J5P A;  2F0Y A;  4OAU C;  4I1O B;  2P2C P;  1TNY A;  4BT8 A;  2WXG A;  4GZ5 A;  2WXH A;  2XRZ A;  2OVB A;  1TEZ A;  5FQ8 A;  3E32 A;  2GRR B;  2P58 C;  4FA6 A;  4OVU A;  3KSL A;  3RO3 A;  2WXJ A;  2CHZ A;  2WXI A;  1NA3 A;  1JWF A;  3SNX A;  3Q15 A;  2WQH A;  3ONK A;  2A4Z A;  4L9P A;  4J8Y A;  4J8D A;  5CMY A;  3AAA C;  5FZQ A;  1FVH A;  4BSX A;  2VTB A;  3QC1 A;  1BI7 B;  4M3O A;  4ANV A;  3SZ7 A;  2BUG A;  4RVB A;  3URZ A;  2LUH A;  3TWU A;  3G2S A;  1HG5 A;  2OEW A;  4G11 A;  3Q75 A;  2XZT G;  2DIW A;  3UPV A;  4CEM A;  2WXO A;  3NB2 A;  1WG0 A;  2GW1 A;  4LSZ E;  4GTT A;  4J6I A;  4N2S A;  3AS8 A;  2DYS E;  3RSE G;  4U95 D;  5ENP D;  3QWV A;  4GTQ A;  3DEO A;  2L0T B;  5BV0 A;  1H19 A;  5EX3 A;  2WVI A;  4ACL A;  3FHE A;  4KZC A;  5CEC B;  2FUL A;  2J07 A;  3ZFW A;  1Z3X A;  3JXJ A;  3T5X A;  3NZU A;  4BTA A;  4TRQ A;  1VDY A;  3LVQ E;  4CT0 A;  4HOU A;  4M7C A;  3MCX A;  4KVO A;  3AJI A;  2UY1 A;  2XGO A;  4BX8 A;  3S7F A;  3E4B A;  5FIN A;  2PQN A;  3FH5 A;  2WXL A;  4D10 C;  2IFU A;  2J8S D;  2LAI A;  1HX8 A;  3FUM A;  4O6F A;  3UX4 A;  4DX7 D;  1K1B A;  2XS8 A;  3D9J A;  4I9E A;  4HB5 A;  1OWL A;  4XIF A;  5ANL A;  4RQI A;  5BV1 A;  4EEC A;  2LXM A;  3DEP A;  1JCS A;  1OCZ E;  4V3I A;  2R02 A;  1N0R A;  3PRZ A;  2V5Q C;  4IUL A;  3PE3 A;  2PQR A;  3OXF A;  1E8Z A;  2KM4 A;  3AU4 A;  5G04 J;  5FT9 A;  3RU0 A;  1H6O A;  5EDS A;  4A63 B;  4PS8 A;  3DPY A;  4GTP A;  4DK5 A;  2HYZ A;  2V5F A;  1NZN A;  4JXT A;  2WM9 A;  5LP0 A;  1AP7 A;  5DBK A;  2H6I A;  3IHV A;  3SO8 A;  4GPM A;  3ASN E;  1TNZ A;  3L9T A;  4UWG A;  3EHR A;  3RRU A;  4GA2 A;  2GRN B;  3TWQ A;  4U8Y D;  1KLX A;  3DST A;  5CCL A;  2BED A;  3LXU X;  2KCV A;  4JW1 A;  5CHE E;  2Y4T A;  2HM8 A;  2ETA A;  2XQ0 A;  1KZP A;  3BG1 B;  4F6R D;  2DBA A;  3QDN A;  4MKT A;  4FJZ A;  4HRM B;  3W9F A;  4AVX A;  2P9L G;  5HQ8 A;  1N4P A;  4A3T A;  4HXI A;  1A17 A;  1OCC E;  2ZGG A;  3PEV B;  4JD2 G;  2CHX A;  2Q7F A;  2EIL E;  3UMV A;  2B0O E;  5CED B;  3UM0 A;  3FTZ A;  2VGE A;  3CVQ A;  2EIM E;  5JHB A;  1QBQ A;  2ETB A;  3FDH A;  3JUE A;  1OCR E;  1SZA A;  3EHQ A;  3SGH A;  2YIN A;  2CFZ A;  3G2U A;  4DI4 A;  4EZJ A;  3OXL A;  3L13 A;  3ZGQ A;  3FTU A;  4APO A;  3RRM B;  1LF8 A;  2VSO E;  4BSZ B;  5KJM A;  4NRH B;  4AEZ C;  3WXX A;  2J4B A;  4ZHB A;  5DIZ A;  3CQC B;  3ESL A;  4WAF A;  2EQX A;  2QYU A;  2OOE A;  4BES A;  5FIO A;  1TNU A;  3LPZ A;  3DBS A;  1RW2 A;  3LS8 A;  3EIJ A;  4TV3 A;  3CR3 A;  1MHQ A;  4G8K A;  4YVO A;  4ANX A;  3SBT B;  4OYS A;  2WXN A;  3HVE B;  3TWX A;  3Q49 B;  3GYZ A;  4JPS A;  2OCC E;  3Q79 A;  4JA9 A;  4ANU A;  2VJ8 A;  3MKQ A;  3B7B A;  2KXP C;  3PRE A;  2KAT A;  3FY4 A;  4NAC A;  4CCA A;  4AJW A;  4MBG A;  3AS5 A;  2V4H C;  4YND A;  3TJP A;  2LNI A;  4XZ4 A;  4UQZ A;  4GU5 A;  4UWK A;  4ABN A;  4BY6 A;  3FP3 A;  2AJA A;  3UKU G;  2YHC A;  3ASF A;  4JEH A;  4DJA A;  4U96 D;  4Q96 A;  1H6P A;  3NZS A;  5ARF A;  4F3V A;  4CYM D;  5ENQ D;  3ML9 A;  1Z5S C;  4DX1 A;  2F8Y A;  3Q7A A;  4U8V D;  1SA4 A;  5B1A E;  3AG2 E;  1L5J A;  2IQC A;  4PUC A;  2AXU A;  2F8X K;  3UIP C;  3DPD A;  2X6H A;  4K5B A;  5AIJ A;  2V0P A;  1SA5 A;  4U0U A;  4XX5 A;  5ANR A;  1QYM A;  4LEU A;  3CKB A;  5EYL A;  2MRI A;  4BX9 A;  1EPU A;  2P9I G;  4N5C A;  1U3C A;  3RRN B;  3DSV A;  1FCH A;  2CFU A;  3RK6 A;  3LYA A;  3QWW A;  1HF8 A;  1NA0 A;  1HS6 A;  4I2W A;  4N3C A;  5D0Q D;  3I4R B;  5KBA A;  4KYO B;  5J08 A;  4GMJ A;  4HQD A;  4G8L A;  2XEH A;  4BEP A;  2L6B A;  1YCS B;  3SBS A;  3D9P A;  5EIL A;  3TWT A;  4GCO A;  2X3M A;  3IEG A;  4UI9 C;  3UT8 A;  3TAX A;  5C1D A;  1FPP A;  1DNP A;  5LFA A;  3CHQ A;  1OUV A;  5AQB A;  3UUX A;  4I1A A;  4U04 A;  4G26 A;  3UIN C;  4N3B A;  2PM7 A;  3JCK C;  4TXP A;  5AAO A;  4OVV A;  3HHM A;  2HE0 A;  4WWN A;  3I3N A;  4URK A;  4EZL A;  3LDZ A;  4WWP A;  3QNK A;  3OXG A;  3UM2 A;  2BKK B;  1Z6T A;  2Y1L E;  5AN8 A;  2QC9 A;  2P9U G;  1E96 B;  3FUL A;  3FUF A;  3E33 A;  4HFG A;  5JJ7 A;  3ISM C;  4EHM A;  5FTP A;  3U4T A;  5J90 A;  4E6H A;  5ENN A;  4DX6 D;  3K9I A;  4OAV B;  3CST A;  1JPL A;  3C5R A;  4DLQ A;  5T4Y A;  3S7D A;  5JMN D;  2BTD A;  2V4L A;  3PUK A;  3AG3 E;  3HXD A;  3RIB A;  4G2V A;  5A7D B;  1KZO A;  3ZYQ A;  3CKC A;  3PZ3 A;  4Q94 A;  2XEN A;  3AG1 E;  3PZ4 A;  3O48 A;  3SQV A;  3HRA A;  5A6C A;  2WXM A;  1X5B A;  3UT7 A;  5D66 A;  3LKU A;  1TYQ G;  3L22 A;  1H2V C;  4JHR A;  1E7U A;  2OV8 A;  3ONL A;  4CDN A;  1A5E A;  1MZC A;  5T3R A;  2HR2 A;  3QK0 A;  3ENE A;  3L08 A;  4G25 A;  4GTR A;  3L54 A;  3TG4 A;  3TXM A;  3S2A A;  1G3N B;  2Y0B G;  4HS2 A;  1NFI E;  4XI0 A;  3CGH A;  1NI1 A;  3MV3 B;  2QZA A;  1FT1 A;  2Y69 E;  2KCL A;  3HYM B;  3FTY A;  1D8D A;  4EBA A;  1BU9 A;  2YHE A;  2IEJ A;  3LJN A;  5CCM A;  1E8X A;  3APC A;  4ACK A;  3E37 A;  1U2V G;  3FU0 A;  3Q73 A;  3AU5 A;  3CK9 A;  2ION A;  3MZL B;  1TNO A;  5ENT D;  3ZN3 A;  5ITZ F;  2XPI A;  4UI9 K;  2LSV A;  3HXF A;  2JAB A;  1TR4 A;  5EKQ D;  2KC7 A;  1JCQ A;  4N5Q A;  4PS3 A;  4ATG A;  4N39 A;  1GW6 A;  2CG2 A;  3FUE A;  3PE4 A;  1HFA A;  1Y8M A;  2EIK E;  3JYS A;  2NXP A;  4MLP A;  4EBA G;  1S0P A;  4WNG A;  4FC8 A;  4ILG A;  1WDY A;  2J9Q A;  3GZ1 A;  3D9K A;  2R05 A;  4U0S A;  1AWC B;  1SZ9 A;  2XEE A;  4UQY A;  3IBE A;  2YQ8 A;  3KSQ A;  1V54 E;  3NOG D;  1ZU2 A;  1W3B A;  2MHK A;  4RSY A;  2P9N G;  3G2W A;  3MX3 A;  4EZK A;  4JEU A;  2OVF A;  5H7P A;  4L1B A;  2DWZ A;  4BFR A;  2I6H A;  5G55 A;  3MKR A;  5FQ4 A;  3DSW A;  5CBO A;  4L2Y A;  4AM9 A;  5KWD A;  3IKO B;  2XZD G;  3HVE A;  2IO3 C;  3BUA A;  3EHN A;  3W9G A;  4LCT A;  2IOL A;  4TXR A;  5E75 A;  4O60 A;  1DC2 A;  2IF4 A;  3Q9U C;  4GTV A;  3VTX A;  3VLE A;  3ZHE B;  1E8W A;  1MJ0 A;  3Q78 A;  1Z3Y A;  4QFV A;  1NP7 A;  1TN6 A;  3FEX A;  2PL2 A;  4XKC A;  4C9B B;  4YDY A;  3HDX A;  4KMO A;  1QNF A;  5AQ9 A;  3EUV A;  2GRL A;  4LRZ A;  3LJ3 A;  4PS7 A;  3PNL B;  4LNG A;  2DVW A;  1S63 A;  1IHB A;  1N9A A;  2KZT A;  4CT4 A;  4C0M A;  3EJN A;  1PAQ A;  1DVP A;  2FO1 E;  1BLX B;  4CDR A;  5AJL A;  5ENO D;  4J0U A;  1PC2 A;  3P2B A;  4LUN U;  3UQ3 A;  3C3Q A;  2VSN A;  1EDU A;  5AYW D;  2J09 A;  5G04 C;  1ZBP A;  3MJW A;  1ELK A;  4ZFH A;  4I43 A;  4GZD A;  4AIF A;  4A1G A;  2WQ7 A;  4LNU D;  4PH4 B;  3CVY A;  4Q69 A;  1QZ2 A;  2DYR E;  3CHM A;  1UW4 B;  1MX4 A;  4XI9 A;  4UI9 J;  2RFA A;  2R2L A;  3DSS A;  3B7S A;  3T9K A;  1OWP A;  2X6J A;  2KBX A;  4GA0 A;  3NF1 A;  2Y3A A;  5JJ6 A;  4HI8 A;  3DXM G;  1SW6 A;  2ZIR A;  4IYP A;  2BKG A;  5EID A;  3TXN A;  4HRN A;  2FBN A;  3DSX A;  2R03 A;  2OEV A;  1K8K G;  3UM3 A;  4QQI A;  5BT1 A;  3Q47 B;  4I6E A;  1TJC A;  5EN5 D;  1INZ A;  1K1A A;  1Q2Z A;  1KT1 A;  3ZYK A;  4F1S A;  2A5U A;  3D9H A;  3LCA A;  1IHG A;  5G05 C;  3MYV A;  5FZS A;  2E0I A;  5B1B E;  4UQX A;  3B95 A;  3I4G A;  4K5C A;  4B89 A;  4YDW A;  4ANW A;  3QJZ A;  1N4S A;  1WY6 A;  4AP2 A;  3PS6 A;  2AXZ A;  1TN8 A;  2WXQ A;  3Q9N C;  4B0Z A;  3SHF A;  3RO2 A;  2E2E A;  2ZXW E;  3CV0 A;  4F53 A;  3QWP A;  4HOS A;  5LCW C;  4WUY A;  3V30 A;  3EU9 A;  4U7E B;  4WND A;  1DCE A;  4PDX A;  4G1T A;  3TL5 A;  2HO1 A;  3FH8 A;  2XRY A;  3TWV A;  1UJJ A;  5CBN A;  1QQE A;  1YYH A;  1N0Q A;  3C3R A;  1TNB A;  3UIO C;  1H6K A;  3ABM E;  1IKN D;  3FTS A;  4J7W A;  3BU8 A;  3J5Q B;  4FAD A;  1JUQ A;  4G23 A;  1JWG A;  5BPP A;  3B7U X; 
#chains in the Genus database with same CATH homology
 3Q9U C;  1IXV A;  4F6R D;  4QQI A;  4N5Q A;  1MJ0 A;  1YMP A;  4J8Y A;  2PNN A;  4QFV A;  4HRL A;  5KNH D;  3TWX A;  3ZU7 B;  4Z68 A;  3AAA C;  3NOC D;  5ENR D;  5EN5 D;  3ZNG A;  1BD8 A;  5ENS D;  4C48 B;  4HRM B;  3W9F A;  2DZO A;  2XEN A;  1MX2 A;  1K1A A;  4DUI A;  2ETC A;  1BI7 B;  4YDY A;  5HKP A;  2DZN A;  4DX5 D;  5KBA A;  2NYJ A;  1MYO A;  3HRA A;  2J8S D;  5AQ9 A;  3D9H A;  3F6Q A;  3B7B A;  3KEA A;  3NBN B;  2KXP C;  2ZGG A;  3TWU A;  4DX7 D;  1K1B A;  3HG0 D;  5D66 A;  4HB5 A;  3T8K A;  1MX6 A;  1SVX A;  2A5E A;  4G8L A;  2XEH A;  4HQD A;  3UXG A;  4BEP A;  1OY3 D;  5BXU A;  4ATZ D;  2L6B A;  1WDY A;  2XZT G;  5BXO A;  2DVW A;  3V31 A;  3ZKJ A;  3B95 A;  3DEP A;  1YCS B;  4NIK A;  4K5C A;  5EIL A;  1IHB A;  3TWT A;  4YDW A;  2B0O E;  2V4H C;  4GMR A;  5HS0 A;  1WG0 A;  1N0R A;  5EIB E;  4HBD A;  1A5E A;  2V5Q C;  4LSZ E;  1BLX B;  2FO1 E;  5CED B;  1AWC B;  2ZGD A;  4HI9 A;  5ENO D;  2AJA A;  5AQA A;  2XEE A;  4O1P A;  2VGE A;  3V2X A;  4B93 B;  3Q9N C;  1OT8 A;  4U95 D;  5ENP D;  1BI8 B;  2ETB A;  5AQB A;  1G3N B;  2Y0B G;  3DEO A;  4U96 D;  4BET A;  2F37 A;  1D9S A;  1NFI E;  3JUE A;  3NOG D;  3TWR A;  4F1P A;  3V30 A;  3UI2 A;  4A63 B;  3UTM A;  3TWW A;  3EHQ A;  3EU9 A;  4CYM D;  4ZFH A;  5ENQ D;  3TWS A;  1K3Z D;  3J5P A;  4HLL A;  5AAO A;  4UUC A;  4OAU C;  1UOH A;  4LNU D;  4DX1 A;  5CER B;  2HE0 A;  3V2O A;  1S70 B;  2F8Y A;  1BU9 A;  4U8V D;  1DCQ A;  4TUM A;  1AP7 A;  2P2C P;  5JA4 D;  5EYP F;  3LJN A;  3TWV A;  5CBN A;  5CEC B;  3SO8 A;  5AAR A;  4BSZ B;  5AQ7 A;  3V79 K;  4GPM A;  2BKK B;  4K5A B;  2Y1L E;  5AN8 A;  1MX4 A;  3EHR A;  1YYH A;  1N0Q A;  2QC9 A;  2RFA A;  2F8X K;  4ZHB A;  3T9K A;  4DX2 A;  3TWQ A;  1IKN D;  4K5B A;  2DWZ A;  2KBX A;  4U8Y D;  4J7W A;  3JXJ A;  3ZUV B;  4BES A;  4DRX E;  3J5Q B;  4HI8 A;  5KNG A;  1N11 A;  4HNA D;  5CBO A;  2QYJ A;  5ENT D;  5ITZ F;  1SW6 A;  5KWD A;  2XZD G;  4LG6 A;  5FIO A;  2MYO A;  3AJI A;  4DX6 D;  1QYM A;  5HRY A;  4OAV B;  2BKG A;  4JB8 P;  4BER A;  4O1O A;  5EYL A;  2JAB A;  3C5R A;  5FIN A;  3W9G A;  5EID A;  3IXE A;  3JXI A;  2ETA A;  4HRN A;  1TR4 A;  4RLY A;  5JMN D;  2RFM A;  5CEA A;  4O60 A;  4G8K A;  1DC2 A;  4CZ2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...