2NYLC

Crystal structure of protein phosphatase 2a (pp2a) holoenzyme with the catalytic subunit carboxyl terminus truncated
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
293
structure length
293
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Protein Phosphatase 2A Holoenzyme.
pubmed doi rcsb
molecule keywords Protein phosphatase 2, regulatory subunit A (PR 65), alpha i
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 91
structure length 293
sequence length 293
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nylC00
2QJCA 4KBPA 2BDXA 1S3NA 3LL8A 5IOHA 5JJTA 4ZX2A 2DFJA 3JYFA 4V0VA 4UT2A 1S95A 3H66A 2QFPA 3H61A 5EQVA 1S8EA 4ORBA 4KKZA 4ZVZA 4DT2A 1UTEA 1Z2WA 2WDEA 3DSCA 4H2IA 3K7VC 3EGHA 2Z72A 4LTYA 4M0VA 1T71A 4MOYA 2XMOA 4FCXA 3CK2A 3AUZA 3H64A 3H62B 3RL4A 3T1IA 4J6OA 1W24A 1IT6A 2IE4C 4G9JA 2USHA 4UT3A 4B2OA 3C9FA 4V0WA 1USHA 4OR9A 4I5NC 3C5WC 1WAO1 5DNYA 1V73A 3EGGA 3N5UA 4NZVA 1OIEA 4JA7A 4YKEA 4UWQA 1AUIA 1FJMA 1G5BA 2Z06A 2NYLC 3THNA 1T70A 2JOGA 2KKNA 3E7AA 2O8GA 1NNWA 3IVEA 2YVTA 3GVEA 4H2FA 3AV0A 3PSNA 5HPEA 3ZTVA 2ZBMA 1HP1A 2WDCA 2HY1A 1II7A 1XM7A 3DW8C 3FGAC 1Z2XA 3KBPA 1JK7A 4O5GA 3H68A 3V4YA 1OIDA 1XZWA 3QFNA 4H1SA 2GJUA 4LACC 2O8AA 3TGHA 5F3WA 4V0XA 4H1YP 2HYPA 2CV9A 3ZU0A 4UT3B 4H2GA 3RL3A 3RQZA 4XPNA 2Z1AA 1M63A 3P71C 5JPFA 3H63A 1MF8A 4HD0A 1HPUA 1SU1A 1S3LA 3HVQA 3QFMA 4MOVA 3THOB 3E7BA 1KBPA 4LU9A 4FBQA 1QHWA 4I5LC 2BQ8X 4O43A 2A22A 3IB7A 3K7WC 4F0ZA 1S70A 3H69A 4WWLA 1HO5A 4H2BA 3DSDA 1U32A 4ORAA 1S3MA 2IAEC 4DHLA 3IVDA 5B8IA 2NYMC 4TUGA 1OI8A 2WDDA 3PSOA 5INBA 5GTUA 2P6BA 2QFRA 4TUIA 3QG5C 3H60A 5JPEA 4O4KA 2NXFA 1UF3A 2NPPC 1TCOA 2AHDA 4IL1A 3ICFA 3QFOA 3QFKA 4FBKA 2R17A 3H67A 3IB8A 4FBWA 4JA9A 4ORCA 3RL5A 4Q7FA 2WDFA 2Q8UA 4IYPC 4O24A 5C1VA 5J28A 4DSYA 1QFCA 2IE3C 2BCDA 4MP0A 2HYOA 1WARA
chains in the Genus database with same CATH superfamily
2QJCA 4KBPA 2BDXA 1S3NA 3LL8A 5IOHA 5JJTA 4ZX2A 2DFJA 3JYFA 4V0VA 4UT2A 1S95A 3H66A 2QFPA 3H61A 5EQVA 1S8EA 4ORBA 4KKZA 4ZVZA 4DT2A 1UTEA 1Z2WA 2WDEA 3DSCA 4H2IA 3K7VC 3EGHA 2Z72A 4LTYA 4M0VA 1T71A 3E0JA 4MOYA 2XMOA 4FCXA 3CK2A 3AUZA 3H64A 3H62B 3RL4A 3T1IA 4J6OA 1W24A 1IT6A 2ZO9B 2DXLA 2IE4C 4G9JA 2USHA 4UT3A 4B2OA 3C9FA 4V0WA 1USHA 4OR9A 4I5NC 3C5WC 1WAO1 5DNYA 1V73A 3EGGA 3N5UA 4NZVA 1OIEA 4JA7A 4YKEA 4UWQA 1AUIA 1FJMA 1G5BA 2Z06A 2NYLC 3THNA 1T70A 2JOGA 2KKNA 3E7AA 2O8GA 1NNWA 3IVEA 2YVTA 3GVEA 4H2FA 3AV0A 3PSNA 5HPEA 3ZTVA 2ZBMA 1HP1A 2WDCA 2HY1A 1II7A 1XM7A 3DW8C 3FGAC 1Z2XA 3KBPA 1JK7A 4O5GA 3H68A 3V4YA 1OIDA 1XZWA 3QFNA 2DXNA 4H1SA 2GJUA 4LACC 2O8AA 3TGHA 5F3WA 4V0XA 4H1YP 2HYPA 2CV9A 3ZU0A 2YEQA 4UT3B 4H2GA 3RL3A 3RQZA 4XPNA 2Z1AA 1M63A 3P71C 5JPFA 3H63A 1MF8A 4HD0A 1HPUA 1SU1A 1S3LA 3HVQA 3QFMA 4MOVA 3THOB 3E7BA 1KBPA 4LU9A 4FBQA 1QHWA 4I5LC 2BQ8X 4O43A 2A22A 3IB7A 3K7WC 4F0ZA 2ZOAA 1S70A 3H69A 4WWLA 1HO5A 4H2BA 3DSDA 1U32A 4ORAA 1S3MA 2IAEC 4DHLA 3IVDA 3D03A 5B8IA 2NYMC 4TUGA 1OI8A 2WDDA 3PSOA 5INBA 5GTUA 2P6BA 2QFRA 4TUIA 3QG5C 3H60A 3FLOA 5JPEA 4O4KA 2NXFA 1UF3A 2NPPC 1TCOA 2AHDA 4IL1A 3ICFA 3QFOA 3QFKA 4FBKA 2R17A 3H67A 3IB8A 4FBWA 4JA9A 4ORCA 3RL5A 4Q7FA 2WDFA 2Q8UA 4IYPC 4O24A 5C1VA 5J28A 4DSYA 1QFCA 2IE3C 2BCDA 4MP0A 2HYOA 1WARA
chains in the Genus database with same CATH topology
2QJCA 4KBPA 2BDXA 1S3NA 3LL8A 5IOHA 5JJTA 4ZX2A 2DFJA 3JYFA 4V0VA 4UT2A 1S95A 3H66A 2QFPA 3H61A 5EQVA 1S8EA 4ORBA 4KKZA 4ZVZA 4DT2A 1UTEA 1Z2WA 2WDEA 3DSCA 4H2IA 3K7VC 3EGHA 2Z72A 4LTYA 4M0VA 1T71A 3E0JA 4MOYA 2XMOA 4FCXA 3CK2A 3AUZA 3H64A 3H62B 3RL4A 3T1IA 4J6OA 1W24A 1IT6A 2ZO9B 2DXLA 2IE4C 4G9JA 2USHA 4UT3A 4B2OA 3C9FA 4V0WA 1USHA 4OR9A 4I5NC 3C5WC 1WAO1 5DNYA 1V73A 3EGGA 3N5UA 4NZVA 1OIEA 4JA7A 4YKEA 4UWQA 1AUIA 1FJMA 1G5BA 2Z06A 2NYLC 3THNA 1T70A 2JOGA 2KKNA 3E7AA 2O8GA 1NNWA 3IVEA 2YVTA 3GVEA 4H2FA 3AV0A 3PSNA 5HPEA 3ZTVA 2ZBMA 1HP1A 2WDCA 2HY1A 1II7A 1XM7A 3DW8C 3FGAC 1Z2XA 3KBPA 1JK7A 4O5GA 3H68A 3V4YA 1OIDA 1XZWA 3QFNA 2DXNA 4H1SA 2GJUA 4LACC 2O8AA 3TGHA 5F3WA 4V0XA 4H1YP 2HYPA 2CV9A 3ZU0A 2YEQA 4UT3B 4H2GA 3RL3A 3RQZA 4XPNA 2Z1AA 1M63A 3P71C 5JPFA 3H63A 1MF8A 4HD0A 1HPUA 1SU1A 1S3LA 3HVQA 3QFMA 4MOVA 3THOB 3E7BA 1KBPA 4LU9A 4FBQA 1QHWA 4I5LC 2BQ8X 4O43A 2A22A 3IB7A 3K7WC 4F0ZA 2ZOAA 1S70A 3H69A 4WWLA 1HO5A 4H2BA 3DSDA 1U32A 4ORAA 1S3MA 2IAEC 4DHLA 3IVDA 3D03A 5B8IA 2NYMC 4TUGA 1OI8A 2WDDA 3PSOA 5INBA 5GTUA 2P6BA 2QFRA 4TUIA 3QG5C 3H60A 3FLOA 5JPEA 4O4KA 2NXFA 1UF3A 2NPPC 1TCOA 2AHDA 4IL1A 3ICFA 3QFOA 3QFKA 4FBKA 2R17A 3H67A 3IB8A 4FBWA 4JA9A 4ORCA 3RL5A 4Q7FA 2WDFA 2Q8UA 4IYPC 4O24A 5C1VA 5J28A 4DSYA 1QFCA 2IE3C 2BCDA 4MP0A 2HYOA 1WARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJC A;  4KBP A;  2BDX A;  1S3N A;  3LL8 A;  5IOH A;  5JJT A;  4ZX2 A;  2DFJ A;  3JYF A;  4V0V A;  4UT2 A;  1S95 A;  3H66 A;  2QFP A;  3H61 A;  5EQV A;  1S8E A;  4ORB A;  4KKZ A;  4ZVZ A;  4DT2 A;  1UTE A;  1Z2W A;  2WDE A;  3DSC A;  4H2I A;  3K7V C;  3EGH A;  2Z72 A;  4LTY A;  4M0V A;  1T71 A;  4MOY A;  2XMO A;  4FCX A;  3CK2 A;  3AUZ A;  3H64 A;  3H62 B;  3RL4 A;  3T1I A;  4J6O A;  1W24 A;  1IT6 A;  2IE4 C;  4G9J A;  2USH A;  4UT3 A;  4B2O A;  3C9F A;  4V0W A;  1USH A;  4OR9 A;  4I5N C;  3C5W C;  1WAO 1;  5DNY A;  1V73 A;  3EGG A;  3N5U A;  4NZV A;  1OIE A;  4JA7 A;  4YKE A;  4UWQ A;  1AUI A;  1FJM A;  1G5B A;  2Z06 A;  2NYL C;  3THN A;  1T70 A;  2JOG A;  2KKN A;  3E7A A;  2O8G A;  1NNW A;  3IVE A;  2YVT A;  3GVE A;  4H2F A;  3AV0 A;  3PSN A;  5HPE A;  3ZTV A;  2ZBM A;  1HP1 A;  2WDC A;  2HY1 A;  1II7 A;  1XM7 A;  3DW8 C;  3FGA C;  1Z2X A;  3KBP A;  1JK7 A;  4O5G A;  3H68 A;  3V4Y A;  1OID A;  1XZW A;  3QFN A;  4H1S A;  2GJU A;  4LAC C;  2O8A A;  3TGH A;  5F3W A;  4V0X A;  4H1Y P;  2HYP A;  2CV9 A;  3ZU0 A;  4UT3 B;  4H2G A;  3RL3 A;  3RQZ A;  4XPN A;  2Z1A A;  1M63 A;  3P71 C;  5JPF A;  3H63 A;  1MF8 A;  4HD0 A;  1HPU A;  1SU1 A;  1S3L A;  3HVQ A;  3QFM A;  4MOV A;  3THO B;  3E7B A;  1KBP A;  4LU9 A;  4FBQ A;  1QHW A;  4I5L C;  2BQ8 X;  4O43 A;  2A22 A;  3IB7 A;  3K7W C;  4F0Z A;  1S70 A;  3H69 A;  4WWL A;  1HO5 A;  4H2B A;  3DSD A;  1U32 A;  4ORA A;  1S3M A;  2IAE C;  4DHL A;  3IVD A;  5B8I A;  2NYM C;  4TUG A;  1OI8 A;  2WDD A;  3PSO A;  5INB A;  5GTU A;  2P6B A;  2QFR A;  4TUI A;  3QG5 C;  3H60 A;  5JPE A;  4O4K A;  2NXF A;  1UF3 A;  2NPP C;  1TCO A;  2AHD A;  4IL1 A;  3ICF A;  3QFO A;  3QFK A;  4FBK A;  2R17 A;  3H67 A;  3IB8 A;  4FBW A;  4JA9 A;  4ORC A;  3RL5 A;  4Q7F A;  2WDF A;  2Q8U A;  4IYP C;  4O24 A;  5C1V A;  5J28 A;  4DSY A;  1QFC A;  2IE3 C;  2BCD A;  4MP0 A;  2HYO A;  1WAR A; 
#chains in the Genus database with same CATH topology
 2QJC A;  4KBP A;  2BDX A;  1S3N A;  3LL8 A;  5IOH A;  5JJT A;  4ZX2 A;  2DFJ A;  3JYF A;  4V0V A;  4UT2 A;  1S95 A;  3H66 A;  2QFP A;  3H61 A;  5EQV A;  1S8E A;  4ORB A;  4KKZ A;  4ZVZ A;  4DT2 A;  1UTE A;  1Z2W A;  2WDE A;  3DSC A;  4H2I A;  3K7V C;  3EGH A;  2Z72 A;  4LTY A;  4M0V A;  1T71 A;  3E0J A;  4MOY A;  2XMO A;  4FCX A;  3CK2 A;  3AUZ A;  3H64 A;  3H62 B;  3RL4 A;  3T1I A;  4J6O A;  1W24 A;  1IT6 A;  2ZO9 B;  2DXL A;  2IE4 C;  4G9J A;  2USH A;  4UT3 A;  4B2O A;  3C9F A;  4V0W A;  1USH A;  4OR9 A;  4I5N C;  3C5W C;  1WAO 1;  5DNY A;  1V73 A;  3EGG A;  3N5U A;  4NZV A;  1OIE A;  4JA7 A;  4YKE A;  4UWQ A;  1AUI A;  1FJM A;  1G5B A;  2Z06 A;  2NYL C;  3THN A;  1T70 A;  2JOG A;  2KKN A;  3E7A A;  2O8G A;  1NNW A;  3IVE A;  2YVT A;  3GVE A;  4H2F A;  3AV0 A;  3PSN A;  5HPE A;  3ZTV A;  2ZBM A;  1HP1 A;  2WDC A;  2HY1 A;  1II7 A;  1XM7 A;  3DW8 C;  3FGA C;  1Z2X A;  3KBP A;  1JK7 A;  4O5G A;  3H68 A;  3V4Y A;  1OID A;  1XZW A;  3QFN A;  2DXN A;  4H1S A;  2GJU A;  4LAC C;  2O8A A;  3TGH A;  5F3W A;  4V0X A;  4H1Y P;  2HYP A;  2CV9 A;  3ZU0 A;  2YEQ A;  4UT3 B;  4H2G A;  3RL3 A;  3RQZ A;  4XPN A;  2Z1A A;  1M63 A;  3P71 C;  5JPF A;  3H63 A;  1MF8 A;  4HD0 A;  1HPU A;  1SU1 A;  1S3L A;  3HVQ A;  3QFM A;  4MOV A;  3THO B;  3E7B A;  1KBP A;  4LU9 A;  4FBQ A;  1QHW A;  4I5L C;  2BQ8 X;  4O43 A;  2A22 A;  3IB7 A;  3K7W C;  4F0Z A;  2ZOA A;  1S70 A;  3H69 A;  4WWL A;  1HO5 A;  4H2B A;  3DSD A;  1U32 A;  4ORA A;  1S3M A;  2IAE C;  4DHL A;  3IVD A;  3D03 A;  5B8I A;  2NYM C;  4TUG A;  1OI8 A;  2WDD A;  3PSO A;  5INB A;  5GTU A;  2P6B A;  2QFR A;  4TUI A;  3QG5 C;  3H60 A;  3FLO A;  5JPE A;  4O4K A;  2NXF A;  1UF3 A;  2NPP C;  1TCO A;  2AHD A;  4IL1 A;  3ICF A;  3QFO A;  3QFK A;  4FBK A;  2R17 A;  3H67 A;  3IB8 A;  4FBW A;  4JA9 A;  4ORC A;  3RL5 A;  4Q7F A;  2WDF A;  2Q8U A;  4IYP C;  4O24 A;  5C1V A;  5J28 A;  4DSY A;  1QFC A;  2IE3 C;  2BCD A;  4MP0 A;  2HYO A;  1WAR A; 
#chains in the Genus database with same CATH homology
 2QJC A;  4KBP A;  2BDX A;  1S3N A;  3LL8 A;  5IOH A;  5JJT A;  4ZX2 A;  2DFJ A;  3JYF A;  4V0V A;  4UT2 A;  1S95 A;  3H66 A;  2QFP A;  3H61 A;  5EQV A;  1S8E A;  4ORB A;  4KKZ A;  4ZVZ A;  4DT2 A;  1UTE A;  1Z2W A;  2WDE A;  3DSC A;  4H2I A;  3K7V C;  3EGH A;  2Z72 A;  4LTY A;  4M0V A;  1T71 A;  3E0J A;  4MOY A;  2XMO A;  4FCX A;  3CK2 A;  3AUZ A;  3H64 A;  3H62 B;  3RL4 A;  3T1I A;  4J6O A;  1W24 A;  1IT6 A;  2ZO9 B;  2DXL A;  2IE4 C;  4G9J A;  2USH A;  4UT3 A;  4B2O A;  3C9F A;  4V0W A;  1USH A;  4OR9 A;  4I5N C;  3C5W C;  1WAO 1;  5DNY A;  1V73 A;  3EGG A;  3N5U A;  4NZV A;  1OIE A;  4JA7 A;  4YKE A;  4UWQ A;  1AUI A;  1FJM A;  1G5B A;  2Z06 A;  2NYL C;  3THN A;  1T70 A;  2JOG A;  2KKN A;  3E7A A;  2O8G A;  1NNW A;  3IVE A;  2YVT A;  3GVE A;  4H2F A;  3AV0 A;  3PSN A;  5HPE A;  3ZTV A;  2ZBM A;  1HP1 A;  2WDC A;  2HY1 A;  1II7 A;  1XM7 A;  3DW8 C;  3FGA C;  1Z2X A;  3KBP A;  1JK7 A;  4O5G A;  3H68 A;  3V4Y A;  1OID A;  1XZW A;  3QFN A;  2DXN A;  4H1S A;  2GJU A;  4LAC C;  2O8A A;  3TGH A;  5F3W A;  4V0X A;  4H1Y P;  2HYP A;  2CV9 A;  3ZU0 A;  2YEQ A;  4UT3 B;  4H2G A;  3RL3 A;  3RQZ A;  4XPN A;  2Z1A A;  1M63 A;  3P71 C;  5JPF A;  3H63 A;  1MF8 A;  4HD0 A;  1HPU A;  1SU1 A;  1S3L A;  3HVQ A;  3QFM A;  4MOV A;  3THO B;  3E7B A;  1KBP A;  4LU9 A;  4FBQ A;  1QHW A;  4I5L C;  2BQ8 X;  4O43 A;  2A22 A;  3IB7 A;  3K7W C;  4F0Z A;  2ZOA A;  1S70 A;  3H69 A;  4WWL A;  1HO5 A;  4H2B A;  3DSD A;  1U32 A;  4ORA A;  1S3M A;  2IAE C;  4DHL A;  3IVD A;  3D03 A;  5B8I A;  2NYM C;  4TUG A;  1OI8 A;  2WDD A;  3PSO A;  5INB A;  5GTU A;  2P6B A;  2QFR A;  4TUI A;  3QG5 C;  3H60 A;  3FLO A;  5JPE A;  4O4K A;  2NXF A;  1UF3 A;  2NPP C;  1TCO A;  2AHD A;  4IL1 A;  3ICF A;  3QFO A;  3QFK A;  4FBK A;  2R17 A;  3H67 A;  3IB8 A;  4FBW A;  4JA9 A;  4ORC A;  3RL5 A;  4Q7F A;  2WDF A;  2Q8U A;  4IYP C;  4O24 A;  5C1V A;  5J28 A;  4DSY A;  1QFC A;  2IE3 C;  2BCD A;  4MP0 A;  2HYO A;  1WAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...