2NYMC

Crystal structure of protein phosphatase 2a (pp2a) with c-terminus truncated catalytic subunit
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
293
structure length
293
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 2
publication title Structure of the Protein Phosphatase 2A Holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 293
sequence length 293
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nymC00
1M63A 3PSNA 4I5LC 4H2IA 1V73A 3GVEA 2AHDA 3IVDA 3EGHA 3TGHA 2Q8UA 5EQVA 1SU1A 2YVTA 3ZTVA 3QFOA 3LL8A 3EGGA 4H2GA 3ZU0A 4WWLA 3H66A 2Z1AA 3K7VC 4UWQA 2WDDA 1II7A 5F3WA 3H61A 3P71C 2XMOA 4F0ZA 1Z2XA 4IYPC 4NZVA 1OI8A 1S95A 2WDFA 4H2BA 4M0VA 3H68A 4IL1A 2IAEC 2GJUA 1S3LA 1WARA 3IVEA 4KKZA 4MP0A 2IE4C 3H60A 4ZX2A 1HO5A 4MOVA 2NYMC 3RQZA 4UT3B 4V0XA 5GTUA 3DSDA 2IE3C 3FGAC 4V0VA 4FBQA 4ZVZA 2WDEA 1UTEA 3RL5A 1QHWA 3QFMA 1IT6A 2WDCA 1U32A 3H62B 4ORAA 2QFPA 1S3MA 4ORCA 1MF8A 3HVQA 2O8AA 2NPPC 1KBPA 1XZWA 5JPEA 2BDXA 3DW8C 1HP1A 1OIEA 2CV9A 4H1SA 5INBA 2QJCA 1NNWA 3QG5C 1OIDA 3E7AA 1W24A 4H2FA 4J6OA 3H64A 2NXFA 3QFNA 4O24A 4G9JA 1JK7A 3E7BA 5JPFA 2HYPA 5J28A 5DNYA 3H67A 1S70A 3K7WC 1QFCA 4FBWA 1USHA 2ZBMA 4JA7A 4KBPA 1S8EA 2HY1A 2Z06A 4LU9A 4O5GA 4DSYA 3KBPA 4V0WA 1XM7A 3THOB 3CK2A 3IB8A 4OR9A 4FBKA 3RL4A 4UT2A 2JOGA 2KKNA 2DFJA 2NYLC 3IB7A 4I5NC 1T71A 3H63A 4LTYA 5C1VA 3V4YA 1Z2WA 3H69A 3DSCA 1T70A 2A22A 2BQ8X 4Q7FA 4TUGA 4B2OA 4JA9A 1UF3A 1AUIA 2USHA 3JYFA 4TUIA 3THNA 2HYOA 1S3NA 1FJMA 3T1IA 4LACC 4DHLA 3C5WC 3QFKA 4FCXA 5HPEA 1HPUA 3AV0A 3ICFA 3PSOA 4YKEA 1TCOA 1WAO1 2O8GA 4HD0A 4UT3A 5JJTA 4XPNA 4MOYA 2Z72A 2R17A 3N5UA 2QFRA 3C9FA 4H1YP 4ORBA 5IOHA 4DT2A 1G5BA 4O43A 2BCDA 5B8IA 3AUZA 4O4KA 3RL3A 2P6BA
chains in the Genus database with same CATH superfamily
1M63A 3PSNA 4I5LC 4H2IA 1V73A 3GVEA 2AHDA 3IVDA 3EGHA 3TGHA 2Q8UA 2YEQA 5EQVA 1SU1A 2YVTA 3ZTVA 3QFOA 3LL8A 3EGGA 4H2GA 3ZU0A 3D03A 4WWLA 3H66A 2Z1AA 3K7VC 4UWQA 2WDDA 1II7A 5F3WA 3H61A 3P71C 2XMOA 4F0ZA 1Z2XA 4IYPC 4NZVA 1OI8A 1S95A 2WDFA 4H2BA 4M0VA 3H68A 4IL1A 2IAEC 2GJUA 1S3LA 1WARA 3IVEA 4KKZA 4MP0A 2IE4C 3H60A 4ZX2A 1HO5A 4MOVA 2NYMC 3RQZA 4UT3B 4V0XA 5GTUA 3DSDA 2IE3C 3FGAC 4V0VA 4FBQA 4ZVZA 2WDEA 1UTEA 2DXNA 3RL5A 1QHWA 3QFMA 1IT6A 2DXLA 1U32A 2WDCA 2ZO9B 2QFPA 3H62B 1S3MA 4ORCA 4ORAA 1MF8A 3HVQA 2O8AA 2NPPC 1KBPA 1XZWA 5JPEA 2BDXA 3DW8C 1HP1A 1OIEA 2CV9A 4H1SA 5INBA 2QJCA 1NNWA 3QG5C 1OIDA 3E7AA 1W24A 4H2FA 4J6OA 3H64A 2NXFA 3QFNA 4O24A 4G9JA 1JK7A 3FLOA 3E7BA 2ZOAA 2HYPA 5JPFA 5J28A 5DNYA 3H67A 1S70A 3K7WC 1QFCA 4FBWA 1USHA 2ZBMA 4JA7A 4KBPA 1S8EA 2HY1A 2Z06A 4LU9A 4O5GA 4DSYA 3KBPA 4V0WA 1XM7A 3THOB 3CK2A 3IB8A 4OR9A 4FBKA 3RL4A 4UT2A 2JOGA 2KKNA 2DFJA 2NYLC 3IB7A 4I5NC 1T71A 3H63A 4LTYA 5C1VA 3V4YA 1Z2WA 3H69A 3DSCA 1T70A 2A22A 2BQ8X 4Q7FA 4TUGA 4B2OA 4JA9A 1UF3A 1AUIA 2USHA 3JYFA 4TUIA 3THNA 2HYOA 1S3NA 1FJMA 3T1IA 4LACC 4DHLA 3C5WC 3QFKA 4FCXA 5HPEA 1HPUA 3AV0A 3E0JA 3ICFA 3PSOA 4YKEA 1TCOA 1WAO1 2O8GA 4HD0A 4UT3A 5JJTA 4XPNA 4MOYA 2Z72A 2R17A 3N5UA 2QFRA 3C9FA 4H1YP 4ORBA 5IOHA 4DT2A 1G5BA 4O43A 2BCDA 5B8IA 3AUZA 4O4KA 3RL3A 2P6BA
chains in the Genus database with same CATH topology
1M63A 3PSNA 4I5LC 4H2IA 1V73A 3GVEA 2AHDA 3IVDA 3EGHA 3TGHA 2Q8UA 2YEQA 5EQVA 1SU1A 2YVTA 3ZTVA 3QFOA 3LL8A 3EGGA 4H2GA 3ZU0A 3D03A 4WWLA 3H66A 2Z1AA 3K7VC 4UWQA 2WDDA 1II7A 5F3WA 3H61A 3P71C 2XMOA 4F0ZA 1Z2XA 4IYPC 4NZVA 1OI8A 1S95A 2WDFA 4H2BA 4M0VA 3H68A 4IL1A 2IAEC 2GJUA 1S3LA 1WARA 3IVEA 4KKZA 4MP0A 2IE4C 3H60A 4ZX2A 1HO5A 4MOVA 2NYMC 3RQZA 4UT3B 4V0XA 5GTUA 3DSDA 2IE3C 3FGAC 4V0VA 4FBQA 4ZVZA 2WDEA 1UTEA 2DXNA 3RL5A 1QHWA 3QFMA 1IT6A 2DXLA 1U32A 2WDCA 2ZO9B 2QFPA 3H62B 1S3MA 4ORCA 4ORAA 1MF8A 3HVQA 2O8AA 2NPPC 1KBPA 1XZWA 5JPEA 2BDXA 3DW8C 1HP1A 1OIEA 2CV9A 4H1SA 5INBA 2QJCA 1NNWA 3QG5C 1OIDA 3E7AA 1W24A 4H2FA 4J6OA 3H64A 2NXFA 3QFNA 4O24A 4G9JA 1JK7A 3FLOA 3E7BA 2ZOAA 2HYPA 5JPFA 5J28A 5DNYA 3H67A 1S70A 3K7WC 1QFCA 4FBWA 1USHA 2ZBMA 4JA7A 4KBPA 1S8EA 2HY1A 2Z06A 4LU9A 4O5GA 4DSYA 3KBPA 4V0WA 1XM7A 3THOB 3CK2A 3IB8A 4OR9A 4FBKA 3RL4A 4UT2A 2JOGA 2KKNA 2DFJA 2NYLC 3IB7A 4I5NC 1T71A 3H63A 4LTYA 5C1VA 3V4YA 1Z2WA 3H69A 3DSCA 1T70A 2A22A 2BQ8X 4Q7FA 4TUGA 4B2OA 4JA9A 1UF3A 1AUIA 2USHA 3JYFA 4TUIA 3THNA 2HYOA 1S3NA 1FJMA 3T1IA 4LACC 4DHLA 3C5WC 3QFKA 4FCXA 5HPEA 1HPUA 3AV0A 3E0JA 3ICFA 3PSOA 4YKEA 1TCOA 1WAO1 2O8GA 4HD0A 4UT3A 5JJTA 4XPNA 4MOYA 2Z72A 2R17A 3N5UA 2QFRA 3C9FA 4H1YP 4ORBA 5IOHA 4DT2A 1G5BA 4O43A 2BCDA 5B8IA 3AUZA 4O4KA 3RL3A 2P6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M63 A;  3PSN A;  4I5L C;  4H2I A;  1V73 A;  3GVE A;  2AHD A;  3IVD A;  3EGH A;  3TGH A;  2Q8U A;  5EQV A;  1SU1 A;  2YVT A;  3ZTV A;  3QFO A;  3LL8 A;  3EGG A;  4H2G A;  3ZU0 A;  4WWL A;  3H66 A;  2Z1A A;  3K7V C;  4UWQ A;  2WDD A;  1II7 A;  5F3W A;  3H61 A;  3P71 C;  2XMO A;  4F0Z A;  1Z2X A;  4IYP C;  4NZV A;  1OI8 A;  1S95 A;  2WDF A;  4H2B A;  4M0V A;  3H68 A;  4IL1 A;  2IAE C;  2GJU A;  1S3L A;  1WAR A;  3IVE A;  4KKZ A;  4MP0 A;  2IE4 C;  3H60 A;  4ZX2 A;  1HO5 A;  4MOV A;  2NYM C;  3RQZ A;  4UT3 B;  4V0X A;  5GTU A;  3DSD A;  2IE3 C;  3FGA C;  4V0V A;  4FBQ A;  4ZVZ A;  2WDE A;  1UTE A;  3RL5 A;  1QHW A;  3QFM A;  1IT6 A;  2WDC A;  1U32 A;  3H62 B;  4ORA A;  2QFP A;  1S3M A;  4ORC A;  1MF8 A;  3HVQ A;  2O8A A;  2NPP C;  1KBP A;  1XZW A;  5JPE A;  2BDX A;  3DW8 C;  1HP1 A;  1OIE A;  2CV9 A;  4H1S A;  5INB A;  2QJC A;  1NNW A;  3QG5 C;  1OID A;  3E7A A;  1W24 A;  4H2F A;  4J6O A;  3H64 A;  2NXF A;  3QFN A;  4O24 A;  4G9J A;  1JK7 A;  3E7B A;  5JPF A;  2HYP A;  5J28 A;  5DNY A;  3H67 A;  1S70 A;  3K7W C;  1QFC A;  4FBW A;  1USH A;  2ZBM A;  4JA7 A;  4KBP A;  1S8E A;  2HY1 A;  2Z06 A;  4LU9 A;  4O5G A;  4DSY A;  3KBP A;  4V0W A;  1XM7 A;  3THO B;  3CK2 A;  3IB8 A;  4OR9 A;  4FBK A;  3RL4 A;  4UT2 A;  2JOG A;  2KKN A;  2DFJ A;  2NYL C;  3IB7 A;  4I5N C;  1T71 A;  3H63 A;  4LTY A;  5C1V A;  3V4Y A;  1Z2W A;  3H69 A;  3DSC A;  1T70 A;  2A22 A;  2BQ8 X;  4Q7F A;  4TUG A;  4B2O A;  4JA9 A;  1UF3 A;  1AUI A;  2USH A;  3JYF A;  4TUI A;  3THN A;  2HYO A;  1S3N A;  1FJM A;  3T1I A;  4LAC C;  4DHL A;  3C5W C;  3QFK A;  4FCX A;  5HPE A;  1HPU A;  3AV0 A;  3ICF A;  3PSO A;  4YKE A;  1TCO A;  1WAO 1;  2O8G A;  4HD0 A;  4UT3 A;  5JJT A;  4XPN A;  4MOY A;  2Z72 A;  2R17 A;  3N5U A;  2QFR A;  3C9F A;  4H1Y P;  4ORB A;  5IOH A;  4DT2 A;  1G5B A;  4O43 A;  2BCD A;  5B8I A;  3AUZ A;  4O4K A;  3RL3 A;  2P6B A; 
#chains in the Genus database with same CATH topology
 1M63 A;  3PSN A;  4I5L C;  4H2I A;  1V73 A;  3GVE A;  2AHD A;  3IVD A;  3EGH A;  3TGH A;  2Q8U A;  2YEQ A;  5EQV A;  1SU1 A;  2YVT A;  3ZTV A;  3QFO A;  3LL8 A;  3EGG A;  4H2G A;  3ZU0 A;  3D03 A;  4WWL A;  3H66 A;  2Z1A A;  3K7V C;  4UWQ A;  2WDD A;  1II7 A;  5F3W A;  3H61 A;  3P71 C;  2XMO A;  4F0Z A;  1Z2X A;  4IYP C;  4NZV A;  1OI8 A;  1S95 A;  2WDF A;  4H2B A;  4M0V A;  3H68 A;  4IL1 A;  2IAE C;  2GJU A;  1S3L A;  1WAR A;  3IVE A;  4KKZ A;  4MP0 A;  2IE4 C;  3H60 A;  4ZX2 A;  1HO5 A;  4MOV A;  2NYM C;  3RQZ A;  4UT3 B;  4V0X A;  5GTU A;  3DSD A;  2IE3 C;  3FGA C;  4V0V A;  4FBQ A;  4ZVZ A;  2WDE A;  1UTE A;  2DXN A;  3RL5 A;  1QHW A;  3QFM A;  1IT6 A;  2DXL A;  1U32 A;  2WDC A;  2ZO9 B;  2QFP A;  3H62 B;  1S3M A;  4ORC A;  4ORA A;  1MF8 A;  3HVQ A;  2O8A A;  2NPP C;  1KBP A;  1XZW A;  5JPE A;  2BDX A;  3DW8 C;  1HP1 A;  1OIE A;  2CV9 A;  4H1S A;  5INB A;  2QJC A;  1NNW A;  3QG5 C;  1OID A;  3E7A A;  1W24 A;  4H2F A;  4J6O A;  3H64 A;  2NXF A;  3QFN A;  4O24 A;  4G9J A;  1JK7 A;  3FLO A;  3E7B A;  2ZOA A;  2HYP A;  5JPF A;  5J28 A;  5DNY A;  3H67 A;  1S70 A;  3K7W C;  1QFC A;  4FBW A;  1USH A;  2ZBM A;  4JA7 A;  4KBP A;  1S8E A;  2HY1 A;  2Z06 A;  4LU9 A;  4O5G A;  4DSY A;  3KBP A;  4V0W A;  1XM7 A;  3THO B;  3CK2 A;  3IB8 A;  4OR9 A;  4FBK A;  3RL4 A;  4UT2 A;  2JOG A;  2KKN A;  2DFJ A;  2NYL C;  3IB7 A;  4I5N C;  1T71 A;  3H63 A;  4LTY A;  5C1V A;  3V4Y A;  1Z2W A;  3H69 A;  3DSC A;  1T70 A;  2A22 A;  2BQ8 X;  4Q7F A;  4TUG A;  4B2O A;  4JA9 A;  1UF3 A;  1AUI A;  2USH A;  3JYF A;  4TUI A;  3THN A;  2HYO A;  1S3N A;  1FJM A;  3T1I A;  4LAC C;  4DHL A;  3C5W C;  3QFK A;  4FCX A;  5HPE A;  1HPU A;  3AV0 A;  3E0J A;  3ICF A;  3PSO A;  4YKE A;  1TCO A;  1WAO 1;  2O8G A;  4HD0 A;  4UT3 A;  5JJT A;  4XPN A;  4MOY A;  2Z72 A;  2R17 A;  3N5U A;  2QFR A;  3C9F A;  4H1Y P;  4ORB A;  5IOH A;  4DT2 A;  1G5B A;  4O43 A;  2BCD A;  5B8I A;  3AUZ A;  4O4K A;  3RL3 A;  2P6B A; 
#chains in the Genus database with same CATH homology
 1M63 A;  3PSN A;  4I5L C;  4H2I A;  1V73 A;  3GVE A;  2AHD A;  3IVD A;  3EGH A;  3TGH A;  2Q8U A;  2YEQ A;  5EQV A;  1SU1 A;  2YVT A;  3ZTV A;  3QFO A;  3LL8 A;  3EGG A;  4H2G A;  3ZU0 A;  3D03 A;  4WWL A;  3H66 A;  2Z1A A;  3K7V C;  4UWQ A;  2WDD A;  1II7 A;  5F3W A;  3H61 A;  3P71 C;  2XMO A;  4F0Z A;  1Z2X A;  4IYP C;  4NZV A;  1OI8 A;  1S95 A;  2WDF A;  4H2B A;  4M0V A;  3H68 A;  4IL1 A;  2IAE C;  2GJU A;  1S3L A;  1WAR A;  3IVE A;  4KKZ A;  4MP0 A;  2IE4 C;  3H60 A;  4ZX2 A;  1HO5 A;  4MOV A;  2NYM C;  3RQZ A;  4UT3 B;  4V0X A;  5GTU A;  3DSD A;  2IE3 C;  3FGA C;  4V0V A;  4FBQ A;  4ZVZ A;  2WDE A;  1UTE A;  2DXN A;  3RL5 A;  1QHW A;  3QFM A;  1IT6 A;  2DXL A;  1U32 A;  2WDC A;  2ZO9 B;  2QFP A;  3H62 B;  1S3M A;  4ORC A;  4ORA A;  1MF8 A;  3HVQ A;  2O8A A;  2NPP C;  1KBP A;  1XZW A;  5JPE A;  2BDX A;  3DW8 C;  1HP1 A;  1OIE A;  2CV9 A;  4H1S A;  5INB A;  2QJC A;  1NNW A;  3QG5 C;  1OID A;  3E7A A;  1W24 A;  4H2F A;  4J6O A;  3H64 A;  2NXF A;  3QFN A;  4O24 A;  4G9J A;  1JK7 A;  3FLO A;  3E7B A;  2ZOA A;  2HYP A;  5JPF A;  5J28 A;  5DNY A;  3H67 A;  1S70 A;  3K7W C;  1QFC A;  4FBW A;  1USH A;  2ZBM A;  4JA7 A;  4KBP A;  1S8E A;  2HY1 A;  2Z06 A;  4LU9 A;  4O5G A;  4DSY A;  3KBP A;  4V0W A;  1XM7 A;  3THO B;  3CK2 A;  3IB8 A;  4OR9 A;  4FBK A;  3RL4 A;  4UT2 A;  2JOG A;  2KKN A;  2DFJ A;  2NYL C;  3IB7 A;  4I5N C;  1T71 A;  3H63 A;  4LTY A;  5C1V A;  3V4Y A;  1Z2W A;  3H69 A;  3DSC A;  1T70 A;  2A22 A;  2BQ8 X;  4Q7F A;  4TUG A;  4B2O A;  4JA9 A;  1UF3 A;  1AUI A;  2USH A;  3JYF A;  4TUI A;  3THN A;  2HYO A;  1S3N A;  1FJM A;  3T1I A;  4LAC C;  4DHL A;  3C5W C;  3QFK A;  4FCX A;  5HPE A;  1HPU A;  3AV0 A;  3E0J A;  3ICF A;  3PSO A;  4YKE A;  1TCO A;  1WAO 1;  2O8G A;  4HD0 A;  4UT3 A;  5JJT A;  4XPN A;  4MOY A;  2Z72 A;  2R17 A;  3N5U A;  2QFR A;  3C9F A;  4H1Y P;  4ORB A;  5IOH A;  4DT2 A;  1G5B A;  4O43 A;  2BCD A;  5B8I A;  3AUZ A;  4O4K A;  3RL3 A;  2P6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...