2NYLC

Crystal structure of protein phosphatase 2a (pp2a) holoenzyme with the catalytic subunit carboxyl terminus truncated
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
293
structure length
293
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 2, regulatory subunit A (PR 65), alpha i
publication title Structure of the Protein Phosphatase 2A Holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 91
structure length 293
sequence length 293
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nylC00
4ZVZA 1M63A 2XMOA 3GVEA 4LU9A 4XPNA 3RQZA 3QG5C 1Z2WA 2Q8UA 4DT2A 4H2IA 4F0ZA 3H64A 1FJMA 4O24A 2HYPA 3E7AA 5C1VA 3IB8A 2CV9A 4IYPC 1OIEA 1II7A 2WDFA 3H68A 2IE4C 3PSNA 3QFMA 3QFNA 4OR9A 4O43A 4H1SA 4B2OA 2HY1A 1MF8A 1HP1A 2GJUA 3QFOA 4TUGA 3C5WC 4V0VA 5DNYA 1HO5A 2QJCA 4O4KA 1UTEA 4ZX2A 2BCDA 3AUZA 4FBKA 3ZTVA 2WDDA 4FBWA 3HVQA 1WAO1 1WARA 4YKEA 2USHA 1U32A 1Z2XA 5HPEA 4JA7A 2AHDA 4IL1A 2HYOA 3FGAC 3H63A 3PSOA 2R17A 4H2GA 1S3LA 2DFJA 3RL5A 5IOHA 3EGHA 1W24A 2BDXA 1QHWA 4Q7FA 2Z72A 2BQ8X 3E7BA 4FCXA 4I5LC 4JA9A 4ORBA 5B8IA 4KKZA 4I5NC 2NXFA 3C9FA 3IVEA 5J28A 5F3WA 3H69A 3K7VC 3DSCA 5INBA 1USHA 1NNWA 5GTUA 2QFRA 5JPEA 4UT3A 4MP0A 1S95A 2A22A 2Z1AA 1TCOA 3N5UA 1XZWA 3QFKA 4LTYA 4WWLA 2WDEA 4O5GA 5JJTA 4H2BA 3H67A 2NYLC 1KBPA 2IE3C 1OI8A 1V73A 3EGGA 2YVTA 2WDCA 1SU1A 3T1IA 4M0VA 4V0WA 3H62B 3IVDA 3JYFA 3LL8A 5EQVA 4ORCA 3RL3A 3THOB 3TGHA 2Z06A 1JK7A 4H2FA 1S8EA 4J6OA 1T70A 4MOYA 4UT3B 4H1YP 4TUIA 2ZBMA 3DW8C 4G9JA 1G5BA 1XM7A 4V0XA 4MOVA 3ZU0A 1S70A 3H60A 2NPPC 3P71C 2NYMC 4NZVA 5JPFA 1IT6A 4ORAA 3H61A 3K7WC 3V4YA 1T71A 1AUIA 3ICFA 2KKNA 3AV0A 4HD0A 4KBPA 3CK2A 4DHLA 4UWQA 3DSDA 2O8AA 2QFPA 3IB7A 1HPUA 1UF3A 2O8GA 4UT2A 4FBQA 3H66A 2P6BA 4DSYA 2JOGA 1OIDA 1S3MA 1S3NA 4LACC 3KBPA 1QFCA 3RL4A 2IAEC 3THNA
chains in the Genus database with same CATH superfamily
4ZVZA 1M63A 2XMOA 3GVEA 4LU9A 4XPNA 3RQZA 3QG5C 1Z2WA 2Q8UA 4DT2A 4H2IA 4F0ZA 3H64A 1FJMA 4O24A 2HYPA 3E7AA 5C1VA 3IB8A 2CV9A 4IYPC 1OIEA 1II7A 2WDFA 2DXLA 2IE4C 3H68A 3PSNA 3QFMA 3QFNA 4OR9A 4O43A 4H1SA 4B2OA 2HY1A 1MF8A 1HP1A 2GJUA 3QFOA 4TUGA 3C5WC 4V0VA 5DNYA 1HO5A 2QJCA 4O4KA 1UTEA 2YEQA 4ZX2A 3FLOA 2BCDA 2DXNA 3AUZA 4FBKA 3ZTVA 2WDDA 4FBWA 3HVQA 1WAO1 3D03A 1WARA 4YKEA 2USHA 1U32A 1Z2XA 5HPEA 4JA7A 2AHDA 4IL1A 2HYOA 3FGAC 3H63A 3PSOA 2R17A 4H2GA 1S3LA 2DFJA 3RL5A 5IOHA 3EGHA 1W24A 2BDXA 1QHWA 4Q7FA 2Z72A 2BQ8X 3E7BA 4FCXA 4I5LC 4JA9A 4ORBA 5B8IA 4KKZA 4I5NC 2NXFA 3C9FA 3IVEA 5J28A 5F3WA 3H69A 3K7VC 3DSCA 5INBA 1USHA 1NNWA 5GTUA 2QFRA 5JPEA 4UT3A 4MP0A 1S95A 2A22A 2Z1AA 1TCOA 3N5UA 1XZWA 3QFKA 4LTYA 4WWLA 2WDEA 4O5GA 5JJTA 4H2BA 3E0JA 3H67A 2NYLC 1KBPA 2IE3C 1OI8A 1V73A 3EGGA 2ZO9B 2YVTA 2WDCA 1SU1A 3T1IA 4M0VA 4V0WA 3H62B 2ZOAA 3IVDA 3JYFA 3LL8A 4ORCA 5EQVA 3RL3A 3THOB 3TGHA 2Z06A 1JK7A 4H2FA 1S8EA 4J6OA 1T70A 4MOYA 4UT3B 4H1YP 4TUIA 2ZBMA 3DW8C 4G9JA 1G5BA 1XM7A 4V0XA 4MOVA 3ZU0A 1S70A 3H60A 2NPPC 3P71C 2NYMC 4NZVA 5JPFA 1IT6A 4ORAA 3H61A 3K7WC 3V4YA 1T71A 1AUIA 3ICFA 2KKNA 3AV0A 4HD0A 4KBPA 3CK2A 4DHLA 4UWQA 3DSDA 2O8AA 2QFPA 3IB7A 1HPUA 1UF3A 2O8GA 4UT2A 4FBQA 3H66A 2P6BA 4DSYA 2JOGA 1OIDA 1S3MA 1S3NA 4LACC 3KBPA 1QFCA 3RL4A 2IAEC 3THNA
chains in the Genus database with same CATH topology
4ZVZA 1M63A 2XMOA 3GVEA 4LU9A 4XPNA 3RQZA 3QG5C 1Z2WA 2Q8UA 4DT2A 4H2IA 4F0ZA 3H64A 1FJMA 4O24A 2HYPA 3E7AA 5C1VA 3IB8A 2CV9A 4IYPC 1OIEA 1II7A 2WDFA 2DXLA 2IE4C 3H68A 3PSNA 3QFMA 3QFNA 4OR9A 4O43A 4H1SA 4B2OA 2HY1A 1MF8A 1HP1A 2GJUA 3QFOA 4TUGA 3C5WC 4V0VA 5DNYA 1HO5A 2QJCA 4O4KA 1UTEA 2YEQA 4ZX2A 3FLOA 2BCDA 2DXNA 3AUZA 4FBKA 3ZTVA 2WDDA 4FBWA 3HVQA 1WAO1 3D03A 1WARA 4YKEA 2USHA 1U32A 1Z2XA 5HPEA 4JA7A 2AHDA 4IL1A 2HYOA 3FGAC 3H63A 3PSOA 2R17A 4H2GA 1S3LA 2DFJA 3RL5A 5IOHA 3EGHA 1W24A 2BDXA 1QHWA 4Q7FA 2Z72A 2BQ8X 3E7BA 4FCXA 4I5LC 4JA9A 4ORBA 5B8IA 4KKZA 4I5NC 2NXFA 3C9FA 3IVEA 5J28A 5F3WA 3H69A 3K7VC 3DSCA 5INBA 1USHA 1NNWA 5GTUA 2QFRA 5JPEA 4UT3A 4MP0A 1S95A 2A22A 2Z1AA 1TCOA 3N5UA 1XZWA 3QFKA 4LTYA 4WWLA 2WDEA 4O5GA 5JJTA 4H2BA 3E0JA 3H67A 2NYLC 1KBPA 2IE3C 1OI8A 1V73A 3EGGA 2ZO9B 2YVTA 2WDCA 1SU1A 3T1IA 4M0VA 4V0WA 3H62B 2ZOAA 3IVDA 3JYFA 3LL8A 4ORCA 5EQVA 3RL3A 3THOB 3TGHA 2Z06A 1JK7A 4H2FA 1S8EA 4J6OA 1T70A 4MOYA 4UT3B 4H1YP 4TUIA 2ZBMA 3DW8C 4G9JA 1G5BA 1XM7A 4V0XA 4MOVA 3ZU0A 1S70A 3H60A 2NPPC 3P71C 2NYMC 4NZVA 5JPFA 1IT6A 4ORAA 3H61A 3K7WC 3V4YA 1T71A 1AUIA 3ICFA 2KKNA 3AV0A 4HD0A 4KBPA 3CK2A 4DHLA 4UWQA 3DSDA 2O8AA 2QFPA 3IB7A 1HPUA 1UF3A 2O8GA 4UT2A 4FBQA 3H66A 2P6BA 4DSYA 2JOGA 1OIDA 1S3MA 1S3NA 4LACC 3KBPA 1QFCA 3RL4A 2IAEC 3THNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVZ A;  1M63 A;  2XMO A;  3GVE A;  4LU9 A;  4XPN A;  3RQZ A;  3QG5 C;  1Z2W A;  2Q8U A;  4DT2 A;  4H2I A;  4F0Z A;  3H64 A;  1FJM A;  4O24 A;  2HYP A;  3E7A A;  5C1V A;  3IB8 A;  2CV9 A;  4IYP C;  1OIE A;  1II7 A;  2WDF A;  3H68 A;  2IE4 C;  3PSN A;  3QFM A;  3QFN A;  4OR9 A;  4O43 A;  4H1S A;  4B2O A;  2HY1 A;  1MF8 A;  1HP1 A;  2GJU A;  3QFO A;  4TUG A;  3C5W C;  4V0V A;  5DNY A;  1HO5 A;  2QJC A;  4O4K A;  1UTE A;  4ZX2 A;  2BCD A;  3AUZ A;  4FBK A;  3ZTV A;  2WDD A;  4FBW A;  3HVQ A;  1WAO 1;  1WAR A;  4YKE A;  2USH A;  1U32 A;  1Z2X A;  5HPE A;  4JA7 A;  2AHD A;  4IL1 A;  2HYO A;  3FGA C;  3H63 A;  3PSO A;  2R17 A;  4H2G A;  1S3L A;  2DFJ A;  3RL5 A;  5IOH A;  3EGH A;  1W24 A;  2BDX A;  1QHW A;  4Q7F A;  2Z72 A;  2BQ8 X;  3E7B A;  4FCX A;  4I5L C;  4JA9 A;  4ORB A;  5B8I A;  4KKZ A;  4I5N C;  2NXF A;  3C9F A;  3IVE A;  5J28 A;  5F3W A;  3H69 A;  3K7V C;  3DSC A;  5INB A;  1USH A;  1NNW A;  5GTU A;  2QFR A;  5JPE A;  4UT3 A;  4MP0 A;  1S95 A;  2A22 A;  2Z1A A;  1TCO A;  3N5U A;  1XZW A;  3QFK A;  4LTY A;  4WWL A;  2WDE A;  4O5G A;  5JJT A;  4H2B A;  3H67 A;  2NYL C;  1KBP A;  2IE3 C;  1OI8 A;  1V73 A;  3EGG A;  2YVT A;  2WDC A;  1SU1 A;  3T1I A;  4M0V A;  4V0W A;  3H62 B;  3IVD A;  3JYF A;  3LL8 A;  5EQV A;  4ORC A;  3RL3 A;  3THO B;  3TGH A;  2Z06 A;  1JK7 A;  4H2F A;  1S8E A;  4J6O A;  1T70 A;  4MOY A;  4UT3 B;  4H1Y P;  4TUI A;  2ZBM A;  3DW8 C;  4G9J A;  1G5B A;  1XM7 A;  4V0X A;  4MOV A;  3ZU0 A;  1S70 A;  3H60 A;  2NPP C;  3P71 C;  2NYM C;  4NZV A;  5JPF A;  1IT6 A;  4ORA A;  3H61 A;  3K7W C;  3V4Y A;  1T71 A;  1AUI A;  3ICF A;  2KKN A;  3AV0 A;  4HD0 A;  4KBP A;  3CK2 A;  4DHL A;  4UWQ A;  3DSD A;  2O8A A;  2QFP A;  3IB7 A;  1HPU A;  1UF3 A;  2O8G A;  4UT2 A;  4FBQ A;  3H66 A;  2P6B A;  4DSY A;  2JOG A;  1OID A;  1S3M A;  1S3N A;  4LAC C;  3KBP A;  1QFC A;  3RL4 A;  2IAE C;  3THN A; 
#chains in the Genus database with same CATH topology
 4ZVZ A;  1M63 A;  2XMO A;  3GVE A;  4LU9 A;  4XPN A;  3RQZ A;  3QG5 C;  1Z2W A;  2Q8U A;  4DT2 A;  4H2I A;  4F0Z A;  3H64 A;  1FJM A;  4O24 A;  2HYP A;  3E7A A;  5C1V A;  3IB8 A;  2CV9 A;  4IYP C;  1OIE A;  1II7 A;  2WDF A;  2DXL A;  2IE4 C;  3H68 A;  3PSN A;  3QFM A;  3QFN A;  4OR9 A;  4O43 A;  4H1S A;  4B2O A;  2HY1 A;  1MF8 A;  1HP1 A;  2GJU A;  3QFO A;  4TUG A;  3C5W C;  4V0V A;  5DNY A;  1HO5 A;  2QJC A;  4O4K A;  1UTE A;  2YEQ A;  4ZX2 A;  3FLO A;  2BCD A;  2DXN A;  3AUZ A;  4FBK A;  3ZTV A;  2WDD A;  4FBW A;  3HVQ A;  1WAO 1;  3D03 A;  1WAR A;  4YKE A;  2USH A;  1U32 A;  1Z2X A;  5HPE A;  4JA7 A;  2AHD A;  4IL1 A;  2HYO A;  3FGA C;  3H63 A;  3PSO A;  2R17 A;  4H2G A;  1S3L A;  2DFJ A;  3RL5 A;  5IOH A;  3EGH A;  1W24 A;  2BDX A;  1QHW A;  4Q7F A;  2Z72 A;  2BQ8 X;  3E7B A;  4FCX A;  4I5L C;  4JA9 A;  4ORB A;  5B8I A;  4KKZ A;  4I5N C;  2NXF A;  3C9F A;  3IVE A;  5J28 A;  5F3W A;  3H69 A;  3K7V C;  3DSC A;  5INB A;  1USH A;  1NNW A;  5GTU A;  2QFR A;  5JPE A;  4UT3 A;  4MP0 A;  1S95 A;  2A22 A;  2Z1A A;  1TCO A;  3N5U A;  1XZW A;  3QFK A;  4LTY A;  4WWL A;  2WDE A;  4O5G A;  5JJT A;  4H2B A;  3E0J A;  3H67 A;  2NYL C;  1KBP A;  2IE3 C;  1OI8 A;  1V73 A;  3EGG A;  2ZO9 B;  2YVT A;  2WDC A;  1SU1 A;  3T1I A;  4M0V A;  4V0W A;  3H62 B;  2ZOA A;  3IVD A;  3JYF A;  3LL8 A;  4ORC A;  5EQV A;  3RL3 A;  3THO B;  3TGH A;  2Z06 A;  1JK7 A;  4H2F A;  1S8E A;  4J6O A;  1T70 A;  4MOY A;  4UT3 B;  4H1Y P;  4TUI A;  2ZBM A;  3DW8 C;  4G9J A;  1G5B A;  1XM7 A;  4V0X A;  4MOV A;  3ZU0 A;  1S70 A;  3H60 A;  2NPP C;  3P71 C;  2NYM C;  4NZV A;  5JPF A;  1IT6 A;  4ORA A;  3H61 A;  3K7W C;  3V4Y A;  1T71 A;  1AUI A;  3ICF A;  2KKN A;  3AV0 A;  4HD0 A;  4KBP A;  3CK2 A;  4DHL A;  4UWQ A;  3DSD A;  2O8A A;  2QFP A;  3IB7 A;  1HPU A;  1UF3 A;  2O8G A;  4UT2 A;  4FBQ A;  3H66 A;  2P6B A;  4DSY A;  2JOG A;  1OID A;  1S3M A;  1S3N A;  4LAC C;  3KBP A;  1QFC A;  3RL4 A;  2IAE C;  3THN A; 
#chains in the Genus database with same CATH homology
 4ZVZ A;  1M63 A;  2XMO A;  3GVE A;  4LU9 A;  4XPN A;  3RQZ A;  3QG5 C;  1Z2W A;  2Q8U A;  4DT2 A;  4H2I A;  4F0Z A;  3H64 A;  1FJM A;  4O24 A;  2HYP A;  3E7A A;  5C1V A;  3IB8 A;  2CV9 A;  4IYP C;  1OIE A;  1II7 A;  2WDF A;  2DXL A;  2IE4 C;  3H68 A;  3PSN A;  3QFM A;  3QFN A;  4OR9 A;  4O43 A;  4H1S A;  4B2O A;  2HY1 A;  1MF8 A;  1HP1 A;  2GJU A;  3QFO A;  4TUG A;  3C5W C;  4V0V A;  5DNY A;  1HO5 A;  2QJC A;  4O4K A;  1UTE A;  2YEQ A;  4ZX2 A;  3FLO A;  2BCD A;  2DXN A;  3AUZ A;  4FBK A;  3ZTV A;  2WDD A;  4FBW A;  3HVQ A;  1WAO 1;  3D03 A;  1WAR A;  4YKE A;  2USH A;  1U32 A;  1Z2X A;  5HPE A;  4JA7 A;  2AHD A;  4IL1 A;  2HYO A;  3FGA C;  3H63 A;  3PSO A;  2R17 A;  4H2G A;  1S3L A;  2DFJ A;  3RL5 A;  5IOH A;  3EGH A;  1W24 A;  2BDX A;  1QHW A;  4Q7F A;  2Z72 A;  2BQ8 X;  3E7B A;  4FCX A;  4I5L C;  4JA9 A;  4ORB A;  5B8I A;  4KKZ A;  4I5N C;  2NXF A;  3C9F A;  3IVE A;  5J28 A;  5F3W A;  3H69 A;  3K7V C;  3DSC A;  5INB A;  1USH A;  1NNW A;  5GTU A;  2QFR A;  5JPE A;  4UT3 A;  4MP0 A;  1S95 A;  2A22 A;  2Z1A A;  1TCO A;  3N5U A;  1XZW A;  3QFK A;  4LTY A;  4WWL A;  2WDE A;  4O5G A;  5JJT A;  4H2B A;  3E0J A;  3H67 A;  2NYL C;  1KBP A;  2IE3 C;  1OI8 A;  1V73 A;  3EGG A;  2ZO9 B;  2YVT A;  2WDC A;  1SU1 A;  3T1I A;  4M0V A;  4V0W A;  3H62 B;  2ZOA A;  3IVD A;  3JYF A;  3LL8 A;  4ORC A;  5EQV A;  3RL3 A;  3THO B;  3TGH A;  2Z06 A;  1JK7 A;  4H2F A;  1S8E A;  4J6O A;  1T70 A;  4MOY A;  4UT3 B;  4H1Y P;  4TUI A;  2ZBM A;  3DW8 C;  4G9J A;  1G5B A;  1XM7 A;  4V0X A;  4MOV A;  3ZU0 A;  1S70 A;  3H60 A;  2NPP C;  3P71 C;  2NYM C;  4NZV A;  5JPF A;  1IT6 A;  4ORA A;  3H61 A;  3K7W C;  3V4Y A;  1T71 A;  1AUI A;  3ICF A;  2KKN A;  3AV0 A;  4HD0 A;  4KBP A;  3CK2 A;  4DHL A;  4UWQ A;  3DSD A;  2O8A A;  2QFP A;  3IB7 A;  1HPU A;  1UF3 A;  2O8G A;  4UT2 A;  4FBQ A;  3H66 A;  2P6B A;  4DSY A;  2JOG A;  1OID A;  1S3M A;  1S3N A;  4LAC C;  3KBP A;  1QFC A;  3RL4 A;  2IAE C;  3THN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...