2NYLC

Crystal structure of protein phosphatase 2a (pp2a) holoenzyme with the catalytic subunit carboxyl terminus truncated
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
293
structure length
293
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Protein Phosphatase 2A Holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Protein phosphatase 2, regulatory subunit A (PR 65), alpha i
total genus 91
structure length 293
sequence length 293
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nylC00
3IVDA 4H2FA 1IT6A 4H2BA 3EGGA 4JA9A 4O24A 3ZTVA 3H60A 4ORBA 4I5NC 2BCDA 4JA7A 4ORCA 3KBPA 2XMOA 4HD0A 5DNYA 5INBA 3V4YA 1S95A 4O43A 4J6OA 2WDCA 1UF3A 2WDFA 1Z2XA 4UT3A 3HVQA 2IAEC 4B2OA 1WARA 4DT2A 3H68A 4ZVZA 4IYPC 4YKEA 3N5UA 3QG5C 3QFNA 1OI8A 2YVTA 1NNWA 1UTEA 4H2GA 4FBKA 4UT2A 5IOHA 3DSCA 3P71C 3THNA 5J28A 1USHA 2HY1A 2AHDA 4H1SA 3E7AA 3IB7A 3IB8A 2QFRA 3C5WC 3GVEA 1FJMA 2Z72A 2HYOA 3CK2A 1JK7A 4O5GA 4TUIA 1S8EA 3H69A 3H67A 3PSNA 5B8IA 3K7VC 3PSOA 2R17A 5JJTA 1II7A 3H62B 1S3NA 3TGHA 3IVEA 4NZVA 1AUIA 3RL4A 5F3WA 3C9FA 2NYLC 3RQZA 2P6BA 2WDDA 1U32A 4M0VA 2QFPA 4LTYA 4FBWA 2USHA 4V0VA 3H64A 4LU9A 5C1VA 4DSYA 5EQVA 4V0WA 4XPNA 1S3MA 4MOYA 5JPEA 2KKNA 1OIEA 1T71A 5GTUA 4ORAA 2GJUA 2WDEA 4H1YP 4LACC 1V73A 2ZBMA 4OR9A 3H61A 2O8AA 4IL1A 1HP1A 1QFCA 1Z2WA 1HO5A 2HYPA 3JYFA 1XM7A 2BDXA 1G5BA 3AUZA 4V0XA 4DHLA 4UT3B 1T70A 2Z1AA 2A22A 2BQ8X 3RL3A 2QJCA 1S3LA 1MF8A 1S70A 3EGHA 3H66A 3ICFA 4O4KA 2IE4C 1QHWA 1W24A 4MP0A 3RL5A 1TCOA 2O8GA 2JOGA 1KBPA 3AV0A 2CV9A 2IE3C 1HPUA 1WAO1 4I5LC 3ZU0A 3FGAC 4ZX2A 5HPEA 5JPFA 3THOB 3LL8A 1OIDA 2Q8UA 3K7WC 4FCXA 2NXFA 4G9JA 4F0ZA 1SU1A 3QFMA 3T1IA 4UWQA 4KBPA 4MOVA 1M63A 1XZWA 2DFJA 4Q7FA 4WWLA 4FBQA 3DSDA 3QFOA 2NYMC 4TUGA 4H2IA 3QFKA 4KKZA 3DW8C 2Z06A 3E7BA 2NPPC 3H63A
chains in the Genus database with same CATH superfamily
3IVDA 4H2FA 1IT6A 4H2BA 3EGGA 4JA9A 4O24A 3ZTVA 3H60A 4ORBA 4I5NC 2BCDA 4JA7A 4ORCA 3KBPA 2XMOA 4HD0A 5DNYA 5INBA 3V4YA 1S95A 4O43A 2ZO9B 4J6OA 2WDCA 1UF3A 2WDFA 1Z2XA 4UT3A 3HVQA 2IAEC 4B2OA 1WARA 4DT2A 3H68A 4ZVZA 4IYPC 4YKEA 3N5UA 3QG5C 3QFNA 1OI8A 2YVTA 1NNWA 1UTEA 4H2GA 4FBKA 4UT2A 5IOHA 3DSCA 3P71C 3THNA 5J28A 2DXNA 1USHA 2HY1A 2AHDA 4H1SA 3E7AA 3IB7A 3IB8A 2QFRA 3C5WC 3GVEA 1FJMA 2Z72A 2HYOA 3CK2A 2DXLA 1JK7A 4O5GA 4TUIA 1S8EA 3H69A 3H67A 3PSNA 5B8IA 3K7VC 3PSOA 2R17A 5JJTA 1II7A 3H62B 1S3NA 3TGHA 3IVEA 4NZVA 1AUIA 3RL4A 5F3WA 3C9FA 2NYLC 3E0JA 3RQZA 2P6BA 2WDDA 1U32A 4M0VA 2QFPA 4LTYA 4FBWA 2USHA 4V0VA 3H64A 4LU9A 5C1VA 4DSYA 3FLOA 5EQVA 4V0WA 2ZOAA 4XPNA 1S3MA 4MOYA 5JPEA 2KKNA 2YEQA 1OIEA 1T71A 5GTUA 4ORAA 2GJUA 2WDEA 4H1YP 4LACC 1V73A 2ZBMA 4OR9A 3H61A 2O8AA 4IL1A 1HP1A 1QFCA 1Z2WA 1HO5A 2HYPA 3JYFA 1XM7A 3AUZA 1G5BA 2BDXA 4V0XA 4DHLA 4UT3B 1T70A 2Z1AA 2A22A 2BQ8X 3RL3A 2QJCA 1S3LA 1MF8A 1S70A 3EGHA 3H66A 3D03A 3ICFA 4O4KA 2IE4C 1QHWA 1W24A 4MP0A 3RL5A 1TCOA 2O8GA 2JOGA 1KBPA 3AV0A 2CV9A 2IE3C 1HPUA 1WAO1 4I5LC 3ZU0A 3FGAC 4ZX2A 5HPEA 5JPFA 3THOB 3LL8A 1OIDA 2Q8UA 3K7WC 4FCXA 2NXFA 4G9JA 4F0ZA 1SU1A 3QFMA 3T1IA 4UWQA 4KBPA 4MOVA 1M63A 1XZWA 2DFJA 4Q7FA 4WWLA 4FBQA 3DSDA 3QFOA 2NYMC 4TUGA 4H2IA 3QFKA 4KKZA 3DW8C 2Z06A 3E7BA 2NPPC 3H63A
chains in the Genus database with same CATH topology
3IVDA 4H2FA 1IT6A 4H2BA 3EGGA 4JA9A 4O24A 3ZTVA 3H60A 4ORBA 4I5NC 2BCDA 4JA7A 4ORCA 3KBPA 2XMOA 4HD0A 5DNYA 5INBA 3V4YA 1S95A 4O43A 2ZO9B 4J6OA 2WDCA 1UF3A 2WDFA 1Z2XA 4UT3A 3HVQA 2IAEC 4B2OA 1WARA 4DT2A 3H68A 4ZVZA 4IYPC 4YKEA 3N5UA 3QG5C 3QFNA 1OI8A 2YVTA 1NNWA 1UTEA 4H2GA 4FBKA 4UT2A 5IOHA 3DSCA 3P71C 3THNA 5J28A 2DXNA 1USHA 2HY1A 2AHDA 4H1SA 3E7AA 3IB7A 3IB8A 2QFRA 3C5WC 3GVEA 1FJMA 2Z72A 2HYOA 3CK2A 2DXLA 1JK7A 4O5GA 4TUIA 1S8EA 3H69A 3H67A 3PSNA 5B8IA 3K7VC 3PSOA 2R17A 5JJTA 1II7A 3H62B 1S3NA 3TGHA 3IVEA 4NZVA 1AUIA 3RL4A 5F3WA 3C9FA 2NYLC 3E0JA 3RQZA 2P6BA 2WDDA 1U32A 4M0VA 2QFPA 4LTYA 4FBWA 2USHA 4V0VA 3H64A 4LU9A 5C1VA 4DSYA 3FLOA 5EQVA 4V0WA 2ZOAA 4XPNA 1S3MA 4MOYA 5JPEA 2KKNA 2YEQA 1OIEA 1T71A 5GTUA 4ORAA 2GJUA 2WDEA 4H1YP 4LACC 1V73A 2ZBMA 4OR9A 3H61A 2O8AA 4IL1A 1HP1A 1QFCA 1Z2WA 1HO5A 2HYPA 3JYFA 1XM7A 3AUZA 1G5BA 2BDXA 4V0XA 4DHLA 4UT3B 1T70A 2Z1AA 2A22A 2BQ8X 3RL3A 2QJCA 1S3LA 1MF8A 1S70A 3EGHA 3H66A 3D03A 3ICFA 4O4KA 2IE4C 1QHWA 1W24A 4MP0A 3RL5A 1TCOA 2O8GA 2JOGA 1KBPA 3AV0A 2CV9A 2IE3C 1HPUA 1WAO1 4I5LC 3ZU0A 3FGAC 4ZX2A 5HPEA 5JPFA 3THOB 3LL8A 1OIDA 2Q8UA 3K7WC 4FCXA 2NXFA 4G9JA 4F0ZA 1SU1A 3QFMA 3T1IA 4UWQA 4KBPA 4MOVA 1M63A 1XZWA 2DFJA 4Q7FA 4WWLA 4FBQA 3DSDA 3QFOA 2NYMC 4TUGA 4H2IA 3QFKA 4KKZA 3DW8C 2Z06A 3E7BA 2NPPC 3H63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVD A;  4H2F A;  1IT6 A;  4H2B A;  3EGG A;  4JA9 A;  4O24 A;  3ZTV A;  3H60 A;  4ORB A;  4I5N C;  2BCD A;  4JA7 A;  4ORC A;  3KBP A;  2XMO A;  4HD0 A;  5DNY A;  5INB A;  3V4Y A;  1S95 A;  4O43 A;  4J6O A;  2WDC A;  1UF3 A;  2WDF A;  1Z2X A;  4UT3 A;  3HVQ A;  2IAE C;  4B2O A;  1WAR A;  4DT2 A;  3H68 A;  4ZVZ A;  4IYP C;  4YKE A;  3N5U A;  3QG5 C;  3QFN A;  1OI8 A;  2YVT A;  1NNW A;  1UTE A;  4H2G A;  4FBK A;  4UT2 A;  5IOH A;  3DSC A;  3P71 C;  3THN A;  5J28 A;  1USH A;  2HY1 A;  2AHD A;  4H1S A;  3E7A A;  3IB7 A;  3IB8 A;  2QFR A;  3C5W C;  3GVE A;  1FJM A;  2Z72 A;  2HYO A;  3CK2 A;  1JK7 A;  4O5G A;  4TUI A;  1S8E A;  3H69 A;  3H67 A;  3PSN A;  5B8I A;  3K7V C;  3PSO A;  2R17 A;  5JJT A;  1II7 A;  3H62 B;  1S3N A;  3TGH A;  3IVE A;  4NZV A;  1AUI A;  3RL4 A;  5F3W A;  3C9F A;  2NYL C;  3RQZ A;  2P6B A;  2WDD A;  1U32 A;  4M0V A;  2QFP A;  4LTY A;  4FBW A;  2USH A;  4V0V A;  3H64 A;  4LU9 A;  5C1V A;  4DSY A;  5EQV A;  4V0W A;  4XPN A;  1S3M A;  4MOY A;  5JPE A;  2KKN A;  1OIE A;  1T71 A;  5GTU A;  4ORA A;  2GJU A;  2WDE A;  4H1Y P;  4LAC C;  1V73 A;  2ZBM A;  4OR9 A;  3H61 A;  2O8A A;  4IL1 A;  1HP1 A;  1QFC A;  1Z2W A;  1HO5 A;  2HYP A;  3JYF A;  1XM7 A;  2BDX A;  1G5B A;  3AUZ A;  4V0X A;  4DHL A;  4UT3 B;  1T70 A;  2Z1A A;  2A22 A;  2BQ8 X;  3RL3 A;  2QJC A;  1S3L A;  1MF8 A;  1S70 A;  3EGH A;  3H66 A;  3ICF A;  4O4K A;  2IE4 C;  1QHW A;  1W24 A;  4MP0 A;  3RL5 A;  1TCO A;  2O8G A;  2JOG A;  1KBP A;  3AV0 A;  2CV9 A;  2IE3 C;  1HPU A;  1WAO 1;  4I5L C;  3ZU0 A;  3FGA C;  4ZX2 A;  5HPE A;  5JPF A;  3THO B;  3LL8 A;  1OID A;  2Q8U A;  3K7W C;  4FCX A;  2NXF A;  4G9J A;  4F0Z A;  1SU1 A;  3QFM A;  3T1I A;  4UWQ A;  4KBP A;  4MOV A;  1M63 A;  1XZW A;  2DFJ A;  4Q7F A;  4WWL A;  4FBQ A;  3DSD A;  3QFO A;  2NYM C;  4TUG A;  4H2I A;  3QFK A;  4KKZ A;  3DW8 C;  2Z06 A;  3E7B A;  2NPP C;  3H63 A; 
#chains in the Genus database with same CATH topology
 3IVD A;  4H2F A;  1IT6 A;  4H2B A;  3EGG A;  4JA9 A;  4O24 A;  3ZTV A;  3H60 A;  4ORB A;  4I5N C;  2BCD A;  4JA7 A;  4ORC A;  3KBP A;  2XMO A;  4HD0 A;  5DNY A;  5INB A;  3V4Y A;  1S95 A;  4O43 A;  2ZO9 B;  4J6O A;  2WDC A;  1UF3 A;  2WDF A;  1Z2X A;  4UT3 A;  3HVQ A;  2IAE C;  4B2O A;  1WAR A;  4DT2 A;  3H68 A;  4ZVZ A;  4IYP C;  4YKE A;  3N5U A;  3QG5 C;  3QFN A;  1OI8 A;  2YVT A;  1NNW A;  1UTE A;  4H2G A;  4FBK A;  4UT2 A;  5IOH A;  3DSC A;  3P71 C;  3THN A;  5J28 A;  2DXN A;  1USH A;  2HY1 A;  2AHD A;  4H1S A;  3E7A A;  3IB7 A;  3IB8 A;  2QFR A;  3C5W C;  3GVE A;  1FJM A;  2Z72 A;  2HYO A;  3CK2 A;  2DXL A;  1JK7 A;  4O5G A;  4TUI A;  1S8E A;  3H69 A;  3H67 A;  3PSN A;  5B8I A;  3K7V C;  3PSO A;  2R17 A;  5JJT A;  1II7 A;  3H62 B;  1S3N A;  3TGH A;  3IVE A;  4NZV A;  1AUI A;  3RL4 A;  5F3W A;  3C9F A;  2NYL C;  3E0J A;  3RQZ A;  2P6B A;  2WDD A;  1U32 A;  4M0V A;  2QFP A;  4LTY A;  4FBW A;  2USH A;  4V0V A;  3H64 A;  4LU9 A;  5C1V A;  4DSY A;  3FLO A;  5EQV A;  4V0W A;  2ZOA A;  4XPN A;  1S3M A;  4MOY A;  5JPE A;  2KKN A;  2YEQ A;  1OIE A;  1T71 A;  5GTU A;  4ORA A;  2GJU A;  2WDE A;  4H1Y P;  4LAC C;  1V73 A;  2ZBM A;  4OR9 A;  3H61 A;  2O8A A;  4IL1 A;  1HP1 A;  1QFC A;  1Z2W A;  1HO5 A;  2HYP A;  3JYF A;  1XM7 A;  3AUZ A;  1G5B A;  2BDX A;  4V0X A;  4DHL A;  4UT3 B;  1T70 A;  2Z1A A;  2A22 A;  2BQ8 X;  3RL3 A;  2QJC A;  1S3L A;  1MF8 A;  1S70 A;  3EGH A;  3H66 A;  3D03 A;  3ICF A;  4O4K A;  2IE4 C;  1QHW A;  1W24 A;  4MP0 A;  3RL5 A;  1TCO A;  2O8G A;  2JOG A;  1KBP A;  3AV0 A;  2CV9 A;  2IE3 C;  1HPU A;  1WAO 1;  4I5L C;  3ZU0 A;  3FGA C;  4ZX2 A;  5HPE A;  5JPF A;  3THO B;  3LL8 A;  1OID A;  2Q8U A;  3K7W C;  4FCX A;  2NXF A;  4G9J A;  4F0Z A;  1SU1 A;  3QFM A;  3T1I A;  4UWQ A;  4KBP A;  4MOV A;  1M63 A;  1XZW A;  2DFJ A;  4Q7F A;  4WWL A;  4FBQ A;  3DSD A;  3QFO A;  2NYM C;  4TUG A;  4H2I A;  3QFK A;  4KKZ A;  3DW8 C;  2Z06 A;  3E7B A;  2NPP C;  3H63 A; 
#chains in the Genus database with same CATH homology
 3IVD A;  4H2F A;  1IT6 A;  4H2B A;  3EGG A;  4JA9 A;  4O24 A;  3ZTV A;  3H60 A;  4ORB A;  4I5N C;  2BCD A;  4JA7 A;  4ORC A;  3KBP A;  2XMO A;  4HD0 A;  5DNY A;  5INB A;  3V4Y A;  1S95 A;  4O43 A;  2ZO9 B;  4J6O A;  2WDC A;  1UF3 A;  2WDF A;  1Z2X A;  4UT3 A;  3HVQ A;  2IAE C;  4B2O A;  1WAR A;  4DT2 A;  3H68 A;  4ZVZ A;  4IYP C;  4YKE A;  3N5U A;  3QG5 C;  3QFN A;  1OI8 A;  2YVT A;  1NNW A;  1UTE A;  4H2G A;  4FBK A;  4UT2 A;  5IOH A;  3DSC A;  3P71 C;  3THN A;  5J28 A;  2DXN A;  1USH A;  2HY1 A;  2AHD A;  4H1S A;  3E7A A;  3IB7 A;  3IB8 A;  2QFR A;  3C5W C;  3GVE A;  1FJM A;  2Z72 A;  2HYO A;  3CK2 A;  2DXL A;  1JK7 A;  4O5G A;  4TUI A;  1S8E A;  3H69 A;  3H67 A;  3PSN A;  5B8I A;  3K7V C;  3PSO A;  2R17 A;  5JJT A;  1II7 A;  3H62 B;  1S3N A;  3TGH A;  3IVE A;  4NZV A;  1AUI A;  3RL4 A;  5F3W A;  3C9F A;  2NYL C;  3E0J A;  3RQZ A;  2P6B A;  2WDD A;  1U32 A;  4M0V A;  2QFP A;  4LTY A;  4FBW A;  2USH A;  4V0V A;  3H64 A;  4LU9 A;  5C1V A;  4DSY A;  3FLO A;  5EQV A;  4V0W A;  2ZOA A;  4XPN A;  1S3M A;  4MOY A;  5JPE A;  2KKN A;  2YEQ A;  1OIE A;  1T71 A;  5GTU A;  4ORA A;  2GJU A;  2WDE A;  4H1Y P;  4LAC C;  1V73 A;  2ZBM A;  4OR9 A;  3H61 A;  2O8A A;  4IL1 A;  1HP1 A;  1QFC A;  1Z2W A;  1HO5 A;  2HYP A;  3JYF A;  1XM7 A;  3AUZ A;  1G5B A;  2BDX A;  4V0X A;  4DHL A;  4UT3 B;  1T70 A;  2Z1A A;  2A22 A;  2BQ8 X;  3RL3 A;  2QJC A;  1S3L A;  1MF8 A;  1S70 A;  3EGH A;  3H66 A;  3D03 A;  3ICF A;  4O4K A;  2IE4 C;  1QHW A;  1W24 A;  4MP0 A;  3RL5 A;  1TCO A;  2O8G A;  2JOG A;  1KBP A;  3AV0 A;  2CV9 A;  2IE3 C;  1HPU A;  1WAO 1;  4I5L C;  3ZU0 A;  3FGA C;  4ZX2 A;  5HPE A;  5JPF A;  3THO B;  3LL8 A;  1OID A;  2Q8U A;  3K7W C;  4FCX A;  2NXF A;  4G9J A;  4F0Z A;  1SU1 A;  3QFM A;  3T1I A;  4UWQ A;  4KBP A;  4MOV A;  1M63 A;  1XZW A;  2DFJ A;  4Q7F A;  4WWL A;  4FBQ A;  3DSD A;  3QFO A;  2NYM C;  4TUG A;  4H2I A;  3QFK A;  4KKZ A;  3DW8 C;  2Z06 A;  3E7B A;  2NPP C;  3H63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...