2NYUA

Crystal structure of human ftsj homolog 2 (e.coli) protein in complex with s-adenosylmethionine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
181
Chain Sequence
b'SYRSRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEVYFLATQYHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ribosomal RNA methyltransferase 2
publication title The Crystal Structure of Human FtsJ homolog 2 (E.coli) protein in complex with AdoMet
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 52
structure length 181
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2nyuA00
2I62A 3G88A 3NJRA 3T7TA 2ZIFA 2C7PA 3PX3A 2IP2A 3KPWA 1JSXA 4BP1A 3EVGA 4RVFA 4X41A 4ATNA 2YVLA 5E2AA 4E32A 2P41A 2VDVE 3Q87B 2ZW9A 1UFKA 1X1CA 2ZULA 4F85A 3A7DA 5E9QA 1JTFA 5CCXA 1BOOA 3PB3A 1O9HA 3GU3A 5KQRA 1IM8A 2IFTA 2EJTA 3UJ7A 1RI5A 2GAFA 4RTLA 4E2WA 1O54A 4O29A 3TFWA 3KR2A 2BR3A 4KRGA 2BM8A 3E23A 3OU6A 3ER9A 2G8NA 2XYQA 4RVGA 5EMJA 5P8WA 3SSNA 4DQ0A 5CVDA 3C0KA 5LQAA 2P3OA 3HCDA 3GGDA 4V0RA 1EQAA 1G55A 3CC8A 3OZTA 3CJRA 3F4KA 3KQTA 5K0JA 1SG9A 1FJXA 3KQQA 3ELUA 3X0DA 2BR4A 1AV6A 3DXYA 2R6ZA 2V7EA 5FWDA 1SUSA 3HCCA 1WZNA 2EG5A 1R6AA 3A26A 3E8SA 2NXNA 3EVBA 5K03A 4AZSA 3G8BA 3NDIA 3KHKA 1I1NA 2EX4A 1RI4A 4PGHA 5T64A 2JH9A 5E1OA 4ER3A 4HSGA 4GC5A 5EKUA 4UOEA 2OKCA 3OE5A 3R9XB 1M6YA 3EVZA 3LDFA 3A27A 2P40A 2O05A 3ME5A 4RV9A 4AZTA 2IPXA 2ZLBA 3GRVA 1VQ1A 3G89A 2EJUA 4OBXA 3OU2A 1KPIA 3EMDA 4EMSA 4RVHA 2JHAA 1HMYA 4E30A 4PYJA 5F2NA 2PWPA 3MHTA 2UYHA 2Y1WA 2ZBQA 5CIYA 5M5BA 1NW6A 4OQEA 4E2XA 1WS6A 2HV9A 3EVDA 1VIDA 4P7JA 2OBFA 3ID6C 3UJAA 4EK9A 1YUBA 5ICGA 3IHTA 5HEKA 1NE2A 2LD4A 3ELYA 4CTKA 3DTNA 2PXXA 2OB2A 1WG8A 1KIAA 4QQNA 5EEGA 3V97A 5E1BA 4RTRA 3CKKA 3NTVA 4RX1A 5E9WA 4AX8A 3KU1A 2BM9A 5EIFA 5EQJB 2O57A 3T7SA 5K05A 1SQFA 4PYQA 1L3IA 4GOLD 2QM3A 3HVHA 2R3SA 2CKDA 4LWOA 3RODA 4M7RA 3BWMA 3VC2A 4EVIA 4QTUB 4CKEA 5K01A 2ZZNA 2ZZMA 2O07A 3EVAA 2N47A 5ICFA 3ANXA 2ZTHA 4HC4A 5ICCA 3EEYA 4RTNA 2I6GA 4R6XA 5GIPE 4OA8A 2P1DA 4E31A 1G6Q1 1XDZA 4YUXA 4PCLA 3MTIA 2YXDA 3KQOA 5FA8A 5DXAA 3ELWA 1KYWA 1NW7A 3IYLW 5CCBA 4ER0A 2AOXA 1RJGA 4CKCA 1NW5A 3REOA 4XUEA 4PYNA 5CVVA 4GBED 4ZTBA 3AXSA 3NDJA 2FCAA 4E70A 3EEOA 5FUBA 1KPGA 2ZWAA 1XCLA 2PY6A 5LQKA 3FPJA 3LBFA 1X1BA 2OZVA 5GWXA 5DT2A 1RI3A 5E9JA 4QPNA 3DLCA 2IBSA 3JWGA 4PYOA 3R6TA 3MB5A 2H00A 3BGVA 3DMFA 4G56A 2BZGA 1QAOA 2JHPA 5CVEA 5EMMA 4DCGA 5ICEA 5K09A 3FRHA 2Y1XA 1I9GA 5JR3A 1NV8A 1YZ3A 2ERCA 4DM3A 1NV9A 1VLMA 4MIKA 1KP9A 2F8LA 5FHRA 3G2QA 2ZBPA 4PYMA 4PINA 3M6WA 2HR1A 1IY9A 1N7JA 1SUIA 3D2LA 3DH0A 1KYZA 3P9KA 2JHCA 1BC5A 1KR5A 4Y2HA 2AOUB 3FTCA 4GUAA 5DX8A 5EGSA 3S68A 1D2CA 3M4XA 5GINE 2G70A 3ERCA 4BP3A 3UJ8A 4DCMA 4K6MA 2ONZA 5KQSA 4OA5A 1JQ3A 3TR6A 3TRKA 5DRTA 1L1EA 3SSMA 1DUSA 1EIZA 2ORED 3E7PA 2YXLA 2ESRA 5DM2A 4C05A 4KW7A 4YV0A 3P2IA 4F86A 1Z3CA 4XUDA 1TPYA 3IEIA 1P39A 1BKYA 2AOUA 3C3PA 1QZZA 3E05A 3KR1A 3LCUA 1M6EX 3LPMA 5KS2A 1AQJA 4YUVA 1HNNA 1NBIA 2C7RA 1VP9A 5E8JA 4KWCA 1KXZA 3R0QA 5K0EA 2NNWB 1NT2A 2CWWA 4QVGA 3CVOA 4XCXA 5E2BA 3HCFA 3QV2A 4FSXA 1NBHA 3BUSA 3FTEA 1QAQA 4RYLA 3DR5A 2GB4A 1NKVA 1ZGJA 2PV0A 1U2ZA 1QAMA 2G72A 5K0CA 4E2ZA 5CVUA 2EFJA 2PGXA 3B5IA 2HWKA 1EJ6A 1JQDA 3G5TA 2QYOA 4KVZA 5E8RA 3BGDA 1O9GA 2AR0A 4C03A 5E1DA 2IBTA 3RW9A 1H1DA 4F84A 4M36A 3H2BA 4GOND 3TPZA 4DKJA 3DUWA 2PWYA 2YTZA 3HP7A 3JWHA 5DXJA 2ZZKA 4QDKA 4X63A 3RIEA 3GRYA 4IV0A 2ADMA 3BWBA 3LCCA 3GDHA 4GEKA 4X1OA 3TLJA 3MAGA 3VYWA 4BY9E 2B78A 2H1RA 5K0NA 2OPBA 2PJDA 2ONYA 4A6EA 3AY0A 3KPUA 1WY7A 5FULA 1M0EA 5FHQA 4C08A 5DWQA 2AZTA 4QTTB 4QVKA 3I9FA 3LKDA 4B17A 3V8VA 2B9EA 4C07A 3GIWA 2ZIEA 3GCZA 1RJDA 4DF3A 4HGYA 4PGGA 3T7RA 2Z6UA 2XBMA 2FPOA 2B2CA 5HIJA 5D1HA 4YMGA 4E2YA 3ELDA 1SQGA 3KQPA 3NVMB 5MHTA 1L3BA 3G7UA 3QOWA 4PCAA 2AN4A 2GLUA 3LECA 3VC1A 3FUUA 2FRXA 3EVCA 5DM1A 1OR8A 3P9IA 2ZVJA 3UBTA 2UYOA 3ORHA 4PYKA 3T0IA 3I64A 1IXKA 5HOQA 3BZBA 3BT7A 2AOWA 1N7IA 1RJFA 1F3LA 2AOVA 5FQNA 2G1PA 2DPMA 3MERA 5LR6A 4MTLA 4POOA 1ZQ9A 5HFJA 5HIIA 3B89A 3B3JA 4DZRA 2YR0A 4P7GA 2QY6A 4RSRA 2GPYA 3AWIA 1FP2A 3NWEA 5B1SA 3OE4A 2IDKA 5T67A 3FUTA 5EHGA 3UWPA 3FYDA 3NVKI 4GOMD 1G38A 3TM5A 4FZVA 5BXYA 3LHDA 2IGTA 3P2EA 1NW3A 2PVCA 2AOTB 2GS9A 4C04A 3FPFA 4EKIA 4WVLA 3BWCA 3TQSA 3HA3A 5U4XA 4RTKA 3DULA 3C6KA 3FYCA 5C1IA 3PVCA 5H02A 3HTXA 4YUZA 2OYRA 3TOSA 2HMYB 5GP1A 2XYVA 2FK8A 1FBNA 1YZHA 5C0OE 4GC9A 4BLUA 1SVUA 4YV1A 3AJDA 5HIKA 4WXHA 1L9KA 2ZWVA 3KKZA 1G60A 2WA2A 3BKWA 5DPMA 2OXTA 3K0BA 5EIWA 2B25A 4QQKA 1XXLA 1QANA 2K4MA 5EKXA 4BLVA 1P91A 4ER7A 3M33A 4HH4A 2IH4A 5BW4A 1YFJA 3R3HA 2P7IA 2AOTA 3CBGA 2PX2A 1FPQA 3HA5A 4R6WA 3EGEA 3CJTA 2YUIA 3PLAE 1JG3A 4P58A 3FUWA 3CJQA 2IH5A 5FADA 3G8AA 1VP3A 3DMGA 2FHPA 1T43A 3ER8A 3HNRA 4OQDA 3GXOA 3OFJA 1INLA 5FTWA 5IKMA 4LWPA 1KHHA 2P3QA 3M6XA 2ZFUA 4RVDA 5IH3A 2UZ4A 3KQWA 1TW3A 4FSDA 5EG5A 4CXMA 5DRYA 3NW9A 3LBYA 2V74B 3IV6A 3M6UA 4RTOA 3JWIA 2PLWA 2WK1A 8MHTA 1JG4A 3O4FA 2P3LA 2AN3A 3U81A 1VBFA 3FUXA 2HNKA 3DXXA 2CMHA 5EOVA 2ZIGA 3FUVA 2IH2A 2PXAA 1NW8A 3UJCA 3UJDA 3G2MA 3KQSA 4PYIA 3AXTA 3DXZA 3HVJA 3P71T 4LECA 1UIRA 4V0QA 4DA4A 3UA4A 5DTRA 4RTQA 3FZGA 1JTEA 5DLYA 4QDJA 2GH1A 4KIFA 2PX5A 2NYUA 3GRZA 4LG1A 4CKBA 4P7FA 1SKMA 1MJFA 4GQBA 5FWAA 2A14A 2E5WA 5EPEA 2I9KA 2HTEA 2OB1A 2VDWA 1XTPA 3THSA 5BP7A 3B3FA 4PIMA 4XUCA 2FK7A 3G2PA 3C6MA 1RJEA 2G71A 1XDUA 3GNLA 4M37A 4MWZA 1JQEA 2IDJA 1EAMA 4M38A 3MGGA 4YMHA 4RTJA 2KW5A 3I5UA 4MQ4A 3P9NA 3HM2A 4FGZA 4RTPA 1YF3A 3FPHA 4KDRA 4U7PB 5ERGB 3KPVA 4R8RA 5FCDA 1WXWA 2BR5A 2JG3A 2Z6QA 3CGGA 3GRUA 2I7CA 4ER6A 7MHTA 4NECA 2PXCA 3LDUA 2OO3A 3A25A 1R8YA 3EGVA 4FR0A 3KR9A 3THRA 4HRAA 1YB2A 4FS8A 4AZVA 3MQ2A 3R24A 2JJQA 3LCVB 2QRVB 4FT4A 1X19A 1PJZA 2PSSA 1BHJA 2XYRA 3LX6A 3LKZA 3KQMA 2P7HA 1B42A 2P8JA 3KQYA 4PWYA 4IWNA 4RWZA 5HIMA 4OBWA 5DTMA 2IIPA 1XVAA 3UFBA 3JWJA 1XCJA 3FPGA 3KPYA 3PX2A 3SM3A 4ISCA 3OPNA 5DX1A 3HVKA 3DMHA 3FPEA 2CL5A 4RTMA 5HZMA 4Y30A 2DULA 1DCTA 4PNEA 3OZRA 3KR0A 5D1NA 2QE6A 2AS0A 5GM2A 3EVFA 4KIGA 1UWVA 2UYCA 2NXCA 2O0LA 2QRVA 4KDCA 3MCZA 2YXEA 3UJ9A 4CWAA 3P9CA 4X61A 4A6DA 3OZSA 1EG2A 3HVIA 3HEMA 5FA5A 1DL5A 1D2HA 1L3CA 3C3YA 3SXJA 1R18A 4PIPA 4MHTA 2PKWA 1D2GA 3P2KA 5K0GA 2ZBRA 3PFGA 5GOZA 5JUWA 4E33A 3GRRA 3VSEA 1Q0SA 5EVJA 3EGIA 5K0LA 3FTFA 1WXXA 3DLIA 2CMGA 3DP7A 5F2OA 3SX0A 4C4AA 3MCTA 1Y8CA 4IKPA 2Z6AA 2YX1A 1TW2A 3O31A 2OY0A 5BW5A 1KPHA 2JH8A 5EEHA 4GF5A 3PS9A 5K0BA 4Z2YA 2B3TA 9MHTA 5KYGA 3BGIA 3EVEA 3FRIA 1XJ5A 4H0NA 3UA3A 5K8VA 1RI2A 4PONA 3PFHA 3TMAA 2O06A 4EQZA 2GA9A 2BH2A 4FT2A 1R00A 3HCAA 3TM4A 3OFKA 3UZUA 1ORIA 3Q7EA 5E1MA 3PTAA 1R74A 1JR4A 4HG2A 5EC8A 2Q41A 2AVNA 3HA7A 1P1BA 2VZ9A 3MTEA 5DM0A 3TKYA 3NMUF 2UYQA 3LDGA 1Q0TA 1VPTA 3BKXA 5EZQA 1P1CA 1VL5A 3SVZA 1G8AA 2ZCJA 1QYRA 2H11A 4AUKA 2PBFA 3BXOA 5T6BA 1X1AA 4X60A 1MHTA 2XVMA 3SSOA 4DMGA 4HTFB 1N2XA 3NWBA 4OX9Y 1FP1D 5K0FA 1ZGAA 5CUQA 1JSZA 2PT6A 3SMQA 3HCEA 2PT9A 3CCFA 4YV2A 1VE3A 3LGAA 2XVAA 1F38A 3O7WA 4IV8A 2C7OA 2NP6A 4R8SA 1V39A 5DTQA 2VP3A 3GJYA 3PT9A 3KQVA 1RI1A 2P35A 3A4TA 3OU7A 5EZSA 5GM1A 5G02A 5LQUA 4PYLA 2YQZA 4RTSA 2NP7A 2VS1A 2WA1A 1ZHFA 3KPJA 3GO4A 5DSXA 2PX8A 3GWZA 3UJ6A 3BWYA 3G2OA 4FP9A 3SR4A 5LQCA 2FYTA 2VDUE 4HTFA 3B7PA 4EKGA 3P8ZA 5LQRA 1XDSA 1PRYA 5CM2Z 3L8DA 10MHA 3LSTA 3QOXA 1X1DA 2NXJA 1YFLA 1JG2A 3DOUA 4L7VA 3K6RA 4P7KA 3A7EA 4U7TB 5EHIA 5KVAA 2PX4A 4YUYA 4GOOD 5LQNA 3HCBA 5C9ZA 3UJBA 3WSTA 4R05A 5LQJA 3P97A 3OCJA 1ZG3A 3EPPA 4QPPA 2ZSUA 3SGLA 3I58A 1JG1A 3FTDA 5DM4A 5LSAA 3G5LA 4YUWA 2AVDA 3B3GA 1AF7A 4HGZA 1I4WA 3LL7A 1ORHA 3M6VA 5DX0A 4BLWA 3TKAA 4ER5A 2NXEA 5CVJA 5EMLA 5CD1A 1AQIA 1R8XA 2AN5A 4AZWA 5FQOA 1G8SA 3M70A 5DSTA 4CTJA 5HILA 5F2KA 4C06A 3EMBA 1EJ0A 3I53A 4JXJA 5EMKA 5GIOE 2C7QA 1ZKDA
chains in the Genus database with same CATH superfamily
2X4IA 4LDAA 2PSEA 1W73A 4IMPA 1Q1BA 3BAFA 3VISA 4D0RA 2DR3A 4UM9B 2HPAA 4HGOA 3C2QA 1AKUA 3SFTA 1T3ZA 3EQ2A 1E2KA 3ZZTA 1J2UA 3JWEA 2A92A 4ZVLA 2HA5A 2D0IA 2H4FA 2GKSA 2Y4NA 4FNAA 5H4GA 1UL1X 1TMYA 1O9HA 2PKRA 3MS4A 4MWGA 5JARA 5L9AA 1MP0A 1XZNA 3M2TA 1YQ9A 2A78A 4AJOA 2BGGA 2EU8A 1X0VA 1XZJA 2FPXA 3K1JA 4KRGA 4I50B 3OU6A 2IXGA 5AJHA 3DHVA 3A9UA 3RUCA 4GMKA 1YZNA 1XNHA 2A0YA 3ABIA 1N7GA 3JARB 1KZHA 4B8WA 1V5FA 3EF3A 3ZIUA 3K71B 2JF0A 5ILQA 3L6RA 3SJ7A 1PJRA 4B4KA 1VYTA 2ZWMA 4EUFA 3P9QA 5F9MA 1TOAA 2ZRDA 5DP2A 2ZBDA 4U4AA 3HCCA 1F5SA 1MJ5A 5GJCA 5DU2A 2RKWA 2NXNA 1OZFA 3O8QA 3RLIA 4Q4HB 4QDXA 2XE4A 4MCIA 5D3MB 1Z5NA 5LOVF 1ZKMA 1FDWA 4J6FA 4YRJA 1GG2A 4HWRA 2NSDA 5IS2A 3BXHA 2WF8A 1OBVA 1OZAA 4WOBA 1G20B 1LF5A 1HY3A 1WF6A 1M6YA 1W0KA 2QD2A 4EQ6B 2C4UA 3QEMA 2ZE6A 3F3SA 3U31A 1DAFA 4RH0A 2ZRMA 3QIAA 2FJ0A 3EH1A 3HCRA 4QOIA 3RLFA 2W7TA 3VNSA 2PKEA 2KM1A 2YZ2A 3UB2A 2Q07A 1ECLA 1DIGA 4F6CA 3MHTA 2ZBQA 2VTVA 4BWYA 4RMJA 5CIYA 1GEEA 2LTAA 3CW2A 2FSVA 4RLQA 2FUG6 5DTJA 2ZTMA 1WS6A 3VKGA 1EGMB 2EEPA 3WBKA 3EEIA 2JFUA 4GPAA 4P7JA 4MAAA 3CLUD 1LBQA 4OFBA 5FV7A 3I5YA 2IQIA 2WVGA 2ABWA 4XIYA 3OWOA 1HFJA 2AYZA 3IEXA 1MFPA 3O94A 4L15A 1V5GA 1JHQA 3DZHA 1UBKS 4L8LA 2R48A 4ZZ1A 1HQCA 3EUWA 1D0VA 5C34B 2ZYAA 3M6AA 4LRQA 5AJVB 3V8MA 3V97A 5JI2E 2IVFA 4M9SA 2HYIC 3L7KA 2BM9A 4OSOA 5K8JB 4F4CA 4PYQA 5MFPA 2NTEA 3DOIA 2YFQA 3LQQA 1EX7A 4OXQA 1DIAA 4EL5A 3PHGA 2QAGC 1D6SA 4CQMA 3HP1A 4QM6A 2QTLA 5K8IA 4GXRA 3OTHA 3FHOA 3GH3A 3NIGB 3WWZA 1DRUA 4P93A 3DO6A 5ICCA 1WUHS 2ZWIA 4R6XA 3MD9A 4GI5A 4B47A 4B6FA 2HXSA 3GJ5A 4RZIA 5GPBA 2E4VA 3OTIA 3JRNA 5BW8A 5CCBA 3IYLW 3NCHA 1QG4A 3GHYA 4I9GA 2CLIB 2VWPA 3K9WA 1XBTA 1KL7A 4N8SA 3WHIA 1VCMA 4NZPA 1GNRA 1HE2A 1N1EA 3CH5A 3R7LA 4PRLA 4MUYA 5JAUA 2ZWAA 4G07A 4EUKA 1KYTA 1X1BA 3E8MA 4V1CB 2WAYA 2O3TA 4QPNA 2QUAA 3R6TA 4YMIA 4C22A 4B6SA 4ZXFA 1D3AA 1LCIA 4CQLA 2TMGA 3RUDA 3HBNA 1ZVKA 4PLFA 1YZ3A 1Q44A 1ZW1A 3Q9UA 3C24A 2WTMA 5ALKA 1G16A 5FHRA 4DCSA 2EOAA 2R8XA 4DQDA 4QD3A 1UQRA 1Z2PX 3PGVA 5JAMA 1YZYA 1GT6A 2X41A 2XZTA 2O3SA 3CA8A 3TR0A 3Q15C 2XMRA 4AUEA 1BC5A 3NBXX 1GA4A 1TAUA 5E7IA 2BLNA 5JHHB 4YLGA 2OXRA 2QRKA 3DPIA 1M2FA 4B2LA 1W2WB 5ISMA 3KKPA 5HNKA 4OA5A 2C7BA 2HCFA 1PFWA 4GICA 1ULZA 1X80A 3EA5A 3L0ZA 4EA6A 4ZJYA 3SSMA 1R9MA 3E22A 3ETNA 3MEQA 2RH8A 4HI0E 1P8AA 4Q3BA 4QJ5A 2EAUA 5PNTA 5KYKA 1J0BA 2PUEA 1Y4SA 1PGQA 2KBEA 1I7DA 2IOYA 1RWWA 3FCXA 5GINE 4XUGB 1BCRB 2W8ZA 4Z99A 3RT1A 1P39A 4K8RB 4M88A 2OQ2A 3M3DA 2WHYA 3GLUA 4CEJB 4IHJA 1HNNA 4U5XA 4Z5XA 4NU6A 4Z4IA 1W93A 3DVSX 4HDKA 2FETA 2C7RA 1OXXK 2CDNA 2R65A 3ESZA 4FFLA 4Q5IA 1F14A 4QVGA 3ZZ1A 2DB3A 16PKA 4OGWA 4PRYA 3THWA 5FR2A 1CQIA 1DJQA 2PLRA 1ESZA 2WQ6A 1E9SA 1W59A 3JQFC 3QPUA 4XLTA 3T7AA 1L4FA 1C2TA 2C03A 2DFVA 3VNAA 4YT8A 2EFJA 4MB6A 2A30A 2HWKA 2YH2A 5C7IO 3B53X 4D8YA 4EB0A 1G63A 2R1ZA 5TMDA 4L1KA 1J1IA 3DF9A 4LF4B 1V16A 1A97A 4F84A 3KBBA 2YTZA 2RG7A 5H80A 3DO5A 3NJ4A 4X63A 1F60A 5LC1A 2PU5A 3WK8A 1AIPA 1FNSA 1IY1A 4QU8A 2WW8A 5EERA 5L4SA 2FEMA 1FP7A 1JQAA 1NBMA 1US8B 3CH4B 4B82A 1M0EA 2W37A 4K6FA 2C58A 3VYSB 1QCYA 5DV9A 3DDOA 2WTUA 1AMNA 3PQ8A 3IQGX 2QU8A 4C07A 3GCZA 4C29A 3K70D 3F8SA 2J5KA 3AHIA 4ABTA 2NU8A 3UH0A 1TJNA 4DDMA 1Z2DA 3P0RA 1D2MA 3FBWA 4KREA 1Q1QA 3SEZA 4KXLA 1Z83A 1Q0PA 3DV2A 3TIGA 1S2IA 2HJRA 4OHKA 4Y2JA 4HK4A 1VE6A 4BWVA 5ADWA 4KRFA 3TAHA 3KEQA 1HG1A 2P27A 1J7JA 3WNQA 4ZZ3A 1S5PA 3KQNA 3ZCQA 1T2CA 2M6RA 2DMRA 4FLFA 4KYIB 1EGHA 4M9UA 5T3YA 4R69A 1F4LA 3CVJA 3OKAA 3RU3A 1HWYA 3V6MA 3OZIA 1DSSG 4JLDA 2G9NA 4BQOA 1H5UA 1WUYA 4LXTA 2FRVA 1DLJA 3B89A 3K1ZA 5KYYA 3RYIA 3OQPA 1X7DA 3OJFA 1ONNA 5KYUA 2CT8A 1VPWA 1RPZA 2C94A 3OLYA 3I6IA 1IDOA 3RRMA 3TJZA 1SC9A 4QU9A 3FTEA 3RBZA 1V43A 2AMJA 1YJBA 5JQWA 5DGXA 3UXEA 3H5TA 1EI9A 1QGUA 4G65A 4WY5A 1ZM2A 5EQJB 2OBXA 2YQ5A 1V0JA 4HWKA 5KJEA 4IH9A 4BEVA 3FYUC 3W0LB 4EAQA 1Z25A 2RJNA 3CINA 3NHSA 4J6EA 2WMOB 3I0MA 4MQEB 5B3JA 3C5WP 3AETA 3TOSA 1FBNA 4MQBA 4DYVA 3PQCA 4GVPA 1GNVA 1SVUA 3FFWA 1CJBA 3Q5GA 3JYNA 4J76A 4REOA 1L9KA 4KPUA 3RVLA 5JAIA 4C3UA 2MSNA 3Q3JB 2A7QA 2EC5A 2J5QA 1I32A 2VHEA 3IUBA 3LT5A 4Q9LA 3H5RA 4MYCA 1ZO8A 4KO1S 5L45A 2Y0CA 1XNQB 1FRZA 1MG0A 1HQYE 4ZKEA 2NU6A 4LYYA 1RJ9B 2EGUA 4R6WA 1M74A 4B31A 1A9ZA 1A98A 1L7QA 4P2GA 5CTJA 3TFOA 4B3MB 3G8AA 1Y9DA 1NF9A 2QX8A 5GZ6A 3CLTC 3NQ41 5IKMA 4G0UA 3CLRC 1JQLB 2E4ZA 2IYWA 2LP4Y 3UGKA 5K9ZA 4F97A 1ZMBA 1NXVA 1RE0A 3M6UA 5TT1A 2GESA 3U56A 1BQ4A 2X42A 2A2ZA 5JWOA 3JQPA 1MDBA 4Q3DA 2QXUA 2W93A 3WJ1A 3PC8C 3NDBB 4TS9A 4FOTA 1I2ZA 3RSHA 2Y1CA 2A57A 2VAXA 3DXXA 2XSZD 3IT0A 3Q7SA 1K5DA 1A7AA 3UJCA 3UJDA 4LOJA 1K27A 4Y3UA 3FFBA 2AE2A 4MS4A 1DKOA 1VZ2A 3IVGA 3D6UA 3KVVA 2RDMA 4BAZA 1XAGA 4JYCA 4FKBA 3VUEA 4WLOA 1JG7A 5JNVA 2HU8A 3PL5A 4FFOA 2VHCA 1N2ZA 3FLEA 1KAEA 3IQZA 2XCIA 4OSPA 4RVCA 4G1BA 2YWEA 1KKUA 4WV3A 4YONB 1T2VA 2XWPA 3MFQA 4KJZA 5K3CA 4BKRA 1IC6A 4JENA 5IG2A 2E5FA 4OJTA 1EB9A 1F3OA 1AGNA 4EG4A 3N76A 4N76A 1AD2A 1J42A 1Z0SA 2XRMA 3FPBA 3PRKE 5JADA 3GPLA 3DOHA 4PTLA 1I4LD 1TM1E 2ZRJA 1W85B 3CTPA 2YIVX 1SUAA 5CX1B 2W6MA 3GA5A 1KK2A 1J2JA 4AK9A 4M37A 1P7WA 2WM9B 3K5PA 3NZEA 2J6IA 3EA4A 3VO9A 3WP1B 1E58A 1GDDA 4HY3A 4M7PA 1RYMA 1OZHA 1ZCZA 4ZVSA 3T3HA 3S8MA 3WB1A 5CH3A 1RWQA 2A5DA 2NPOA 5DM60 1VYVA 4Y7DA 4YRIA 1OGIA 2O8DA 4KWIA 1PGPA 4UOQA 3P9RA 1HL7A 4DJAA 2VT3A 2QVLA 4BNVA 4E1AA 4XB6B 4NECA 1P73A 4IRUB 1TKBA 4FGJA 4OHUA 4S2EA 1R8YA 3VH4A 4ZYTA 2W2PA 3KR9A 1VPVA 4CKXA 5H83A 4AZVA 3PLRA 2H18A 1M1YA 5G41A 2BGUA 3T94A 1XMVA 3PPVA 4F06A 2VJYA 3L9XA 2V96A 4U5QA 5IN5A 3SZMA 2CL7X 4IWNA 2I2CA 3WGVA 2J9XB 1NX9A 3LY5A 2VNHA 4GOXA 3MF4A 1H8EA 1P1JA 4DGSA 2ACKA 2ZBFA 2C61A 2D59A 2I5PO 3QU7A 4LDQA 5AVJA 4AVYA 5I8ZA 3FBTA 3NHPA 1VA5A 4NULA 2WZCA 5TX7A 2HLPA 4AF8A 3GLIB 2VLBA 2JA2A 4RTMA 1Y6FA 4I55F 2GILA 4AMYA 5EWLA 4HQFA 1WV1A 2YCLA 2J30A 2FPGB 3S40A 2CFRA 2O0LA 1YTUA 2RIPA 3UJ9A 2VHVA 2CD9A 1YBVA 1G3MA 4IIHA 2EIXA 2XHEA 3WGZA 2NTNA 4L5IA 3H2ZA 4FTWA 4IIVA 4NJEA 3FMGA 2VZ8A 4YJ3F 3K32A 4NFLA 5FBWB 3D8SA 4R0NA 1Y3HA 3P2KA 1BWSA 4JS0A 5KKNB 1N5DA 3AP3A 3VVLA 2PL5A 1BMDA 2UVPB 5EXDA 3VSEA 3OBBA 3THYB 1TD9A 3FTFA 1JDUA 5FBKA 1X1RA 4A6PA 1KAQA 1AQLA 1MGPA 1KVUA 1O4WA 3NNDA 1U8CB 2SKCA 1NVEA 1O6BA 4MIOA 4CF5A 2A5FA 3WX0A 3T9EA 2Q5JA 2QXTA 3FTPA 5HVNA 3SNHA 1GGJA 2HUPA 2ZTVA 4ND6A 2D2FA 3L7YA 2F00A 2RC6A 2ZI9A 5CMLA 3L7LA 4I9FA 3UA3A 1RI2A 4Y9DA 3L04A 1XP5A 4P36A 4M0PA 4LF8B 1V5IA 3CIFA 3K0HA 4HUJA 4M0LA 1G6OA 2O5VA 3WIUA 3RS9A 2GEFA 3T35A 3GZTB 1O08A 5B7NA 4Q05A 2BW0A 1YS9A 2VF2A 3H9QA 4PZAA 2GFHA 1Q83A 1FFXB 2B99A 1U0LA 5D3QA 3VZPA 1G2OA 1G0OA 2QG9A 2Q5IA 4LY0A 4DCVA 5AHWA 4TZKA 5BXQC 3CSUA 3KHTA 2PSJA 1OGJA 2WF6A 4X60A 3M1AA 5T6BA 3OLCX 5E3HA 1AN9A 1PJTA 2Y9MB 5D5HA 3W9BA 3D8UA 1I4TD 5CFOA 1BMQA 3O2NA 3H2GA 2BEKA 5FV4A 5JG7A 3H6HA 1KFBB 3I05A 2A5LA 3RAEC 4W5NA 1TU0A 3FBGA 4M55A 4ZOQI 1B6GA 2FFQA 5AD1A 3NH6A 3IJEB 3EOAI 3D02A 2Y8EA 4N49A 3T95A 1G21B 2P35A 2RONA 4XM1A 4DLVA 1SCJA 1IMJA 3O26A 4AJIA 4Q4JB 2BV3A 2E18A 2GK4A 2YQZA 3S70A 1M9NA 2UDPA 4HR7A 5EMHA 4ZU3A 1CTQA 1RFLA 2G40A 3G2OA 4LNUA 5LQCA 3HWX1 1V3VA 1PX2A 2QN1A 3A11A 1D1QA 1H6AA 3I42A 2WSSA 2NN3C 3EDOA 1T4MA 1GOTA 1R1DA 3G1WA 3OUUA 4NK5A 4O4HF 5EZ5A 5B2ZA 4CMGA 1Q2UA 2C4WA 2FH5B 4JCCA 2XLBA 4UAGA 5IRCD 3EOZA 3MHPA 1DHRA 1YFLA 4L7VA 2IUFA 5B3AA 3A7EA 3SIPA 1GAWA 1UP4A 4BO6A 2AK3A 2IODA 3OKPA 3PUYA 1YQUA 2A1TS 5CDHA 1HKUA 1N2JA 2P4UA 4M8LA 4R98A 4TL8A 3RRNA 2C2XA 3PK0A 4D7AA 3NM5A 4LXGA 3GZNA 1XJWA 4N5IX 4QGBA 4ZAGA 3C98A 3HFSA 4I55B 5GJVC 4NYMR 4G41A 4N5NA 3ORRA 2O3UA 3PUHA 1G3UA 4I9UA 1CZNA 5CVJA 3TS1A 1LI4A 3CPHA 2BFWA 3OKFA 1W25A 4CL8A 1QG6A 2FWAA 1NXOA 3DG9A 4YJ3B 4MR8B 1TYCA 2YNMA 3LF2A 4F3YA 3WA7A 3OSUA 2O19A 5F1PA 2VQFB 3TB6A 2GN1A 1EE2A 3TRJA 1UMCA 3FZQA 3WQBA 3ONDA 1FDRA 5EINA 4CLEA 2QUIA 2VRWA 3FRJA 1KA9H 4OJQA 5AJYA 4EYKA 4I6GA 1RRGA 4NCHA 2PZFA 3HZZA 3PV0A 2V6IA 1ECPA 1EBFA 2WWGA 2YV4A 4GU5A 1LKZA 3PGJA 1V48A 1BN7A 4QOHA 3WTBA 4DDHA 3ULKA 4RHXA 4F1WA 3JVVA 3RK4A 4W8HA 2EFHB 2CXQA 4QHTA 5CCXA 4RYDA 2ZIZA 1ODTC 2P9GA 1EDOA 3W3AA 3FD8A 1R6TA 1YR2A 2QRPA 4HWPA 4UDOA 5JSKA 4RTLA 5B1DA 3UGTA 1AKRA 4R3UC 4S1VA 1QV7A 1JYFA 3DEKA 4ESEA 3SSNA 4A8JA 2EDAA 4BFWA 4LZAA 2VTKA 4C0SA 1GG9A 2R87A 3GGDA 1DINA 4I5FA 4IIJA 3VR6H 5ITSA 2GZSA 3CJRA 3R4VA 1ISMA 1DIBA 2R1TB 4RK4A 5DLEA 4JL5A 1KARA 5E7JA 3RS3A 421PA 3X0DA 2O52A 4X24A 1U8YA 2AA3A 4LNAA 4DLZA 2FG7C 2ZSJA 2AC4A 4X95A 3VPGA 3W2HA 3WXMA 1RLTA 3QELB 2FGJA 3CE6A 3QITA 4G8BA 4HADA 3JQGB 4DJTA 3U4MA 2Q7OE 2JCSA 2D1RA 3VO2A 3QXSA 3EIUA 1OWNA 3D8HA 5BVHA 4J94A 3AKZA 1TKAA 2PZMA 3DEIA 4HSGA 1XXHB 1YDHA 1Z2NX 1HYEA 1M67A 1Y5LA 5DYNA 2MSLA 2ZJBA 3KZNA 4KO2S 4NV3A 3IO5A 2FPLA 1CUUA 3QKRB 5BWCA 3NHRA 1PDOA 3TOVA 1GTVA 3RV3A 1N6HA 3EC2A 3VM6A 3LQYA 2AD5A 3COYA 2IUTA 1T26A 1RYHA 4U3JB 3NDRA 2Y1WA 1NAHA 5CNKA 1TUIA 4IRXA 4KFTA 4S0XA 1F6BA 1V11A 2H4ZA 3AERB 2IL1A 4O4HB 2D06A 4QUIA 3IDAA 3IA7A 1KEEA 5FNZA 1VIDA 3LPAA 4FDLA 5H3HA 1FUKA 3L01A 1JFRA 3QQPA 4OU5A 2DHQA 4BJHB 1SVSA 1YDWA 2IV7A 2JLWA 3CB2A 1QHHA 3SKYA 3VU1A 2MR5A 2HDNB 1KMHB 1HQDA 4LC0A 1PQYA 1MABA 2BL4A 4TYNA 1UXOA 4M83A 1C3OB 1Q0RA 1XRQA 2I4IA 3ICOA 5KJ6A 3OOSA 3K8ZA 4LY6A 1SOWA 3PJFA 4S24A 5I8PA 1YRYE 3VC3A 2R3SA 5I45A 2GXQA 3QPVA 4JGGA 2HF2A 2O2CA 2PHZA 2GJKA 3KAPA 3ON5A 4G0NA 1XDGA 3AFIA 4AP9A 4CNBA 3IHKA 2Z1NA 3EVAA 1OA1A 2HZ7A 3E84A 4IJQA 3K9LA 1WULS 1Z5GA 2OBBA 3B1WA 4YACA 1N6PA 3A9VA 2GF2A 4UHCA 2IXFA 1UM8A 2CL6X 2P1DA 4GUDA 5HQTA 3F6YA 4ANFA 3FSEA 3IVAA 2PGOA 2V7GA 2XB4A 3EGXB 5LZ4A 2O3JA 1YVUA 5DXAA 4BTEA 3U7GA 1QZTA 1SELA 4E4YA 2JS7A 3EJWA 4HMOA 5EIOA 4R2MA 1GFWA 2WF9A 1KBQA 3IQEA 4XYLA 3TD9A 3DBRA 1IWBB 1NY6A 3ROMA 1Z0FA 1HDIA 3DFMA 1WMSA 2F7SA 3KKLA 4Y1RB 2Q6OA 3ZOKA 5K0TA 4ZDIA 2PUVA 1QCZA 2B5OA 4XD7D 2E55A 2NV6A 4JQCA 4G56A 4Q18A 1GSHA 1KVQA 2VYND 2JHPA 1MO2A 1JFLA 4NS4A 5REQB 5BRJA 1II8A 3SYRA 3ZGVA 2PJUA 4U2FA 1NI3A 2NZYA 1VLMA 2Q4EA 1FRFS 3TINA 3V2UA 1KP9A 1KKLA 2ZBGA 2ZIXB 3G2QA 5ADVA 4WOPA 1P72A 2VBFA 1HKHA 3C3MA 1ZJ5A 3M6WA 3M4JA 3PICA 1CY8A 1Z15A 2FR1A 3QMMA 4GFDA 4PSCA 2BGJA 2AT1A 5DHSA 4AJ2A 4URUR 1D2CA 4IQ0A 5L95A 3OJ0A 1PSZA 1QF7A 1DBSA 3M9WA 4JKYA 2D5AA 1CV2A 2EKLA 5DIFA 2F1KA 2ORVA 3E1GA 3OIGA 2DXIA 2WUVA 2ORED 2OD7A 5EPOA 5CT5A 3TKLA 2BGMA 3F0TA 2BMWA 1E9FA 3E27A 3E1SA 1GLGA 3ZY2A 4YV0A 3QYFA 3UW1A 2FVXA 3L49A 2R66A 4UTNA 5LYJB 4TMTA 3LUPA 3K09C 1T6ZA 1XELA 1X87A 3ZCXA 1QIKA 2D8AA 4A5OA 4EUHA 1JLLB 2GCNA 4LE1A 4UD2A 4XVRA 5F7OA 3KXIA 3KXKA 1NBIA 1E1CA 3QLVC 3TTXA 4QJIA 2GN6A 1VP9A 4H59A 3PXXA 2TMYA 4WADA 3X1YA 1D0IA 1L0BA 4X1IA 4UM8B 1I33A 3IAEA 3PYXA 3Q7RA 4HFJA 4JYZA 1CQZA 3CPSA 1KO8A 4RYLA 3MINB 3RRFA 1G2PA 2GB4A 3UK6A 1PZNA 1Y1RA 3NVAA 2WJWA 2B4RO 2G6BA 1MX3A 4EFKA 4JCOA 1TO2E 4DV3B 4ZFNA 1Y9ZA 2OHXA 1R8SA 4CMIA 3FKSD 1OXMA 4F38A 8LDHA 3RW9A 5FUYA 1H93A 2OL4A 2P67A 4MKGA 1YR9A 3BM5A 2NQ8A 2VJKA 4CEHA 4QUHA 1W96A 2R7LA 2YHIA 4CM3A 5KQLA 1WW3A 1M1NB 4H2DA 1FJ2A 2X1LA 4YLEA 1BRTA 1I14A 3HR7A 4PR3A 3DEAA 4H1VA 4FE7A 3GUCA 4FB4A 2H5IA 4DY4A 4RO0A 4A6EA 2RMKA 2QJWA 1DTEA 1WKCA 4QC2A 2VYQA 3ZHVA 1YC5A 3AKDA 5TLSA 4WJKB 3WLIA 2OXEA 3L7MA 3SE0A 3W5BA 3U3MA 2VHUA 5CFQA 4R0VA 1I5EA 1NBME 5I01A 3D9QX 2B2CA 2GFQA 4YI3A 3S2YA 3BE8A 1SCUA 1RC1A 1T0BA 2G76A 3EY4A 4I3GA 4TS3A 2G1UA 5DCLA 5KAPA 3UQYS 5KOHA 3FKJA 1JEAA 3JR3A 5FAKA 2JK1A 4EHJA 1XEXA 2Q5OA 4ZHQF 3OX3A 2IV2X 1I3KA 1L7OA 4CLRA 4JC0A 4DLRA 5L6MB 4DBZA 4IJKA 5HOQA 2JK0A 4RPHA 4H7DA 4DQVA 1WRBA 5CD9A 4MMXB 2F8SA 3NRBA 2IRWA 2CFIA 2YWRA 5I4CA 1NBMD 1YR3A 4H7JA 4IDHA 1QR2A 1SXGA 4L4SA 5EQFA 4EGQA 5BMOA 4J4HA 4LX0A 4TRNA 3QVGA 4R1SA 5DLQC 3CNBA 5IBPA 1C7QA 4KDFA 4WXRA 2Z8YA 4EMBA 2VJMA 1KGSA 1OPXA 2AD1A 4GP9A 1FW6A 3CE9A 2F4NA 4YGXB 2D74A 2JEOA 3DBHB 1P2FA 4CEIB 2OMEA 4MINA 1P61B 2PVCA 3O1HB 4J0JA 3U3XA 2RHLA 4B6GA 3PEUA 4O0LA 4RDCA 3H05A 3NBAA 4U7WA 3B2EA 2AI1A 3PGKA 2WWXA 4OQXA 3UHOA 5GP1A 1KDTA 2FK8A 5J5AA 2NU7B 2QTHA 2YINC 3A05A 3PVZA 4CMHA 4YV1A 3CG4A 3IKTA 3VPFA 5EFZA 2WA2A 3ZH2A 3F8WA 3S27A 1GAJA 2B25A 1T8YA 3TNFA 2K4MA 1NNSA 2J7KA 3W5CA 1H5NA 3B3QA 3EEBA 3HADA 4HDRB 4NU5A 4ZI7A 3NFYA 2HCRA 1E2BA 1P9OA 4MP8A 2O7RA 2G4VA 3NRJA 4YJDA 3E61A 3GFBA 4RKRA 3EX7C 4HYQA 1UIMA 2XTMA 4ALIA 4CCYB 2BCEA 4Y6OA 4D9IA 5SY6A 3QXJA 1FX1A 5FTWA 2PVSA 3COZA 1YH3A 4BZQA 4JOQA 1S9HA 1CR6A 5T4HA 4YNBA 3TF5A 1E6EA 1NI4B 1UJCA 4HD8A 4KMMA 2FFJA 1S7GA 1DG9A 4KVGA 5HBRA 2ZXEA 3L4BA 1Y98A 2NZUG 1V6CA 2RBEA 3A6LA 1C9YA 3DOCA 4QGFA 4CKBB 3OQVA 4RU1A 3EXG1 3ZLVA 1VL2A 3LUFA 3F3KA 3BHMA 4FI3F 3W5JA 4NCBA 2ZK7A 3QXHA 2YWJA 3MWEB 4N7MA 1L5NA 3JALB 1K5GA 3BDIA 2QP9X 2OP1A 4TTSA 1NVVR 3AOEC 2WJHA 4G63A 2PUFA 1C80A 1XEFA 3ODPA 3Q7IA 4C5CA 3PUJA 3W2TA 3ZE8A 4PVDA 2YV3A 2VDQB 3D3KA 2DPGA 2R4TA 1UIRA 2Y1FA 3FIJA 2AJ8A 3GVIA 3I32A 4YAJA 3RU9A 4J8PA 4DA4A 2CMDA 3N70A 4QDJA 4DNOA 1FTNA 4XCQA 3V7FA 3LQ4A 1NZJA 1DXOA 2R96A 3C14C 3GYBA 4GQBA 4S1WA 1BKSB 5D00A 5IK2A 1Q7CA 3WYNA 4JJ4A 4HVAA 3OQIB 4DLAA 4ZHQB 4AU1A 2QVZX 3GUUA 3NR2A 4XUCA 4QOJA 2GCEA 4JQOA 2PU7A 3VPAA 2ZATA 3LRXA 5CDFA 3SBDA 2MJLA 2ZP1A 3I5UA 2DUWA 1IOWA 4AKGA 4FE3A 3FZYA 3KYDB 1YI1A 4OCZA 3P0JA 4PNZA 4P5EA 2J0VA 5KJFA 2GZ3A 2V6GA 4GMXA 4QQ8A 2RJ3A 4UATA 2Q62A 2Q8PA 1QGYA 4OHZA 2F3RA 1E5TA 2VT2A 5AW5A 3E5NA 3GFRA 4YT5A 2PX6A 4A6XA 4AUNA 4ER6A 2PQMA 4X90A 1V6SA 5BR4A 3IVRA 1MTOA 1AK1A 2XUGA 3EGVA 1VE7A 2WSMA 1PK9A 3BH7A 2PGIA 2N46A 3CEAA 4FBMA 1BXGB 3VMMA 1V4BA 4A2PA 3LK6A 3HEAA 1N5OX 1XZEA 2CNNA 2HA3A 3KXDA 1DQRA 3CF0A 1ZUHA 4G8JA 3TTVA 3WK4A 4JY7A 3CRMA 2BFCB 8GPBA 3WWOA 3I04A 2H07A 3JTEA 2B94A 3N53A 3RUEA 1GRCA 1MJHA 3T4PA 1M1YE 1J39A 1RHKA 1FDSA 2AG6A 4WPGA 3TW6A 3AR2A 1QU2A 3R5XA 1Z06A 3OPNA 4NOMA 1JEYB 2Q3LA 2OHHA 3TVTA 1RABA 3I09A 5IASA 4QEZA 4RV5A 4HT3B 4E4RA 1LGYA 5DGIA 4KIGA 4XPIB 4EW3A 1K7EB 1WDTA 5DZSA 5K8UA 2XX3A 3ISTA 2FPUA 4J1NA 1JWLA 4ML3A 3WV4A 4JOBA 3WYEA 1T5HX 4BNUA 4FKMA 1C1DA 5I7RA 1QJCA 1ZAYA 3H5IA 1G9XA 4FEEA 4KXMA 4URZR 2VP5A 5IARA 4OG2A 2E4UA 1MA0A 4R2KA 3GRRA 1OI4A 1OT5A 1NIJA 3B1XA 4J0DA 3GD5A 2M6KA 3PR1A 2P9EA 5JD5A 4FUTA 2B82A 4ZAXA 4ZGBA 4L50A 3BWDD 3KT0A 1BRMA 1E8NA 2P6MA 5CPFA 3SQNA 5BNIA 4IOJA 2CJXA 1ONOA 4RY0A 5EIBC 3EPKA 5T8KA 1E5QA 3TG8A 5A02A 4HNAB 4IBOA 4JP3A 1CEEA 2B30A 2PRYA 2XNCA 1UBOS 3X1KA 1W8DA 3DOFA 4N6OA 3E7DA 4CN9A 4CF7A 4GPIB 4JI8B 2WZQA 4BQFA 2OO7A 2Y9PB 3O3NB 1CNFA 1RAFA 4JLWA 1CZRA 4P7BA 2XUIA 1TU4A 2J4FA 3D4NA 2AVNA 3GJ4A 3HA7A 2WFZA 2VZ9A 1EWRA 4ENPA 3TGLA 1E7WA 1E2LA 5J5CA 3BF8A 3PDIB 4CIAA 2C4KA 3N2YA 3ZJTA 1KJJA 3CPJB 2JFGA 1GZSA 3VBCA 4YPOA 2C4HA 1EEXB 3TRHA 1YRHA 4XX0B 1FP1D 3N2GA 4B0OA 4OL0A 1P0QA 4HZIA 1T9BA 1U8EA 2XHZA 3VO1A 1M2EA 3CLVA 2QTWB 5IC6A 4QZVA 1CVRA 2IYEA 5DTQA 5KWEA 5IHXA 3RVPA 5EZSA 2RGAA 2IE8A 4ZQCB 4WCFB 1EVQA 5CBKA 4PO9A 1S2GA 2QRHA 3GO4A 3V8QA 4ZTZB 1VLHA 1IHYA 4LRWA 3RGGA 4IDFA 2H0AA 2QT1A 1PS9A 4FYWA 2RGBA 3CXUA 3OO1A 2MSDB 1PFYA 3W2GA 4B5KA 2QV7A 4FONA 1W1IA 4EB6B 1M8GA 4N0EA 4GGPA 1G4AE 1QP8A 4CZ2A 2F59A 4LV6A 4QEKA 1DJNA 3IUJA 4J7XA 2IHNA 5BOSA 3NC4A 1UXIA 1R2QA 3VPDA 3FTNA 1CXZA 2ATEA 2QD5A 4R05A 5TR9A 3ZZUA 4EPXA 2O2XA 1Q0HA 1P7CA 2BFDA 2J46A 2P9FA 3H16A 1NUTA 3OZAA 4MJ3A 3AEQA 3X2EA 2G83A 1S1MA 4K6HA 4P3YA 1UC5B 3GEMA 5AOBA 5JJIA 4G25A 2QMOA 3VDXA 1QRSA 5DX0A 1CJTC 3RK0A 5MGNA 3U7RA 3VSAA 1J5XA 5BMVF 1NOIA 1J6UA 2D7CA 2XAAA 1XZ8A 1HLPA 4I5EA 1WD5A 4IS2A 2RGNC 4BMVA 1CWUA 4L75A 4ZPJA 1VSVA 1Z9BA 1DAKA 2RAVA 1GUDA 1S8FA 4YRBA 1T3SA 5JW6A 3W2FA 1GT91 1Z75A 5BURA 2NADA 2CFCA 2VG8A 2ZUDA 3AB7A 3GH1A 1CRWG 4BJ5A 5AVWA 1ZSVA 4DLXA 3BTVA 2JFQA 1RC8A 1JSXA 5JZ9A 3PDHA 4UEKA 2CF5A 2HN9A 3H83A 3GT3A 3PNLA 1P3JA 3AI7A 3KM0A 4MULA 3R41A 3U0BA 3WMGA 1JMKC 2WAXA 1DVRA 4LJ6A 4XASA 1Z74A 3LU1A 3H8JA 1FRQA 5MF6A 3U9TA 1XAIA 2FZVA 1O54A 4W8GA 1FDOA 2BY4A 4M0DA 2B8JA 1JEJA 4DMUB 1X39A 4AKHA 1DAHA 1G8FA 4ZV4A 4C6SA 5IJWA 4CU5A 5EA2A 3W7VA 1JSRA 1FNNA 3U6KA 5TF4A 4D26A 721PA 2OOKA 4P80A 3P27A 1FJXA 2C9DA 4BFCA 1NW9B 1QH8B 2ID8A 2FFAA 3ELUA 3RRYA 1OYYA 2LIVA 2OFFA 2R6CA 2WAOA 4OK5A 1H4TA 4NEHB 2VH5R 1R0CA 2R7MA 3OZ7A 2EXXA 4JJKA 5AIBA 1ZEJA 4BMCA 4U2EA 2NPFA 4AZSA 4ZYZA 1JALA 3BL6A 5ARBA 1IOVA 3BSWA 5IJ0A 5T64A 5HTOA 4D5EA 4KQWA 2NU9A 4BASA 4YMWA 5BQFA 1JU4A 1VIMA 4ASUA 1KVRA 4OMDA 1SY7A 4DRZA 4ZP1A 1KE2A 4DWWA 4DYHA 2UKDA 2JI6A 2M6LA 3MB8A 1QO7A 2AN9A 2O4UX 4D9HA 2ZXUA 2OUKA 4RVHA 4Q4AB 4W7IA 2CXSA 2CZGA 2JHAA 4B81A 3IESA 1OFVA 2WKWA 3U9LA 2H54A 2P2LA 3ABOB 1E1DA 4URFA 1QPBA 4HDNA 3OH8A 4NATA 4OAQA 4F46A 2I91A 1HDOA 2W2QA 2KS6A 5KYXA 1US8A 2D2XA 1GKKA 1PI3A 2F9LA 1MB9A 3RTCA 2QAIA 1YA8A 3ELYA 2QVXX 5DOZA 4CTKA 2GK3A 3O82A 3GLGE 4BVGA 5B7GA 1P7YA 1C9DB 5ALEA 4TM7A 1XT6A 3FW1A 2XBLA 4G36A 4CHGA 1AU9A 4PFQA 1DRVA 4Y9SA 2XKKA 3LVFO 1SZCA 3WFJA 2LR0A 1LVGA 2VF4X 3DLBA 5EVCA 3U17A 5K0SA 4PFSA 3M82A 4XYBA 2QM3A 5BMVB 1SURA 2XVYA 4EJ2A 3L0YA 1VECA 1PNOA 5FB3A 1HFEL 3RADC 3QQ5A 5ENVA 1QH1B 3WLAA 5HKBA 1Z2CA 4HN9A 5AM4A 1IFXA 2XUFA 3A58B 3EF1A 2F4VB 2FN3A 3PC2A 3KB1A 4JU9A 4E31A 1XOIA 3IUEA 4WE3A 8OHMA 1E5LA 3MTIA 4DPLA 1FYVA 3HN2A 1ODKA 1YWGO 1C1XB 4PPYA 2DR0A 4XUEA 2GXAA 4F5EA 5LU9A 3RGWS 3O1JC 3BB3A 3CUSA 4P3PA 3ROTA 5FUBA 2AW3A 2ONCA 1CJUC 1KOGA 3IEMA 3JAWB 3FSJX 3V4OA 2BUCA 2H00A 2A4MA 2ZT8A 4YCBA 5F1KA 1JSCA 1L5SA 3DAHA 2ZKLA 3PUKA 2QSUA 3DWGA 2NYVA 4AKIA 1Q3TA 4QYXA 3Q0IA 3W34A 4TLLB 4GX0A 3EPJA 2CDCA 4J1TC 3VC7A 5D5QA 4TYYA 4AN1A 4PZUA 5ELMA 3R7WA 4AYTA 1HNXB 4KK4A 2I3AA 1T2NA 1WHSB 1YKSA 3A9WA 2XOEA 3UF0A 2RHOA 2N9UA 3WWEA 2JHCA 2ORYA 3OEEA 5FBVB 4R8KA 4D82A 4BFZA 1A9TA 1IJBA 1OHHA 2X0EA 3QK7A 1IBMB 1NVMB 4MUBA 4MEBA 2R60A 1JU9A 4BBPA 1A4IA 2AFIA 4PPNA 2PIAA 3QPWA 3HR4A 1EFPA 3GGJA 4AX8A 3WLSA 2ESRA 2NPIA 3D4PA 3IV9A 4N3AA 4KEAA 1NPYA 4XIFA 3G8YA 2NTYC 1OI3A 3X1MA 4IJMA 3C3PA 3E05A 2V5UA 2KMLA 3PPYA 4AM8A 2YN2A 4OQLA 2AG0A 5P21A 4KX5A 5AO9A 1UOQA 2ZE7A 1DZIA 1PLJA 3GLFA 1EESA 1FFGA 1M7BA 1HEYA 1ZI9A 3IPCA 3UG6A 1OWMA 2CJFA 3LFUA 3QFFA 1FLDA 3QE3A 2W8BA 3TEMA 4Q9JA 3EGCA 4JV5B 1G8YA 1RBZA 3A32A 1P1IA 1ZGJA 3DEJA 2WUEA 4BXOB 1LS1A 2J32A 3R3VA 4UTVA 1CU1A 4GP6A 1NURA 2FUNB 3I28A 1K3FA 2WPNA 3B5IA 3GMDA 1N25A 5CVUA 3QBJA 2QYOA 2XB9A 4GVLA 4XM2A 2CLCX 4TMYA 4ZOCA 3ZDXB 5BVGB 1EKXA 3TYXA 1XA0A 2ZVPX 3JD1A 4PAOA 1UFVA 3BGOS 1B73A 1SC6A 3T3MB 5ILOA 1RM3A 2OGWA 4AC9A 3BA1A 3EHDA 3ESRA 3HJGA 1IJFA 3HHPA 4K2AA 4TSKA 3WVNA 2BMEA 1O6GA 3I92A 3RIEA 3AEKB 2WWTA 3VPHA 2N1MA 3W8RA 2HOQA 2XBUA 5B1EA 5IKPA 4BY9E 1WU7A 5G0TA 1H9BA 2IPLA 2D13A 3B2QA 5LXTF 4CG3A 2CDBA 1NJ1A 2B9VA 2JD1A 4R8VA 5GTDA 1UPFA 4N4AA 3KB2A 2XXAA 1YUMA 3OEHA 2AB0A 4TUYF 5BYKA 3K9FC 4TMZA 1W7AA 1JHZA 1OXSC 2JBHA 2NX2A 5BQPA 3QX3A 4Q9KA 1QKIA 3TSOA 1SVIA 4L8FA 1RKXA 1SN7A 1ZH2A 5DI3A 3TZEA 2FSUA 4YMGA 3MMPA 3Q9SA 4MYHA 2F55A 3EAFA 1T0UA 1L3BA 2NUPB 3GLKA 3FPCA 4K9LA 1XPRA 4RHUA 3HN7A 3EVCA 4NBVA 3T7EA 3VR0A 2R6R1 4B2PA 2ZR8A 3ORHA 3F1KA 1B41A 1O95D 5HCNA 5A71A 1AGXA 3BIXA 3TNYA 2UXBB 5AI4A 3AR6A 5JISA 3ZWNA 4NCAA 1DQYA 2DECA 5CXQA 2CFTA 1T3TA 2XTAA 1YI8A 1BN6A 1ENZA 4FJ1A 5TPWB 4WFKA 3N2KA 1KS2A 4BNIA 4FE4A 5ENDA 1KJIA 5BUSA 1XLVA 4M89A 1YR6A 3AWIA 3OTWA 2FPIA 4U9IS 3FUTA 4QOGA 1MAHA 5T67A 7YASA 1V1JA 1BJTA 1DRJA 2QMEA 4GOMD 2XT6A 4LIPD 2DCUA 2EX0A 3RFXA 4FZVA 1G38A 2HLDD 1R0ZA 3PNKA 3ZU6A 5BUCA 2XZPA 4RH1A 3A2NA 1VKJA 3HKDA 5FFNA 3PJEA 2E9SA 3L8ZA 4GR5A 5L51A 3BWCA 5EE3A 3VSDA 1L5HB 3O93A 5B64A 5EJMA 1O1YA 3T5PA 1NUAA 3HBLA 3V55A 4UEWA 4Z7QB 4MP3A 1XTJA 3LXMA 3G49A 3A1WA 1WKBA 3EFBA 3SG0A 3BKWA 3C6QA 4Z53A 4EG0A 1RYBA 4X97A 4O4LB 3T41A 1E2DA 3QKSA 5EKXA 5TQ2A 3M33A 1HURA 3O8LA 4MWCA 2IXAA 5LZ7A 1VZ3A 1YU9A 2HBQA 3ZWPA 4F2GA 4JQZA 4AUMA 4N5HX 2Z6AA 3O8OB 3JQFA 3BJZA 2GM5A 1JG3A 1XRSB 4RHFA 4UE2A 3IQFA 2PZ8A 3IILA 2ICAA 3L82B 2AUMA 2OECA 4KFRA 1SPXA 3B36A 4M9QA 5HKKA 1S4QA 4BN4A 3GL9A 3GXOA 2H0QA 2XCLA 1QQTA 1FFXA 3WWYA 3ROEA 2UZ4A 1COWD 1BCSA 4FSDA 4MKXA 5F4BA 4CXMA 4UPEA 3KQUA 1RMQA 4EG3A 5JROA 4RZXA 4XCVA 5EAIA 3WGGA 4MITA 5CB4A 5HYVA 1GRVA 1B00A 8MHTA 2PL3A 2CHVA 2EARA 3AJRA 1PWZA 1WDMA 2XA9A 3CG0A 4R1NA 4DR2B 4IO0A 1F2UB 2XQFA 5LXTB 5ARDA 5BSTA 2PGAA 5DE3A 3DL7A 2Z9BA 2BI8A 4PAQA 2FEPA 2BFEB 5BRNA 3TSZA 3WIOA 3N6RA 3ZVKA 3UWSA 4ENQA 4DT1A 4PYIA 3AXTA 4W63A 5ALYA 3TAUA 3HG7A 3NH9A 5DLDA 2CJWB 3C7DB 1J9EA 5DEIA 4FGKA 2GPTA 4JJ7A 3VVBA 1P44A 3TLGB 3SBEA 1ECJA 3CLSC 4XDZA 3P19A 1DMSA 2BD0A 1NC1A 1Z2EA 4L6AA 1LK7A 3QIVA 5H70A 3R5KA 3BORA 4WBXC 1VGQA 2Z2ZA 5EPEA 2FUKA 4AIRA 2VDWA 4MO2A 3D3EA 4GPZA 1K06A 1WZEA 2OK8A 1A9XA 3I5AA 5I4KA 4PZ0A 4BVAA 1JFFB 2PUHA 4AJHA 1JQEA 2AYYA 1KI9A 1NE7A 2OFWA 3EQ6A 2CUTA 1YZTA 1YRWA 4OUKX 5AW0A 2CVOA 2DWUA 5CYFA 5CG2A 1ATZA 2AJLI 3KZCA 3DTVD 5L40A 5CDFE 1T1EA 1J99A 4Q93A 4PTYA 5L3SB 4QBKA 4ZCPA 5KEIA 1N0HA 2QX7A 4P9NA 1ICIA 3E9DA 4M98A 5K4AA 4AN0A 2QJOA 5IHPA 3S7ZA 3FYUA 1SO8A 2CJYA 4L5AA 3WKBA 1NJ5A 4PGFA 3HBMA 4MUXA 2OCXA 2PUTA 3QE2A 4DLSA 2JEZA 1NSFA 4FT4A 3BXPA 3TB4A 1NYRA 4GKBA 4UTXA 1IZYA 3TWOA 5HIMA 3FMVA 1JA1A 4BX8A 1E69A 2IXDA 5J1TB 4IMJB 4Q3AA 1XCJA 3F6CA 3KPYA 2PEYA 3PNSA 4QU5A 3I8OA 4ISCA 3OT1A 5H4HA 3WAGA 1OQAA 2CL5A 5HZMA 5G3YA 2W90A 4RNDB 3K0SA 4NS1A 1OF1A 3CB4A 2P5SA 4KWEA 3RVBA 3GJ0A 3DJYA 3OZRA 1QVVA 1UWVA 4IINA 1ABEA 3LUAA 3MJHA 5DHPA 4KDCA 3PPWA 1A4XA 1XCMA 4ZQIA 4JDUA 4FSHA 5CTAA 4A6DA 4B6OA 1DCFA 3R3WA 5F21A 4ARIA 1JVSA 1EFDN 1F48A 1GZVA 1TKRA 3OI7A 1DL5A 3LWZA 3OY7A 5DTIA 3CUUA 3QKWA 3JYHA 1QVRA 1CY1A 3OFVA 4F9GA 1EUDB 4G1EB 1DDOA 1J8VA 3DV0B 4EUEA 1HLGA 1Z8HA 2HSJA 4ZJPA 1M1XB 4ND4A 4ALJA 2J4CA 4HLDA 2ZBEA 1Z7WA 4IDAA 3I6ZA 4M9ZA 1DIOB 3WMFA 2PGNA 4BCCA 3C7KA 4IVNA 3BMCB 1AKQA 5GONB 2EG9A 1Q6YA 5K0BA 4C88A 4XWKA 4MIYA 3ZIAA 1E3IA 1W52X 5I9IA 3QWBA 2P6OA 1XB2A 4UE3S 1EVJA 3MAAC 1PF7E 3OJCA 5KNDH 1F0YA 2GN9A 4ASUD 1W19A 5E1MA 2FPWA 3N7UA 5KU7A 2D3WA 1W48A 1TZCA 3UAVA 5EXSA 1Q0TA 2G6TA 1MH9A 2HQRA 2YWBA 1GZ5A 1IHDA 3LRTA 3SYKA 4V1CI 3FWZA 1FMLA 4M4SA 1Z2AA 1GXSA 1Z7BA 3F7TA 1E9BA 1T2DA 1K5PA 4L76A 3RFCA 3D1JA 4A0SA 3S2ZA 4JLVA 4ND1A 4GQIA 1QVWA 2GBIA 2GZRA 1MQSA 3DDCA 5CUQA 5FYQA 1QYVA 3E9RA 5FFFA 1KY5A 1BYUA 3SMQA 4FZJA 3A6JA 2ZT6A 5CH8A 2XUJA 4IAOA 1FTQA 1T9GS 2J09A 5DASA 2AFHE 4URWR 4E5MA 3T5GA 1JFSA 2SCUB 3UMJA 2P2ZA 1RI1A 5E4JA 4CTOA 1HDCA 1L5RA 4OLJA 4UZEA 3EPRA 1OI2A 5C31A 1U3DA 2O1SA 3GWZA 1WSBA 1II9A 4ZT2A 2WYHA 1PHRA 1H69A 3UAYA 2WEKA 5IVPA 3BRQA 1GKLA 4O5AA 3VH2A 3ZLUA 1E2HA 1EJ2A 1JHPA 3KDSE 4TKMA 5FLYA 4ZC1A 1XLWA 1XWFA 2V7XA 1E8DA 2CWDA 2GA8A 2N3ZA 3EAQA 1LTHR 3QOYA 3ZHYA 1KQOA 4MI3A 4BWFB 1YE3A 5GMOA 2JAQA 1ST2A 1UINA 2JCGA 2I3ZA 3U7FB 1NJSA 3UXYA 2B8TA 2IEIA 3HCBA 4WACA 1T2FA 4F2DA 4D9GA 1FSSA 4Z4EA 2DEUA 3UV7A 4DOMA 3OCJA 3KSBC 1XHEA 3GFSA 1DFGA 3QBEA 1A4UA 1YL5A 1ZPDA 2Z3ZA 1CQXA 1IHPA 2X3UA 4IICA 5AR1A 2HK6A 3HB0A 4U2KA 3B3GA 2JIPA 3MJVA 3M6VA 2HQOA 1XQ6A 3RYFB 2V3WA 2VR1A 4P4TA 1PR0A 4MI6A 2NOAA 4CIBA 1EHYA 3A6ZA 2C00A 2BEVA 1DTWB 1EM8B 1Z37A 3P9ZA 3RH0A 4D0SA 1KYVA 5DP1A 4BPBA 2VZEA 1PR3A 1M66A 1TADA 1WSAA 1ZOPA 3FF4A 4KTTE 3RM3A 2GCOA 3VZSA 1PK8A 3W8FA 4F5ZA 4ZTUB 2CNWD 2VDOB 2WT8A 1DTSA 4V0SA 2Q7XA 3IUMA 3WS7A 2YHAA 4FZ5A 1QNFA 1PT5A 1E3SA 2P9CA 3WBFA 2AMFA 4Q7KA 1HT0A 5LDHA 3FPAA 1XCOA 3O3OB 2R8PA 5EMNA 1XX6A 1KZ7B 1T9KA 3AFHA 1L4EA 3TQRA 4ETMA 3BMOA 3WKDA 8AT1A 4O63O 3T7KA 3FLAA 4PFKA 2MDTA 1XZCA 2BR3A 3THOA 1I51A 4U6SA 4ZXPA 3RAPR 2GEVA 2XYQA 4MW4A 1Q74A 3BXEA 4JL8A 5FUWA 3VU3A 4ENVA 3OZTA 3P4UA 4AO7A 3HXOA 3QEJA 4CKZA 4EELA 1JLLA 2QENA 2J8ZA 3RNOA 1UODA 1ZD4A 2SHKA 4EPWA 2R6FA 4RABA 5HFNA 5C32A 4AS2A 4YJ2F 1Z88A 1GFZA 4DBVO 3VMFA 4KO8A 3PNMA 2O20A 3JQ8B 3L7CA 3NIBA 3ZYCA 3NBQA 3WR5A 4RACA 1EXVA 2C0QA 2W00A 5E6SA 1UT6A 1X7YA 5GVRA 2WP8J 5JH7F 1U8ZA 3CUEF 1ESEA 4GPTA 3RIYA 1V7PC 1T9GR 2OKCA 1GZ6A 1XN4A 2BLLA 2O2EA 3AZPA 3PKIA 3I8XA 4HWOA 2XGMA 4PV7A 4XOIA 1NLFA 3AUKA 3NM4A 1I7QB 5DCUA 5C1BA 2E4WA 1C7JA 1D4FA 1T5IA 3DZJA 3QTTA 4B2YA 1KZ6A 4O3FA 1TZ2A 5AOAA 2GEDA 3WKAA 4KXQA 4XTCS 1O2DA 5JAHA 3UWKA 4EB8A 1V8DA 3EK2A 1Z45A 5FO1A 3AVQA 5JMPA 5K3SA 2E6KA 2QE7D 1MQ8B 4OK6A 5IEBA 3G59A 4EVRA 3DZBA 1KSJA 3RRJA 1EP9A 2F9FA 2QVBA 4TZ6A 3ID6C 3UJAA 1ILEA 4HQKA 5A7FA 2P5UA 5C8YF 5ESDA 2YZMA 2JC3A 4FPXA 1L8OA 2JLBA 2DWPA 2H7CA 2W2NA 3FCCA 4WGFA 3RBAA 2DPLA 3K6KA 2GEUA 5AQEA 1PWEA 5AXAA 1NN5A 3IB3A 1YA6A 1T9ZA 3VZRA 3B48A 2QR5A 2V5VA 4HOYA 1KYYA 1MJGM 3QF4B 4P3NA 1QHYA 5CT8A 3QEKA 1UT8A 4G01B 2NLOA 2AHRA 2QI9F 3VTFA 4MDEA 2DFPA 4M1ZA 1W6UA 2E5LB 2DUJA 3NC1C 4DIKA 4KMSA 4UCFA 4TT3A 4CR8A 4DR1B 5ALZA 2I03A 2PKCA 4EKYA 1L5WA 4X65B 4TTPA 5JHGB 1NR1A 2RHRA 3Q10A 1C4KA 2E4AA 2VHZA 2YZNA 2RGUA 1JLKA 2XMCA 2CVPA 4OA8A 2Y0EA 3D1LA 3WIBA 4AJEA 3LO8A 1U7OA 1J33A 1DPFA 4Q1EA 4DQLA 3OWXA 4FMDF 2GXSA 1IIRA 4YRDA 3HXPA 3ZVNA 1P6UA 1VL6A 4WXYB 3TTTA 2K7ZA 1QDUA 4KZPA 4V3CA 3U44A 4KLCA 4J3NA 3BIOA 4OMFG 2ANBA 2OENG 4ECAA 3CM0A 3MWJA 3U7IA 4E12A 5IDXA 5MDHA 5HDBB 4JT2A 2J9FB 5EP2A 2UUCB 1Y34E 3S2GA 2FA9A 1RKQA 3WAKA 4DMMA 2WRZA 5K09A 3FCEA 3GG9A 1BDIA 3MCUA 4BBZA 1L6RA 3QXXA 2ERCA 3K0FB 1IAVA 4KH1A 4UREA 2EKDA 3PXDA 1C2YA 2OCBA 4MIKA 5I7EA 5AXDA 1DOAA 5GY7A 4RS4A 4UAUA 1ZIPA 3AM4A 4GLJA 1V3TA 3WYGA 3KZVA 4XDGA 4YJ2B 3X1JA 4W1SA 4XEUA 4EG7A 5A4IS 4MKRA 4LFBB 2H7VA 5ALUA 1MB2A 1PG2A 4QFBA 2PPLA 1GHTA 2BTQA 4GYKA 4L02A 5L3RA 4D97A 1PX0A 5JH7B 3IEPA 4QLAA 4CCYA 5ALIA 5DNCA 2FE4A 1YNSA 4H3KB 5E6RA 4GWGA 1QONA 1HE3A 3RIGA 4RDHA 4B3TB 2NMVA 5FD8A 4ITUA 2YFKA 3LPLA 3PIIA 4MPJA 5DRTA 2JFWA 5CB8A 1GTSA 4DMRA 1Y82A 2P5YA 4Z8YA 1XA4A 2P6PA 3E3AA 2KE5A 3ZR4B 4KW7A 1BHSA 3L5OA 3K53A 4L51A 2AFIE 4AX4A 3AR3A 2ZPAA 3M8KA 2QN3A 3K9CA 2BEUB 3HYNA 3IE1A 4YUVA 1JJVA 3U5TA 2GPBA 6REQA 1U0OC 2G28A 3N9IA 4BRWA 5EHXA 1TQ4A 5E2BA 2G3YA 5EJ8A 2EGGA 5IXYA 1QAQA 3C15C 5C8YB 3GLFE 3PFKA 2JCBA 1JE1A 3Q85A 4YR9A 2ZYWX 4K0RA 4K9MA 2C5AA 1X74A 4NV0A 4Z51A 2QBYB 2QTBA 1DV1A 1KEWA 2WIDA 1AKEA 1JT2A 1M7GA 1S02A 1P5JA 1ND5A 3DDSA 3KSUA 4A5SA 1ZWKA 2X1HA 4PSAA 2RH9B 3PQFA 3JS5A 5L4NA 1X7WB 3DE5X 3I52A 3RASA 1VHDA 3KUCA 2JKYA 4ZHSA 1Z4QA 4KXYA 1AA9A 5JS2A 1CQJA 1ZXBA 4NR0A 1U9IA 4U6NA 3VYWA 4CU2A 2H1RA 2ZR9A 4N03A 5JSFA 4IIXA 1I6MA 4FFPA 4UNSA 2JIRA 1YSCA 3WJAA 1JQBA 2XD9A 2A9JA 4G4SO 4W8OA 3LKDA 4FMCF 5GZ1A 2VJPA 3I2GA 4B48A 2OO5C 4FMDB 1UM9B 5DBGA 5ED0A 5HMMA 2E0IA 4QPJC 4JB8A 4PGGA 2Y68A 2Y2UA 3TRFA 5DN6A 1IK6A 1ZZEA 2HBRA 1E0JA 1KOJA 2BMJA 2V0NA 3ILVA 1XF1A 3C3CA 5JD3A 4LZPA 1U80A 1UCFA 4MPPA 1DKMA 2WTXA 3JXEA 1PR2A 2MINA 1P9RA 3AESB 2JGMA 2GJAA 3RUPA 4C0QC 2WIFA 2O2JA 5JJCA 3EGOA 2BHSA 5FPTA 1LPPA 3FGNA 3NO4A 4HHEA 4OB6A 1NTOA 2RARA 5DBHX 3RNLA 2X4DA 4N0QA 5DNWA 2I3BA 1DQSA 4A0HA 4G5YA 4FN4A 3BSSA 5D2CA 3PXGA 3T0FA 3OIUA 1PT9A 5HE8A 2Q9AA 3FIUA 4V24A 3T7CA 1HDGO 1LQTA 3EMVA 4ARUA 3GLHA 2PMFA 1TXGA 3LO5A 5D85A 3TLBA 1TK3A 1T1IA 4X66B 4BEBA 1DQNA 1DWOA 2G9QA 3C97A 4O2BB 4X0EA 4MQMA 4ALKA 5BNZA 1F51E 3SZOA 2Q2WA 4ZA2A 3OEWA 3F6RA 5JTTA 2IGTA 1LWOA 3K9BA 4KUEA 5FDFA 1CUHA 2C84A 1VSUA 3QVUA 4G5XA 2BM0A 4PG8A 5HZHA 3EXHA 5H02A 1Y8RA 1MRSA 1KERA 3K09A 2HMYB 2XUAA 4E3ZA 2WJYA 3ND5A 3C3XA 5IJ9B 4I99A 2ZIAA 4GMFA 4MW7A 3HY6A 5EQTA 3L8HA 4C4OA 1ZM4A 2VN8A 2FSGA 3AMVA 3LHSA 1E7QA 3QLVA 4N54A 3D31A 3S7TA 1PJAA 1E99A 1T5DX 4CMCA 1SHZA 1Z6AA 4LE2A 3SLKA 3DM9B 4MJLA 1SQ5A 3SD7A 3U9SA 2A7XA 4GSYA 4HNAA 1ZS9A 2J6BA 2IOFK 4QYIB 4WKCA 4BGUA 3B5EA 1I2DA 4X92A 3WLMA 1YVRA 4PX9A 4DG5A 4WZAB 4AICA 2I71A 4MW0A 4HFNA 1MNQA 5KTKA 4MRMB 2JAOA 3A1VA 3E2PA 4L5YA 1E4OA 4FFDA 2VBGA 1PJ2A 4JJGA 1P1KA 1N5IA 1BX3A 1NP6A 3H86A 3M6XA 1N75A 3PC3A 3W7AA 1TW3A 4E3WA 2R6JA 3MJTA 4OUDA 4TWBA 2KPOA 3VHLB 2ZRIA 2D3TA 1LLQA 3RTDA 1JR3A 4TRRA 3ZNOA 3EBPA 1G5TA 1C41A 4ZCMA 1VMAA 3S28A 1GPJA 2NG1A 2PM8A 1V1MB 2XADA 4PGAA 1VRVA 3TXYA 2AN3A 3BIFA 3CZQA 4DRYA 3U81A 3LLSA 1FFBA 3QVWA 4BQPA 3BXXA 4UU8A 3V4ZA 5A3JA 1D4ZA 4LJ7A 4RF2A 1MX5A 5JYEA 1PV1A 2AG8A 1CUJA 4FMCB 3K5IA 1YJXA 5I8WA 2W4IA 1E5VA 2FXVA 2P30A 3HVJA 4F3NA 4KZKA 5JXJA 3QBDA 4QBHA 3UAGA 1V9CA 1L8XA 3UA4A 4RTQA 4XB2A 5F3WB 2COUA 1O94A 1DLIA 1ZMOA 2FZKA 1UXKA 4X64B 3FLBA 1L1RA 3I9LA 4C7VA 3PDWA 4G4GA 1J06A 3IQHX 3JYPA 1IEQA 2GKGA 4R7GA 4EPYA 4PN7A 3B3FA 1YBHA 5B1YA 5KC9A 4BMSA 1H8HA 3BBPA 1RPTA 3HDQA 1JIQA 1UDAA 5FLEX 3DUFB 2H2HA 4B4VA 2VWQA 2BGTA 3CVYA 2UZ3A 2LDBA 2QKYA 1FXWA 3ML1A 3QUBA 2COEA 1LTKA 4KLZA 4TL7A 4A03A 1YCGA 3T1QA 2IX9A 1LNQA 2Y1OA 1YF3A 5JXHA 1EAYA 4EW2A 4PSUA 1QR6A 4LW8A 4R8RA 1KDVA 1WXWA 3IP3A 4EAAA 4Q3EA 3A6KA 3SLGA 1E5XA 1KI6B 3U5ZB 2QUBA 3WGHA 2JJ1A 4KR0A 3DKPA 4TTAA 5FUVA 3THRA 1E9VA 2Q6IA 2Z4RA 2PMDA 3BICA 4NMMA 2F3SA 3OPXA 1XLTC 3Q88A 3WK9A 4BU0A 3IBSA 4FIDA 4AWXA 2W0SA 1T6NA 2ZJ5A 3RT9A 3A6HA 4EPVA 4G37A 2B5WA 2Q2OA 5E6UA 4D3FA 2Q9CA 2BEJA 2NGRA 4JITA 2G1JA 3DT8A 3QHPA 3UHPA 2HRRA 4DJJA 2VQEB 3ZJVA 1JEQB 2I3DA 5U4XA 2O2SA 4FB5A 4YN3A 3STUA 5TQ0B 4LVCA 4C3ZA 2DQ4A 1TD1A 5LD2B 3MIIA 2BEWB 3N0XA 3ECAA 4MCAA 3UT5A 5L8VA 3SQDA 2FDRA 5FL7D 4JLPA 1UEJA 3G2LA 2WJVA 3WLKX 2FLWA 4HDMA 4OP3A 4NNOA 1JU3A 1I1HA 1MLDA 1ST3A 2FFBA 4NONA 4P3OA 4RZ2A 2G5TA 4YIKA 1RZ3A 4PICA 1R18A 3MLAA 1B1CA 3FGZA 3BXGA 4JUCA 1QXSA 1ZH6A 2FSFA 2QSYA 3WQQA 3KVOA 1QP0A 1U5AA 1QDLB 2Y05A 5EZYA 2D00A 3DONA 5F2OA 1WW8A 3IKVA 1U3UA 3LSYA 5B58C 5DDIP 3H13A 1HRKA 1TW2A 4ENTA 4QNNA 3V8BA 1ENYA 3MTDA 1K7YA 4UC0A 5BW5A 2WJ6A 2X8JA 3IQXA 3SHFA 2VHXA 2JI7A 3K9HA 1UXJA 4GF5A 3WO1A 4BYMA 4Q9IA 5JJ5A 3E18A 1O7JA 2QD3A 4KLRA 1M34B 1HTBA 3EIFA 1PFGA 3D4IA 5EKSA 1TZBA 2GA9A 4KHZA 3CLTD 1UKAA 3R7BA 4B9AA 2HF8A 5DTEA 3CLRD 4V02A 3DHYA 2KB0A 2C9YA 2QL5A 3GUZA 4LJ8A 3ZHQA 4C2BA 2BGNA 4WLVA 3OOWA 1KZ4A 1KSFX 4EW1A 2BI7A 1GPUA 1TA0A 4WN9B 1KZ1A 1GA6A 1NOKA 2G0NA 3QMWA 4EIWA 2NVWA 1DT3A 3DR3A 3JY6A 1P80A 4QJ4A 2CHGA 3NXKA 1XD2A 4YJGB 5AP9A 4OO3A 1I6LA 1U0NA 2G9ZA 2RHMA 1J23A 2XVMA 2AKAB 3PPXA 4RPIA 3SSOA 3X2SA 3FDZA 4JOCA 4RXMA 2OAQ1 5CLFA 4UHBA 3W6NA 3TTWA 5K0FA 4WCVA 1PEYA 2VSOA 2PT6A 5SV2A 4G0VA 3LGAA 4BNLA 4ME6A 3K1AB 1I2BA 3F7OA 5KU1A 4YAIA 1LLFA 4TV9A 1ZMTA 2GLXA 2Z57A 3H4MA 1KIMA 2O5RA 3KQVA 2IWRA 1X70A 4CLHA 3GNSA 1PU2A 1QFSA 5BSVA 2IHKA 4TYWA 1F6DA 1WXQA 2FX3A 2EQBA 1KEZA 1OZGA 3PD7A 1EWVA 3LGSA 5EWJA 2PBLA 3SR4A 2VDUE 2IF2A 1RP7A 3DZ8A 2IOQA 1BIFA 2FMHA 3EUEA 2BKUA 1F0KA 2D2VA 4NYIR 3RAJA 3NBUA 3ADOA 1BX0A 4G24A 3X3HA 3EIXA 3L8DA 4NU0A 1LFAA 3IDFA 4QUDA 4CMAA 3NANA 1QK5A 1G8GA 1QRRA 2VC2B 3L1VA 2W2MA 2DCMA 1Y3FE 2FPRA 3RANA 1HETA 4RPGA 3E1KA 1U1EA 4D41A 4EHHA 621PA 1KKMA 2FZ4A 3P2MA 2HJWA 2VSQA 4X9XA 1IN7A 4BZPA 4ZEXA 1NXXA 4X91A 4C6HA 2HFKA 3CZCA 4A8TA 4EHNA 2XIQA 5ABPA 3AY3A 3DAPA 3G0IA 2ZCVA 1F8UA 5ICMA 5DOVA 1P9LA 3LL7A 4R1TA 4W6QA 5FO0A 3WLTA 4A82A 2GERA 1LRKA 2PWZA 1R6UA 2CHUA 2H4XA 3I72A 3MWKA 5ALFA 5EMLA 4C7JA 4QLBA 2G06A 4FI3C 4U2CA 1ZHOA 3IERA 4H6WA 4KBYA 1M6VB 2AN5A 2JI9A 1RAGA 2VJBA 3AHDA 4OM8A 1CQPA 2OCGA 3ISJA 2GT1A 4BGEA 3V9AA 4YRMA 1P60A 3D5TA 3QFSA 4K46A 1CR1A 1Z7YA 2PTHA 5A9TA 3IIIA 3EGDA 3I9MA 1N9GB 4UMEA 1JDJA 4U7DA 1LLDA 3IDZA 1YBFA 4I1SA 1K2WA 2UUBB 2CLOB 3IKLA 2R1VA 3O74A 3MLEA 3QVJA 4LPKA 4BO4A 5JZBA 1LS6A 3Q2KA 2A58A 1NWCA 2Z4TA 4NPCA 1J20A 4KQFA 1Y8QA 1K7XB 4JFRA 3HKBB 1BOOA 4P54A 1U0HC 1ULUA 2I2WA 2IFTA 2O0HA 1YQEA 3FOBA 2G7ZA 1ZNZA 3ZD7A 1R3UA 1QK4A 1UPCA 1C0KA 1SK9A 2SKEA 3K94A 1ZI6A 4FXPA 4LHEA 4QFCA 4HUQA 5E9AA 2G9RA 3UAXA 4ZAZA 4DAOA 4CVNA 2BDTA 3ESBA 1UZNA 2PUJA 3IC5A 3FB4A 1CZHA 4HAIA 1MEJA 2GCPA 1FMJA 2P3OA 3CQ9A 3FNBA 4W4TA 2IYFA 4WNCA 3TZCA 1JPJA 1TYZA 5FTMA 3ZDYB 4KP7A 2FSSA 3E9QA 2VRCA 2ZIUB 3WGUA 1OB2A 2QZ9A 4GXTA 4WCFC 3MC1A 3W5SA 1KO1A 2I3GA 3AOGA 2WKSA 1K89A 3ECSA 3I76A 4FHDA 4WK0B 4A1FA 2BGRA 3QX9A 3RPEA 1IY8A 2N75A 2J9GA 3B78A 4TKZA 5IAEA 1DZ3A 4K28A 1QFYA 4H1UA 2X0DA 2YYAA 1UP6A 3IIEA 3IP6A 4QT4A 2A86A 2XWBF 4HWSA 5FWXA 1V8ZA 2XMZA 3WOHA 1PE0A 1E1YA 2FXIA 1SOVA 2ENWA 1A1SA 1XRMA 5NLLA 3OQMA 5AW2A 4PAMA 1KNXA 1A27A 3DQQA 4B32A 4YXWD 1J07A 2PE5A 1PL8A 1U28C 1QE5A 3PE6A 3EOBI 1Y1TA 2CHFA 1RLUA 3ZDCA 4BKUA 4LWZA 1R66A 2NZWA 4PX2A 4OH1A 4G5FA 3RQIA 2RK3A 4QE3A 4ZRMA 2WV7A 4Q00A 4KQEA 5I7WA 2REXB 2VUSA 1M8JA 4ZQEA 1WTCA 1TYBE 3MGBA 2DPHA 3HLKA 5GQSA 2A4KA 1IWPB 4DS3A 3L5KA 4IG9A 2RAPA 1TECE 2EBHX 4H77A 3RQSA 3U09A 1X13A 1T6XA 4Y1FA 3ZHRA 3LVQE 1WCV1 1JI3A 2X58A 3VKVA 2F3UA 1FF9A 2MYTA 4RX1A 4F2HA 5ER9A 4HQ6A 1ZA2A 2GEJA 3JD4A 2WVJA 3KU1A 3MCAA 5A2QA 3O2SB 4Y0VA 3UPUA 4IDEA 4KK3A 4CKCB 5T4FA 2AW5A 1GPAA 4OYHA 3BFPA 3IH5A 3NXSA 3PCTA 3U3KA 4CKEA 1DJLA 1MA3A 1NMSA 4MVJI 4XA8A 3EUFA 4X85A 2AHOA 1Q7EA 3CLHA 1RVDA 1VPDA 1Z8FA 2G4CA 3EEYA 1PYGA 1EFHA 3E3OA 3G5AA 3NEAA 4LXIA 3IDQA 5B12A 3LA6A 2HGSA 2VXYA 2W4MA 1AQYA 2F1OA 1T3GA 1W94A 5I9BA 4P98A 4MUIA 5KDLA 3R8XA 4B85A 1XTZA 2GI4A 3WRVA 3AONB 3WBBA 4ZCLA 4AQ7A 3KSMA 3DYVA 4NQZA 1IH8A 2PH7A 3OZGA 3OO0A 3M4YA 3NDJA 4BTVA 1L5VA 2DKNA 3AHHA 1GFSA 4XRRA 3TDKA 3OVMA 1KOFA 1DKLA 1JAXA 1R4MB 3AEYA 5G1PA 4UBNA 3RSCA 4E88A 4D9EA 4W5QA 2J3HA 3BXFA 3CXRA 3F7NA 3BGVA 4L7QA 4DN6A 4TT3D 1QAOA 4RTSA 1C8BA 2YOFA 3Q3GE 3FRHA 2Y1XA 5IAKA 4JQYA 3WB0A 1Y3CE 1JNXX 1XZIA 4LCJA 4B45A 5ITWA 1PTJC 4GBGA 2H2WA 2ZBPA 1N33B 1DADA 3O4GA 5A4DA 5JVDA 4DV2B 1Y7LA 1IY9A 4BUCA 4XPZA 3T3OA 3DH0A 5A0TA 2WP0A 5DHQA 2I8LA 2O14A 4WCDA 5FPKA 1ZISA 4HDQB 4TT8A 3SHWA 4XSGA 1XK6A 2W58A 1VBKA 3ERCA 4PYRA 5JXGA 5KOJB 4GM0A 3KFVA 5CA0A 5KQSA 1LFDB 4IOLA 3DD1A 1CNMA 4D43A 1HA3A 2XQVA 4JT4A 3WRXC 1MHPA 2VPTA 4UCXA 2HSDA 2BWJA 4C05A 4WJLA 1I5RA 4EDHA 1Y48E