2NYUA

Crystal structure of human ftsj homolog 2 (e.coli) protein in complex with s-adenosylmethionine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
181
Chain Sequence
SYRSRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEVYFLATQYHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human FtsJ homolog 2 (E.coli) protein in complex with AdoMet
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Putative ribosomal RNA methyltransferase 2
total genus 52
structure length 181
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2nyuA00
3HCAA 5GM1A 5LQRA 1NV8A 2PKWA 4MWZA 3EMBA 2XBMA 4QVKA 3A7EA 5LQCA 4FGZA 5DWQA 3R3HA 2FPOA 2PT9A 5EMMA 5M5BA 3EPPA 5FULA 1VBFA 3E05A 4PYLA 5ERGB 5EEGA 3THRA 1X1CA 3LDGA 5LQKA 1VIDA 5G02A 2QE6A 1JQEA 2PSSA 2UYCA 5EHIA 4AZVA 2PXAA 3A27A 3A7DA 4RV9A 4CKEA 2QM3A 2ZIEA 4YUYA 1EJ0A 3OZSA 3HEMA 3FTEA 1Q0SA 4KWCA 4X1OA 1M6YA 2EG5A 3NVMB 4PYMA 3A26A 3FZGA 3HTXA 3QOXA 3SSMA 3KQSA 1VPTA 2GA9A 5EOVA 4E33A 2FRXA 2BR5A 3FRHA 4XUCA 3TRKA 5DTMA 2PX8A 3LDUA 3LX6A 1ZQ9A 5DM2A 2PLWA 5H02A 2Z6UA 3UJCA 3DMHA 3IYLW 4OQDA 1SUIA 1IY9A 3UZUA 3FUVA 3FUUA 3JWGA 5BW4A 1FPQA 5E1BA 4RWZA 2P40A 3C6KA 1O9HA 3DTNA 5P8WA 3UJ7A 4QTUB 2C7RA 3EVFA 2P3QA 3FPEA 2XYRA 3HCEA 2ONYA 4CWAA 2B9EA 4DCGA 2VS1A 3Q7EA 4ATNA 1SKMA 1NV9A 5EQJB 1VQ1A 4RVGA 3EVCA 3G2QA 3PT9A 2OXTA 3R9XB 4PONA 3A25A 5EIWA 1KHHA 5FQNA 3ER8A 2AOXA 1G55A 4H0NA 5FWDA 2DULA 5DM1A 5E1MA 4DF3A 3O7WA 5HIIA 1JR4A 2BR3A 4GQBA 4JXJA 1FP2A 1Y8CA 2AVDA 5EMKA 1KIAA 3LCUA 1NW3A 3T7SA 2IIPA 1D2HA 3SSNA 1U2ZA 3DP7A 2VDUE 3FPFA 4FT4A 2AN3A 3SR4A 2NXJA 3M6UA 2O0LA 3HA5A 5F2NA 3X0DA 4B17A 5DPMA 4ER5A 4RVDA 2QYOA 5DTQA 4EK9A 1BKYA 2VZ9A 3K0BA 4R8RA 1JTFA 1N7IA 1YZ3A 4FT2A 4E31A 3CJRA 3PB3A 2PXCA 3CCFA 2JH8A 3THSA 4OBXA 1I1NA 5K0GA 2IGTA 2ZZKA 4RTMA 2IFTA 3OZTA 1NBIA 4PWYA 3KR0A 1DCTA 4EQZA 3CKKA 5EC8A 3EVAA 3GRZA 4PINA 5KS2A 3BGVA 1EJ6A 2O57A 4GEKA 2AR0A 3KPWA 4F85A 3HNRA 3LCVB 5GP1A 4E2XA 3OCJA 3MCZA 4YMGA 1R8XA 3EVZA 1QAQA 3ME5A 1BHJA 5DM0A 3EVEA 5LQUA 4OA8A 4LWOA 3LL7A 1FBNA 2ZSUA 3P71T 2AOUB 4YUWA 3NDJA 4DZRA 5LR6A 3LKDA 3T0IA 2PXXA 3FYDA 2JHAA 5K0CA 3BGDA 2ADMA 4PIMA 3CJQA 1L3IA 5KQSA 3RODA 3UJAA 2ZLBA 2B78A 2HMYB 2EFJA 4GBED 1UWVA 4ER6A 2R3SA 1R6AA 3BWYA 1G60A 1KPGA 2ZWAA 4CKCA 1G38A 5FTWA 4PYIA 4M7RA 1D2GA 3SSOA 3AJDA 3TKAA 4IKPA 3MAGA 3P9CA 1F38A 2H00A 2PJDA 4P7FA 4QDJA 3G8BA 3VYWA 4ER7A 4RTQA 5K8VA 3G5LA 2OZVA 3GWZA 1WY7A 2P35A 3B89A 4BLVA 1VLMA 3M6WA 2YXEA 1AQIA 3G8AA 4XUEA 5E1OA 4YV2A 3M6XA 3TQSA 1HMYA 3FTFA 4CXMA 2A14A 5HIKA 4PCAA 5CM2Z 3UA4A 4C07A 3BXOA 3C3PA 3FYCA 3EVBA 4WXHA 1Z3CA 3M70A 2P41A 1KP9A 2FK7A 1QZZA 4AUKA 3FRIA 3G7UA 3GDHA 3LBYA 2NXNA 3LGAA 3AWIA 4BLUA 3DULA 3BKXA 2P8JA 4CTKA 1RI1A 2AZTA 4A6EA 5DLYA 4AZTA 4C05A 3EGIA 5DX0A 5FQOA 1JQ3A 3KR2A 4L7VA 2C7QA 1QYRA 5LQNA 1I9GA 3AY0A 5HFJA 2UZ4A 3LKZA 2IBSA 3REOA 5BW5A 2AOTB 2P7HA 3GRVA 3KQYA 1ORIA 4KDCA 1X1DA 2HWKA 3GGDA 1IM8A 1RJFA 5FHRA 4C06A 3FPJA 2I9KA 2PGXA 2E5WA 2C7PA 1KXZA 4MTLA 3SM3A 2O07A 1JG1A 3HVJA 4C08A 3OE4A 4PGHA 4PYNA 4YUVA 2NYUA 2Y1XA 2NXCA 5CVDA 2XYVA 4HTFA 2AN5A 5DSXA 5GINE 4YV0A 5CCBA 5EZSA 3DLIA 2CWWA 3NW9A 2HNKA 4Y30A 4E2WA 2XVAA 3KKZA 9MHTA 5LSAA 2HV9A 3NMUF 2O06A 5F2OA 2EJUA 4QVGA 3B3GA 5DSTA 5E2AA 1X19A 3CGGA 1NW5A 5EG5A 3QOWA 2PT6A 4PCLA 3GNLA 1PRYA 4R6XA 1RJDA 3G88A 5BP7A 4FSXA 3GRUA 3HCCA 3KU1A 3R24A 4GOND 1FP1D 3TPZA 1F3LA 1SVUA 3VSEA 4DA4A 4X41A 3IHTA 3KQQA 3QV2A 3FUXA 4GC9A 4PIPA 1KR5A 3BWCA 3H2BA 4GOOD 2GH1A 3DXYA 4HGZA 4RTSA 4RTOA 5EMJA 2ORED 2NP6A 4XUDA 3TOSA 4YUXA 1NW6A 3CVOA 1RI2A 2VDVE 1L1EA 5EEHA 1RI3A 3M6VA 4C4AA 3C6MA 5CCXA 1XDUA 2I7CA 4DM3A 2OKCA 2ZBPA 1BOOA 1P1BA 4EKIA 5ICCA 2FCAA 3OFKA 3NWEA 3OPNA 10MHA 3MERA 4LECA 4X63A 2O05A 3JWIA 4RTKA 2I62A 3GCZA 1M0EA 3C0KA 1T43A 1Q0TA 3GJYA 4RTPA 5FCDA 4DQ0A 2NP7A 2GAFA 5E9JA 4U7TB 2UYOA 2FHPA 3CC8A 5DXAA 3MCTA 2H1RA 2OY0A 3BKWA 3S68A 1XJ5A 2FK8A 4NECA 3DH0A 2GPYA 3EVDA 3KPUA 3P8ZA 4ISCA 4EVIA 4MQ4A 1YFLA 5K01A 3SVZA 2IPXA 2ZVJA 4G56A 4KIGA 2QY6A 3HCBA 2IBTA 3P2IA 1KPHA 1UFKA 3PX2A 3TMAA 3U81A 2UYHA 2PV0A 3UJDA 4HTFB 1XDZA 5FWAA 3E23A 3KQPA 1NE2A 1AF7A 2OO3A 2FYTA 4GF5A 3GU3A 3IV6A 1ZHFA 5K05A 5C1IA 3G2PA 3I58A 2YUIA 3OU6A 3I9FA 4RVHA 3HVHA 2N47A 4M38A 1EG2A 2Z6QA 4KIFA 5FHQA 2AS0A 5KVAA 4PYOA 5D1HA 5DM4A 5CVVA 3SGLA 4POOA 1EIZA 5EMLA 5BXYA 2IH2A 3AXSA 3M4XA 2PX2A 5DT2A 2I6GA 3BGIA 2LD4A 3EEYA 3OFJA 5EHGA 3NJRA 2IH5A 5FA5A 2IDKA 3T7RA 3WSTA 1X1AA 1XCLA 2YR0A 3HA7A 2EX4A 3OU7A 3BT7A 1JG3A 3G2MA 2ZWVA 4CKBA 5T64A 2P3LA 3OU2A 1L9KA 5DX1A 3G2OA 1JG2A 4PYKA 4FSDA 3ID6C 1ORHA 2NXEA 4KW7A 1NW8A 5DRTA 3ORHA 5IKMA 2GS9A 1SQGA 2VDWA 4E2YA 5CD1A 2C7OA 4Y2HA 3DMFA 3G5TA 3MTEA 2BM9A 3G89A 3GXOA 3L8DA 4PGGA 3DUWA 4GOLD 3LCCA 1TW2A 4QDKA 2P1DA 1H1DA 4AZSA 2YTZA 3VC2A 1JTEA 4HRAA 4R8SA 5U4XA 3ERCA 3LHDA 5E8JA 2YQZA 2VP3A 4UOEA 2WA2A 4AX8A 4YV1A 4RX1A 4KDRA 8MHTA 2QRVB 4ER3A 4BP1A 2HTEA 1IXKA 3PVCA 2JHPA 4R6WA 4V0QA 3RW9A 1I4WA 1PJZA 2JHCA 3FPHA 3LPMA 5CVJA 1YB2A 3NDIA 4R05A 3TM4A 4YUZA 2Y1WA 1DL5A 1EAMA 4DKJA 1ZGAA 1P1CA 4OQEA 5ICFA 4IV0A 1RJGA 5CUQA 4U7PB 3T7TA 1D2CA 5EVJA 1R00A 2OB2A 1MHTA 2B25A 3O31A 1XVAA 3ELDA 3PTAA 2YVLA 3UJBA 3DOUA 4F84A 1YFJA 5D1NA 5EPEA 4E2ZA 1NT2A 3KPJA 4QQKA 3LECA 2PWPA 5E9QA 3CJTA 3FUWA 4E70A 2P7IA 2YX1A 3ELYA 3JWJA 3B7PA 1YF3A 3B3FA 3HVIA 4BP3A 1EQAA 1UIRA 1B42A 3UA3A 3P2KA 4BLWA 5CIYA 5HIMA 3JWHA 4QPPA 3GIWA 3LSTA 3P9NA 4V0RA 2HR1A 5EKUA 5DXJA 3TR6A 2OPBA 2IH4A 1MJFA 2ZBQA 1ZGJA 3BUSA 5E1DA 5EZQA 3D2LA 5K0NA 3PS9A 3TLJA 4DCMA 3KHKA 4A6DA 2Q41A 3KR1A 5K09A 3B3JA 1AV6A 1L3BA 1L3CA 4O29A 4BY9E 4KRGA 5K0EA 1V39A 3TFWA 3NWBA 5GIOE 2AN4A 4OA5A 4E30A 1ZG3A 1YZHA 3GRYA 4RTNA 3E7PA 1RJEA 2ZIFA 2G72A 4M36A 4P58A 5DRYA 2AOUA 4RTLA 3UWPA 3HVKA 1HNNA 3HM2A 3PFHA 1P39A 3MTIA 3BWBA 4X61A 4MHTA 2G1PA 5CVUA 5MHTA 3DXZA 5JR3A 4LG1A 3PX3A 4KVZA 1NKVA 4F86A 5E8RA 2XYQA 3ELUA 1WXWA 2KW5A 2ZFUA 7MHTA 1TPYA 5HILA 2ZCJA 2V7EA 3V8VA 2PWYA 2QRVA 5T6BA 4YMHA 1XCJA 2G71A 1RI5A 2ESRA 1SUSA 3KPYA 5DX8A 5KYGA 5GIPE 3NVKI 1DUSA 3TKYA 1YUBA 3I64A 1AQJA 1OR8A 1G8SA 4IWNA 3EGVA 3HCDA 3I53A 2OYRA 2JJQA 4GOMD 3MGGA 3OE5A 4HSGA 3KR9A 3ANXA 5B1SA 5T67A 4GUAA 3I5UA 4M37A 3M33A 1R8YA 5HEKA 3NTVA 3GO4A 2CMHA 3ELWA 3E8SA 1R74A 4FS8A 2ZZMA 2ONZA 3MQ2A 2G8NA 3EGEA 5FA8A 1VP9A 1SG9A 3R0QA 1KYZA 5IH3A 2IDJA 4X60A 3IEIA 2BH2A 4HG2A 4EMSA 2XVMA 2ZW9A 2Z6AA 1VP3A 1NW7A 2AOVA 2IP2A 3KQWA 3K6RA 3OZRA 3CBGA 1XTPA 3KPVA 3P9IA 2JH9A 1XXLA 5EKXA 1WZNA 3MB5A 4LWPA 2UYQA 1QAMA 4RYLA 4GC5A 5JUWA 5K03A 3R6TA 2ZULA 2WK1A 3DR5A 2R6ZA 2EJTA 4HH4A 4RSRA 4XCXA 4WVLA 4HGYA 4P7JA 3SX0A 1SQFA 3DLCA 1G6Q1 2GB4A 4FZVA 3UJ8A 3KQOA 4PYJA 3PFGA 3HCFA 3C3YA 3HA3A 5GWXA 1RI4A 2AOWA 3SMQA 5C9ZA 3EEOA 1QANA 2BR4A 4C04A 5K0BA 5FADA 3SXJA 1N2XA 2PX4A 1JSXA 2PVCA 1QAOA 2CKDA 1KPIA 5HIJA 2H11A 1WXXA 2PY6A 3B5IA 3DXXA 5EGSA 3UJ6A 3Q87B 2ZBRA 5FUBA 2F8LA 3LBFA 5EIFA 5HZMA 5KQRA 2CL5A 1O54A 2ZTHA 3P2EA 3DMGA 5GOZA 4P7KA 4CTJA 5HOQA 2JG3A 2B3TA 4RTJA 3F4KA 4MIKA 1FJXA 3PLAE 3BWMA 3EMDA 1JSZA 1VL5A 1KYWA 5E2BA 4E32A 3AXTA 3KQMA 2PX5A 2ERCA 3UBTA 2B2CA 4QPNA 3KQTA 2OB1A 3TM5A 3FUTA 3V97A 2AVNA 1ZKDA 3VC1A 1R18A 5F2KA 2YXDA 2BZGA 1INLA 3BZBA 2BM8A 2YXLA 2G70A 4EKGA 3O4FA 2AOTA 5K0JA 5K0FA 4PYQA 1BC5A 2GLUA 4K6MA 3P97A 1G8AA 4RVFA 4C03A 1TW3A 2CMGA 3UFBA 4OX9Y 5GM2A 2K4MA 4QQNA 3EVGA 2NNWB 4AZWA 5CVEA 5LQJA 2WA1A 1O9GA 1JQDA 2DPMA 3FTCA 4FP9A 1P91A 5E9WA 5K0LA 3RIEA 4IV8A 3FPGA 3GRRA 4DMGA 3LDFA 1XDSA 3KQVA 5DTRA 3A4TA 2ZIGA 3UJ9A 2ZZNA 2OBFA 2PBFA 2V74B 4RTRA 4Z2YA 1WS6A 1X1BA 4ER0A 5ICGA 1N7JA 1NBHA 4OBWA 5ICEA 4PNEA 2P3OA 1VE3A 3ER9A 3FTDA 4ZTBA 3HP7A 4QTTB 5LQAA 1WG8A 4HC4A 3MHTA 5C0OE 1JG4A 4FR0A 3P9KA 4P7GA 1M6EX
chains in the Genus database with same CATH superfamily
1G21A 3HCAA 4E6EA 5AJUA 3P0HA 4K5QA 2JZOA 4HAVA 4NRDA 4HXEB 13PKA 4J4BA 1WCV1 3EQ9A 4HGNA 2GCNA 3BWEA 3S8MA 4H1UA 2YC4C 4RXTA 5JSFA 3E4CA 4C01A 3D8HA 2X6TA 2UV8A 1J09A 2DH5A 3LDGA 3G23A 4P80A 4CLEA 4GFDA 2RGWA 1GZ3A 4G65A 2C9CA 3B70A 3TUJC 5FI1B 1Y1PA 5BY2A 1VLJA 1ZKMA 2B4QA 4LHSA 2AK3A 3ODPA 4MUYA 3W0LB 5LXTF 4DR5B 1GGMA 3KB8A 1NRJB 3AVUA 1K06A 3F9IA 4PRZA 4F4IA 3IPRA 4Q03A 1ACMA 2CHEA 2V7WA 4DNXA 1LTHR 2H8GA 3DMHA 2YZMA 4NULA 4RFSA 1SUIA 4TVOA 4MICA 3RU2A 3TN7A 3DKKA 3K9QO 4PQGA 4UEQA 1JKMA 5P8WA 5IVPA 3NANA 4C4PA 3DEKA 4WBSA 3FPEA 3G9TA 1FQWA 1UEJA 1Y6QA 2ZRQA 3NDRA 4CDNA 2DECA 1E9FA 1EX7A 3VRHA 4BQSA 1GGEA 3OZUA 4RK1A 1KJZA 2ZJ5A 1BMDA 3GOQA 5HKBA 5KDLA 3UJHA 5CDTA 4MVJM 1WQ4A 4HX9A 4OLJA 3V8QA 2PZFA 3EGOA 3R7WB 2R2AA 3N2GB 1E1YA 1D9XA 4N8EA 5G2OA 5EMKA 4PPQA 5B6JA 1BDBA 1YCGA 3LCUA 3SC4A 1VA4A 4BKPA 3ZGZA 4NFLA 2A9VA 5JXGA 2AZ4A 1HFEL 5CFMA 1XTIA 3RYFB 3CLHA 1XF1A 2JAWA 3EG9B 4JITA 3VDQA 2B20A 2QNBA 5KWSA 2H7YA 2QL5A 3RKSA 3TFQA 3TKLA 4MZXA 4B17A 5MGBA 1NI4A 2Z09A 3CCCA 4IHJF 4Y9UA 2FFJA 1K9VF 2YCBA 3DOFA 4D8VA 4IZOA 1YZ3A 3UG7A 2OM2A 1G20E 2GSDA 4CQJA 3MGAA 5FH9A 1II8A 2H2HA 4LJLA 4LYGA 1MGOA 2ILTA 3AB8A 3EZ9A 1ATZA 3U3JA 5JANA 3I61A 1U28C 2PMKA 4KXLA 5KC9A 3R20A 3BH6A 4H7HA 2QTFA 3LUPA 3MD9A 3MYYA 1UP4A 2EFCB 2YY7A 3CKKA 4ZYUA 3TW6A 3EVAA 2WR8A 4DMKA 1T4MA 1K6XA 1SOMA 3GMTA 5CA0A 1GZ4A 4EGFA 3PCTA 1B6TA 3COPA 3OZCA 5CJ2A 1CF9A 5GV8A 2WIJA 5BQXA 1AA6A 5DM0A 4OP1A 1FL9A 4LWOA 2R96A 2WILA 1A7UA 2H2GA 3N59A 3NDJA 1S9HA 4UXIA 5LFAA 1UDRA 3QF4B 4JGGA 4WNIA 2Q4DA 3CJQA 1L3IA 2X7JA 3HCRA 4KPUA 4PIMA 3RODA 1RM0A 3C3KA 4XIIA 4NDZA 5LVAA 3OF5A 4QUAA 1XL0A 5EN4A 2QRUA 1TCUA 3QVOA 4QOGA 4DLBA 3RVNA 1WPXA 4I0WB 3COVA 2H4YA 3M4JA 3AKDA 5DHSA 3ROEA 5ED0A 4GPEA 3EWSA 2HBYA 4H7DA 4U9HS 4EIWA 4RTQA 1UODA 1E4EB 4B45A 5I4KA 3G5LA 4K6KA 3LC2O 1J24A 1JDBC 2JI7A 2ZUDA 4PPNA 4DMHA 1LQTA 1KS2A 4INPA 4B6JA 5KZMB 1NUQA 1FNSA 1E2JA 3HABA 4J0KA 4NENB 1JDSA 2E4ZA 2NO4A 5IG2A 2W2LA 3A6ZA 5KTKA 3GQVA 2QVYX 3FYCA 3OIDA 4KGZA 2G1AA 3HSSA 1D8TA 1VPEA 3VJKA 3RVDA 1Y4DE 4E5MA 3IHKA 4DJJA 1K2WA 1KP9A 4PN3A 3QKTA 4HAZA 4TSKA 3WFZA 4DCSA 5GY7A 5KTSA 1PK9A 1XWWA 1YKGA 4IKEA 1V8DA 1ORTA 2FPIB 4C05A 4QUJA 3KR2A 2WF7A 1XB2A 1EM6A 3IP5A 3JR3A 4RVOA 4YRCA 5CJPA 3VO2A 1RWXA 5T4FA 2DBQA 1J97A 1VYVA 2DERA 2IBSA 1TTHA 2RBEA 2YYZA 1RKXA 2COUA 1UKVY 3AV0B 3GF4A 4Q4HB 4XVHA 5EZYB 4FWIB 2XT9A 2G0TA 3WDKA 4YV7A 1C4OA 1J23A 2MYUA 1MT0A 5HUJA 3GGOA 2C7PA 4LRXA 5FA6A 1VBKA 3ZUPA 8GPBA 1UQUA 1SUEA 1SEPA 5I7RA 1FXSA 4B4DA 1QFXA 4Y2TA 3SNKA 3JX9A 4YWHA 2AN5A 1MXFA 2RAFA 2AJTA 4D9FA 2XMZA 3LA8A 1EI9A 4YV0A 3R5SA 5CCBA 2VF4X 1JU4A 3I0MA 2HNKA 5E7QA 3GLIA 5TRTA 2IIVA 4WOCA 5LSAA 1KJYA 2QV7A 3IT1A 2EZUA 2W6ID 2CDCA 1GQYA 2YHAA 5C34B 3G88A 4BCCA 1O77A 4YR7A 5KYNA 2QYHA 2XB8A 1B6SA 3BORA 1ORRA 1QORA 3GDOA 4TMZA 4WDRA 1W4BA 2F00A 3MN1A 5C8ZA 3AUKA 3TG2A 5K0ZA 2EDAA 4A36A 1PK8A 2LXNA 5IAEA 4GOJA 1XMSA 4RTSA 1HYQA 3CWQA 4QTXA 1JHYA 2GN9A 4YUXA 1S2GA 3TYXA 1DG3A 3Q6NA 1GRRA 1DEXA 3E22A 4ND8B 3E5NA 3TXYA 1MOSA 1P1BA 1XXHE 1Q7RA 2OYSA 2Q5HA 3AGQA 3O2NA 4KQ6A 2P5YA 2QWXA 3RWBA 1TUEA 2DKNA 5F9HA 1YB4A 3OPNA 5FTKA 3MERA 4PFSA 4U7HA 1EQ2A 4YMWA 1DIHA 4ZI3A 1D1PA 2A78A 1IZ9A 2PRJA 2GN2A 5H1YA 3O8DA 3WGNA 4KQCA 4H4CA 1P45A 1SKYE 3ECCA 1FSPA 4RZQA 5IJZA 4JXZA 4UVDA 1Z26A 5KKCA 2IYSA 5DCYA 5CDFE 3EMKA 1X87A 4DLYA 4L50A 1TIPA 3HYCA 4PBTA 1FXUA 3PQ5A 3L7CA 3TIIA 1Z0ZA 2GLXA 1NF3A 2XWSA 1BFKA 4RZIA 3U7FB 4QT4A 5ECGC 2V7XA 1Y4SA 3NBZC 3IV6A 1JHAA 4FCWA 4OMCA 4IG4A 4R2IA 4R1MA 1RU3A 1W29A 5ED4A 1UJ6A 4D8WA 3WWPA 1FFXA 4BMSA 3ZVMA 4P4TA 4UMDA 2C3OA 2ZYGA 2EYUA 4I6JA 1NBMD 1Z2EA 4DQXA 4O02B 3BJRA 2WP0A 3AXSA 4UTZA 2AI2A 3EXFA 1H4TA 4IGAA 3IQXA 2D5IA 1U31A 3RUCA 2AC4A 3NJRA 5FA5A 2XXJA 1W93A 3U0BA 5M04A 4M0CA 3TO5A 4PC1A 3MJCA 1LW6E 3WSTA 2VDRB 3IEMA 2QTBA 4JYZA 3L6BA 1IBRA 1ZD2P 2ATXA 1MO3A 3HSYA 1S7CA 1TEHA 3G2OA 4M0EA 1JG2A 4IIEA 4IMPA 1VE5A 2PU7A 4DS3A 2YVAA 1XLTA 2X23A 3OIUA 3Q8WA 3L7JA 4LC1A 4MR7B 4K1XA 2UUAB 5FKJA 3STTA 5K8TA 2WUGA 3C2QA 2I5PO 4AJHA 4GOLD 1W0CA 3AR8A 5A62A 1X7ZA 1TM3E 2W6OA 1II9A 1XD9A 2A0WA 4ARZA 5FPQA 3O1IC 1V48A 5B58C 1C9MA 1NRIA 1QIIA 5ALRA 4JODA 2B7BA 2ID8A 4AF7A 2Z2IA 3RC2A 4H31A 8MHTA 3C7CB 4MYDA 3SC2B 2KB0A 3ZWYA 3FVQA 5COQA 4GMFA 1XK7A 2H1SA 5CVJA 2PZKA 1GQSA 1EVJA 2XI4A 5I7AA 3PF8A 4CL0A 5JQGB 2Y1WA 3URMA 2GCIA 1XOIA 2VAXA 3ILYA 5B58T 2NYAA 2XHEA 1HQCA 4OQEA 1UJMA 1RJGA 4IMJB 2OCDA 1U8ZA 3I9KA 3DTVB 4Z3DA 4EUFA 4AMVA 2CVHA 3WIVA 4KI7A 4L0MA 1Q7EA 1IWBB 4YJGA 2J09A 3JTEA 3PICA 1N0VC 2FSVC 3VKUA 3F71A 1Y42X 2WD8A 4EUSA 5B4VA 1BH2A 1OMOA 2HO4A 1Y4ZA 3K0SA 5G3ZA 3HVIA 5IPFA 1HFKA 2WZBA 5KHOC 4BLWA 5ADVA 3GPCA 4P1ZA 3GIWA 1J0AA 2FDRA 2WPDD 5CRIA 2QRNA 2WWIA 1PV4A 5DXJA 2Q5IA 1UBEA 1QKIA 3WGTA 3DSRA 1M7HA 4EHHA 4UXJA 2VAMA 3QLJA 5K0NA 3PS9A 3TLJA 3U1VA 1G7CA 3OQ6A 3P0FA 4XEUA 3RVPA 1T9CA 3GEDA 4GMKA 2HUNA 1AG9A 2GRAA 2NQTA 4XAQA 3STWA 3WB9A 2XPCA 3RUFA 4OK6A 4OA5A 1ZG3A 1YZHA 4ARBA 4D0SA 1WMFA 3FZQA 3MCVA 3PNOA 1TL7C 5DNDA 4QRIA 4A82A 5DNWA 1HNNA 3HM2A 5E7IA 2F9MA 2WG2A 1S5PA 2D4AA 2D54A 3PQFA 4A8PA 4BEBA 5IKXA 1DC5A 1YVDA 1E2MA 1HY3A 4JEUA 1U6KA 4OG2A 4P3KA 1NKVA 2VHUA 2PAAA 2DCUA 2AZDA 2ZCJA 3IQFA 3AEKA 1QJ4A 4Q9KA 4LFBB 1HPLA 1SUSA 1ZA1A 2Q5LA 5HS6A 5SZKB 2EL7A 2Z30A 2ZRHA 4IZIA 1L8AA 4RD3A 5ERXA 3SJZA 3WP0A 2MSLA 2PS1A 2VKQA 3TPCA 2PUCA 4DN6A 3PNVA 1SHTX 2FPXA 2ZRAA 4GBMA 5A1TA 5HZHA 3OJ0A 2DF8A 2VBIA 5AM1A 1C2TA 1YS7A 1BD3A 2NU9A 3QTLA 5AW5A 2GJ9A 1AQYA 1GKUB 1XRRA 3CE6A 3E8SA 4GYKA 4MGIR 1UMBB 3MJTA 3MQ2A 3HE3A 3LBHA 4NZNA 2MCFA 1WB9A 4I5IA 4DV3B 2E85A 4AJJA 1FW6A 4NJEB 3IUJA 2F1KA 2Y3IA 4I9NA 1LV8A 4KCGA 4QX6A 1YDMA 4XX0A 3I04M 5LZ7A 1RWVA 3UCEA 4EMSA 5JBNA 2WWVD 1DEAA 2VJNA 4BB9A 5EP2A 1NW7A 4XQ0A 5ILGA 3BF7A 1GPMA 1WNTA 1DC6A 2ZANA 1K1EA 1QCDA 3Q2KA 4OAQA 4OXYA 3GDGA 5JAIA 3R6TA 1NFFA 2Y27A 4B35A 2COKA 2QRPA 4FYWA 4ZQHA 2OP1A 3RSOA 2JGNA 1TJNA 3C6ZA 5F3RA 3M81A 3FMOB 1DIAA 3FD8A 1L8QA 5AUNB 1PT8A 1T5OA 1ZK1A 5CYOA 2X14A 2Z8YA 4ZPJA 4AYTA 4CM6A 2D0DA 4Z5XA 4CUZA 1RLUA 1CNFA 3BRQA 1QS0A 2UVPA 3LPNA 5BR8B 4M9UA 2UVDA 1D8AA 3ZS9A 2FMFA 4Z51A 3OP1A 1NUAA 5JJIA 1F8XA 4G0YA 4XGKA 1JLLA 2JLAA 4PXSA 2YZ2A 1AHNA 2JGJA 2CJWA 3NYRA 4LTNA 2F4NA 4CKZA 4TS9A 4P7KA 4HH3C 4FD2A 2VTKA 3OQIB 4PVCA 2X5JO 2JG3A 4FLEA 3GP8A 1JT2A 4HGQA 2HPAA 3FKSD 4B31A 1IOWA 2H9AA 2R47A 3E1GA 1DTEA 3F9CA 3VNVA 2BGGA 2YWJA 3S1AA 3LPLA 5AOCA 3FGPA 2EP5A 2PSFA 3L18A 1C9KA 3PT5A 4CLRB 1UZUA 3P7MA 1U65A 1OYYA 1JN0A 2XLCA 3RUAA 5I6DA 3NWJA 1VC2A 3ABSB 4XKJA 5HF6A 4EI7A 3WBKA 1XMOB 4GG1A 2DP4E 1KE2A 1G3IA 1BWRA 3BB3A 1NAHA 3FF4A 3IILA 3RGGA 4CM8B 4W9MC 2O59A 3KSDO 1CEQA 4MV3A 1C9EA 3VNRA 4Q15A 3FPKA 3UT6A 4CLDA 5CHEA 4QDZA 1RQRA 3R9XA 1FP4A 2YHIA 3I6BA 1SPXA 4OHUA 5CVEA 4HRVA 2PBLA 5LQJA 3ZK7A 2JEZA 4BP8A 1A4RA 4H1TA 3ZUGA 4UFPA 1PFKA 2JGEA 5AWFC 3BXGA 3ZGVA 1OYOA 4N48A 4EO7A 3KYBA 3UJ9A 3HKCA 2IEAA 2PBFA 1R37A 5ALLA 5LPNA 2VH5R 3CVWA 4B4WA 2H48A 2QMOA 3V5NA 1JJFA 2Q2OA 4ZYYA 4AJ9A 2HD4A 2IUFA 2Q2NA 2G5GX 3LFTA 3PC7A 2HIMA 3ILSA 3FTDA 4ZTBA 4J0GA 4CV1A 2WHEA 3ZE9A 4ZTUB 1H5QA 2GAIA 1CY8A 3GIDA 4Y0AA 4C5CA 4BJHB 1JJVA 3BFVA 4BO5A 1NV8A 3CEPB 4D1YA 3AIMA 2ODBA 1N2SA 3T7EA 5LQCA 2QPOA 2XOKD 2W4MA 2FPOA 1U7HA 1CERA 2PT9A 3IQGX 4JC8A 2Z2JA 2Z9BA 5ERGB 3L8EA 4WV3A 1YFKA 2TMKA 1K98A 1RKVA 3PR1A 5T8KC 1L5YA 3O3OB 4BLPA 5EHIA 2UYCA 5L3QB 1MV8A 1ZMRA 2BKLA 2PXAA 2GFHA 3HFGA 2HMAA 4TVBA 4XYBA 5FPHA 4QQ8A 1KBOA 1GRQA 3B6JA 2VSFA 3HNPA 3KXLA 1J0BA 1M6YA 4MS3B 5AVKA 3W6ZA 4PYMA 1H4QA 1OFHA 4LV6A 2YJ3A 4NC9A 1LQUA 3CY6A 4IDOA 1G3RA 3SSMA 2OV6A 4DUGA 4GU5A 5A4IS 4KLAA 5KU7A 3VBEA 4C3OB 2FRDA 4BFWA 1R7RA 2ZJ1A 2EL9A 2M6SA 2HAEA 1GCAA 3ZR4B 3PNLA 4Q16A 3TEJA 3QLUA 1T5LA 4WESA 4AB1A 2GUGA 4DKXA 1IEXA 2O2CA 1K68A 2H4HA 2VP2A 2P40A 2GHRA 4EGJA 3DTNA 2QTAA 1AQUA 4F7DA 3ITNA 4ND8A 3CUUA 4QTUB 2CLEB 2W7TA 1ML4A 5J43A 4I46A 5HJEA 2I3DA 3NIGB 4WI1A 2Y1KA 1TJPB 1X77A 1Z28A 1XQWA 3DVSX 5IDQA 1X8JA 2DQSA 4FE4A 1DPGA 1GQ2A 3F8WA 4ATNA 4D8YA 4E22A 2ICAA 4K2AA 1VQ1A 1TAGA 1TT7A 3BCHA 4XW2A 5AVUA 1GSAA 1KEVA 3GG2A 3PNBA 2ZSKA 3DFMA 4QXMA 1XV5A 4YAOA 3RFTA 4ACAA 5FWDA 1YTUA 3N8KA 5KYVA 2G7ZA 4IDCA 5BR7A 2LRHA 2J48A 4AS1A 1YRBA 3NNNA 4WMLA 5HQ3A 5K0CA 4TQUS 5CM9C 5CR9A 3F67A 2YXBA 4WERA 2GO7A 2C5EA 3AFOA 4YJ2F 2B2NA 3EGCA 1KDVA 1U6JA 2WJ3A 1TOAA 2GJAA 2QJRA 3SJ7A 3KQKA 3L41A 1RKQA 1L6RA 4DLWA 3IRVA 2AG0A 4H6VA 4KQWA 1DNPA 3JS5A 4EQ6A 3K8QA 2VZ9A 3ZW8A 5K0TA 3HQ4O 1ZL0A 3I9JA 1JQAA 4GPTA 5LOVA 4N7BA 3D6JA 1T4GA 5CLIA 5FUXA 4OQLA 4XYLA 1ATIA 5REQA 4J76A 2QDKA 4GMXA 5AKJA 4J3FA 4WA7A 2NTEA 5FOQA 1A8UA 5KNCA 5K4GA 2A5FA 1EVQA 1W0KA 2IGTA 3HRHA 1C4XA 2MMGA 3PCRB 4KFCA 1H6BA 4Z0HO 3FSRA 5FI3A 5EC8A 5KS2A 3SBEA 1HDYA 1DINA 2Y6VA 1MOQA 2QVLA 4NIMA 4O25A 3SZOA 3UY4A 4JJKA 1VMEA 4C0XA 3BMQA 2EV9A 4YJKA 5GP1A 2E5LB 3OCJA 3CSUA 3E15A 4H08A 3G2HA 1CEEA 2DT8A 3P2MA 4RHYA 4CMCA 1YKFA 2QM8A 2AJ8A 1OBOA 3RVJA 4LSWA 4QQFA 1YUNA 5KOHB 3ZWMA 1GNQA 2XUFA 4B87A 5BXQC 1W49A 1X7HA 3VR6A 3VZCA 3DBRB 2FSGA 1SCIA 3OOWA 4F3NA 5D51S 3N5CA 3M82A 1ZXBA 1QGYA 1QK4A 1G38A 2HZBA 5KUTA 5M7EA 3KWMA 2BHSA 4I55A 1H3EA 1DQSA 1LVGA 2I2AA 4ZV4A 5DLDA 3KK0A 1U5AA 4YAUA 4QDJA 4L4RA 5DBIA 2IZ7A 5AJHA 1M6HA 3G9XA 4RHEA 4V3CA 4D3FA 3H16A 1XRLA 3TD6A 2DLDA 3F2IA 2X7HA 1KKUA 4P92A 4EJ2A 5HIKA 1MCZA 3R4VA 1C81A 1AT1A 1C3LA 3H9GA 5K7SA 4B7XA 1HFWA 1WL8A 1SA0A 3EVBA 1YBAA 3QA9A 3JY6A 4FX2A 4WXHA 5SY4A 4ZIRA 5LMUB 3E3OA 2I65A 3H5AA 4LPKA 1GFIA 2NVBA 2DFPA 3AJ8A 3R4CA 2IY8A 1ZSYA 4O3MA 2QN8A 2ODNA 1L7RA 4KOAA 4A8JB 2EGHA 1JR3E 2Y9MB 3GD5A 2XDWA 3EGIA 3PFBA 1AGXA 2I4OA 4G0PA 4V38A 3TB6A 3P4UA 4UM9B 1H05A 2VQ3A 3L49A 1ULHA 1WLYA 3NORA 4QGAA 3FTQA 2OL4A 3MCWA 1KL7A 1OGYA 1JFVA 3A4YA 1SXJE 3CX8A 2HSGA 2ISQA 3BSFA 2HWKA 3HY4A 1J2YA 3M8KA 3ED5A 5DULA 1WUJS 1N9ZA 4RVNA 3NOVA 1W9MA 4BMVA 4ARUA 3KAPA 1Q7BA 4XR9A 2XWQA 1UBTS 3NRBA 4YLGA 2Q27A 3D9QX 1A5TA 2OD9A 4UJ3A 3AK4A 4IXMA 5AW4A 2IP4A 1GTJ1 1XTBA 2OV8A 1FX1A 2XGSA 5KNLA 4E46A 2JFPA 2ARKA 5DSXA 5E9AA 4LRYA 5CDUA 3H7IA 4RGQA 1Z7WA 2W58A 1M1NA 2CBGA 3T9DA 1OF1A 2RMKA 1QTQA 2MINB 3KKZA 1REQA 1TM7E 1H1LB 2OZKA 2R60A 3C5EA 4MUJA 4DV6B 3DDNA 4Q4AA 2OAQ1 5IJ9B 1DQZA 1JLHA 1T9GS 2OECA 2GAOA 2YNMC 3IEPA 2GPSA 4JXKA 2NZXA 3R24A 2PUGA 3O4IA 3HJCA 4I4IA 1JDNA 2FJ0A 4I6EA 2VUSA 1SVUA 2NT3A 5E4FA 5DCWA 1BXZA 1ODIA 4AS2A 2PDAA 1Q7CA 4I2VA 4JSRA 5ALSA 3FHCB 2JK0A 4OJKA 1T29A 2VRWA 4MZDA 2XGMA 4W9NA 4F9GA 1VM6A 1Y9AA 1WQ1R 3M6LA 4EJFA 4ZT6A 1GILA 1G21E 2QPTA 2XVYA 4B6PA 2FLWA 1XF9A 4IR7A 1ZJ6A 2YBEA 3SFTA 4BPBA 4BEJA 2FG6C 2I7CA 2XUAA 3PUJA 3WB2A 4F12A 3IUPA 2VDWB 3GA7A 3PQEA 5LP6B 2PUJA 1AKYA 2BBSA 1RR6A 5E2IA 2QTGA 3OEWA 1WPRA 1AGRA 2EARA 3R9KA 1HKHA 1G5PA 4N65A 4ZEMA 4L9WA 2IS1A 3TAUA 1ZICA 5LLSA 1HLDA 3C0KA 3D0KA 3KSMA 3WQSB 1Q0TA 2RGGA 3GJYA 4DQ0A 4LY9A 5E6UA 4D3DA 4ESVA 2H4ZA 5DM60 1YIOA 1ZU4A 2H1RA 4MRRA 5HM6A 2XTMA 1JQLB 1M5TA 3Q85A 4NDAA 4NYIR 1RHJA 2WUDA 3F98A 4C4TA 4KGDA 5KBYA 2BJHA 3SR3A 5K01A 2MINA 3DB2A 2BGRA 4DREA 3X1DA 1VSUA 1OY1A 1KPHA 1U02A 4F1JA 1CLUA 4DXDA 3C70A 1I5RA 1XBTA 1RYNA 4CIXA 4YRQA 5TIIA 4MS1B 5G1PA 4A26A 4YFVA 5K05A 3FR7A 3G2PA 1YDEA 4Y0VA 3I9FA 3AFGA 2I6UA 5JAQA 1BVUA 2CC2A 2VZ8A 2WPDA 1IXRC 1PT6A 5FHQA 3F73A 3RT1A 3R7LA 2UUOA 5JQWA 1IBMB 2IX9A 1FW8A 2CCJA 5U4QA 1M10A 1NXVA 2Y0CA 4AKTA 4DUPA 1D3AA 1SQ5A 5AKKA 3RVKA 1EEXB 1XZIA 4BJ5A 1C14A 3VFDA 2BYTA 2FPPB 5HR5A 1VSVA 4I50F 3ZD6A 3BREA 2FR0A 2OORA 3C6YA 1NU6A 2HYIC 1SJ9A 2PKCA 5DWDA 2J3MA 5KNDD 2EX4A 1L8LA 3NTUA 3B9BA 1ORDA 4ONEA 2ZWVA 1UM8A 1UJ4A 3FX2A 2DAPA 2XSZD 1L9KA 2AEEA 2XYHA 4NOKA 4DY6A 4RFLA 1Z0AA 2PX6A 3MWEA 4IJKA 1JMKC 2IEIA 3VQTA 2Q2WA 2ZREA 1E66A 2ZJ6A 4NCNA 1V4BA 2ZRGA 3FNEA 5JSYA 4NI5A 1SN7A 1WDKA 4K7JA 1ZA2A 1V1MA 4M83A 4O2RA 1IJEA 3QU5A 4GO1A 1LPOA 4TQAA 5B37A 4WKOA 1C3EA 1H1DA 3FA2A 2FUG1 1T2UA 5TPZA 3D5QA 1BA3A 4Y2RA 4NABA 3HWWA 1U28A 2FEWB 4QDTA 5E8JA 2IE0A 2Q8NA 4RZ3A 3BHNA 1E6CA 2ASEA 4RX1A 1JR3A 2FDCA 1VYTA 3EA5A 2ZITA 3RIYA 1NVBA 5BNIA 2VHTA 3SKXA 2JHCA 3WRYC 3Q72A 4R05A 2INGX 2IOHA 3LLCA 4RCYA 4ZCQA 3U6KA 5CA1A 1CBUA 1M2WA 4UHFA 4Y6GB 2FEOA 2DFDA 2VJYA 2WKWA 2YYSA 4B46A 3I6YA 2GHTA 1RZRA 4TKMA 3D4BA 4D9CA 3LS2A 4B3MB 2DPHA 2C7GA 2ZUTA 5KYUB 4GYJA 2X7XA 3PIDA 1AK9A 2HDHA 3PPVA 4O8CA 4U1RA 3C3AA 5F21A 2H1VA 2QI9F 5D1NA 4LJ9A 5IBRA 3N07A 3ANSA 3RROA 5KJCA 3KPJA 4M22A 1H1TA 1KYYA 2IXFA 3D3JA 4MW2A 4QU9A 1RXUA 2EHJA 2B3DA 1ZM9A 4KQ9A 2HA0A 2BY4A 2EERA 3E3LA 2WU3A 1EQAA 3OOYA 1B42A 4JP5A 4JIGA 1EWVA 2VJKA 2GPJA 4V2IA 1VJTA 3CPEA 2HHLA 2BGNA 2N0SA 2OQRA 1N6IA 3OT5A 1MVNA 3P9NA 3DKIA 4HATA 5JJCA 1XEFA 1ZO8A 1MJFA 3ZQ4A 4UOZA 4IRMA 4JLWA 4WKPA 4TROA 2EBUA 3OA2A 5DH9A 4ZHSA 1IVSA 3TLBA 1TK2A 3O8CA 1PJTA 1U1EA 3H75A 3GFOA 4ZK6A 1WVGA 2QLTA 4UUNA 1EE9A 5F4ZA 6YASA 4AJIA 3U4IA 4LK2A 1V39A 3T38A 3TFWA 5A05A 4MW5A 1P8AA 2H6EA 1NF8A 2HRZA 4D9IA 2FEKA 3DC2A 1ZIXA 3GVPA 3KEOA 1JR6A 3TAXA 1L4BA 1Z5PA 1Q84A 2IYZA 3JPWA 4HPWA 3RH0A 3G5MA 4LNUB 3SYLA 4TZTA 4F4UA 4X61A 2Z3WA 5H7XA 1LJLA 1QDUA 4S1OA 3AIOA 3K3PA 4CG0A 4MYTA 2O19A 1UEXC 3OIWA 4RPKA 3I39X 1G8HA 2D7CA 2Q1YA 1B1CA 2QENA 2Z8XA 4DFDA 2CBZA 2IYNA 1BQ4A 4ETWA 1D4FA 4CM3A 4K9RA 2HLNA 4PY2A 2ESRA 3WTCA 4FWBA 4EG0A 4WNAA 5CK4A 3WZ2A 3D81A 3T5TA 3PC4A 3IAM1 5DBFA 1PSDA 2EZ9A 4JMLA 2OV1A 1DAPA 1A04A 3G79A 1RLJA 3N1UA 4IHJB 4TYQA 3DYVA 1MQSA 3OHPA 4FW8A 3PJRA 4KPYA 3UVEA 4QLBA 2Q2VA 3GO4A 1WZEA 2V6IA 2IIBA 5A0VA 1M0SA 1R74A 1UXKA 5JTUA 4H7IA 1K5GA 1WP4A 3R6WA 2NVUB 1SG9A 3QRWA 5M29A 4KPGA 1QUEA 3INRA 1KDOA 1AS3A 5JMWA 5TJHA 4HN4B 1AA9A 5B1YA 2AFIB 4OJYA 2D1TA 2HLDD 4KKVA 1Q6YA 2OZEA 4X3CA 3TF5A 5FUYA 1JBQA 1BMQA 2EX0A 1U0HC 3GUVA 2JH9A 3AUUA 3GFVA 3F8SA 4G1CA 4LE2A 4MI3A 5AKXA 2J3JA 3MGKA 1ZGZA 4UASA 3NU1A 5FTLA 2QLMA 1GOTA 1IMOA 4R0MA 2IZ0A 1PWXA 2Y0PA 3CG4A 3L7NA 3BVPA 4R41A 4LBYA 5CXUA 1WR8A 4FDUA 5CW1A 3GCGA 4LYYA 3PFGA 4R83A 3R77A 4FYXA 3BIFA 4HSEA 4R7GA 3EEOA 1NQXA 5F77A 3NC0C 4X71A 1OI7A 4KR6A 2PX4A 4MA4A 4TTJA 1BW9B 2CSXA 1CRPA 2WHPB 4ES6A 3RJ9A 4G0UA 1OLSA 4PCVA 4L0DA 4YB8A 1OA0A 3R6GA 2FFQA 2AK2A 2GD2A 3CNLA 2F4VB 3ZHZA 5SZIA 1D03A 4L4YA 2ZJ3A 3PKIA 1FYFA 3F4KA 3WKDA 1U81A 3ILHA 5AKGA 4A15A 3DZDA 1GYQA 3BDAA 4U5XA 2O0KA 3QKWA 1XMVA 2BZ1A 4WXYB 1KYWA 2O8CA 4HN9A 4JKIA 4MPDA 4E3WA 4ZGGA 1YVEI 4WBNF 5BPHA 3WBJA 1LQ2A 2WDPA 3VC1A 3PRHA 1F2TB 3IOBA 3RS5A 5AJTA 4II7A 4L02A 2QJTA 2VHQA 1B15A 1Q3TA 1K7SN 3ZXUB 1QVVA 2AOTA 2OO5A 2PD6A 2WYIA 5L45A 1J6UA 5FXMA 1HTTA 4FFBB 2O52A 5F12A 2ALJA 4I1RA 1X2EA 2CMGA 1QFJA 1ULUA 4HDSA 5JT1A 4IIBA 4QQNA 4BTEA 3SPXA 4I99A 4P54A 4MUBA 3MINA 5M2QA 1GITA 4Y67A 3H0CA 1O9GA 1S96A 5TQVA 4TN1A 3E5RA 1Q0RA 4Z9XA 1U7WA 4A0RA 1LPNA 2BTEA 4OXKA 2KM1A 2EZ4A 3ND6A 2PZBA 1MDBA 2O0HA 3SEZA 3TZLA 4F91B 5L53A 4G1UC 5KPJA 2OBFA 1SVLA 2C4NA 2OCLA 2VWQA 4LYDA 1XXHA 4HRXA 5FOVA 4ZKEA 3SXUB 1S3FA 4DGQA 3CISA 4V0OA 5HRUA 2I7VA 1YK1A 3C5VA 3M89A 3T15A 2BC9A 4EAQA 3NKLA 1T1RA 4CUKA 4DY4A 1WG8A 3B3AA 3FTPA 4OY3A 2ODEA 1M6EX 1K4YA 5DYTA 3VNAA 2GR9A 3CVVA 3FPLA 1E60A 1VCNA 2G76A 2WZCA 3AHDA 4F92B 3V4SA 4BVFA 4TRMA 2BLLA 2IXAA 2W90A 3RG2A 2GNAA 5EIEA 5ANRB 3KTAA 1KJIA 5BRNA 3C4QA 3DNMA 1QF9A 1P7CA 4AD8A 1A7AA 2PSSA 2X1VA 4HDAA 3EXG2 5F64A 3U13A 1TUBB 1Z68A 1HE3A 3NBXX 1QP7A 5A4KA 2NVWA 4U39A 2BLNA 3GXBA 2OCPA 1NWHA 4KWCA 2NQ2C 2VF7A 3CZMA 3ZNQA 4F97A 4OSPA 1ARZA 3A26A 3CUWA 2QTMA 5IT4A 1AN0A 3FWNA 3O26A 3X3HA 2Y0DA 4H1WA 3RWMB 2QAGA 3MINB 2FEPA 1USUA 1WXQA 1FXWA 4FILA 4B1FA 4YP6A 2IZOA 1JLRA 3TRKA 3BG5A 3E9NA 2QD3A 3PEEA 4KLRA 3Q3JB 3S55A 3UW1A 1ZNWA 2PJRA 2IU3A 2R65A 2ZR9A 4QODA 1IY9A 4QTZA 5GMOA 4P4SA 4RWZA 2GBCA 4HEQA 1Q91A 2VK2A 4HQOA 4I4NA 5AVWA 4XDHA 1QCCA 5EJAA 1YBVA 5DP1A 1DO8A 1QS0B 2O7QA 1UJ2A 2UVPB 1H2FA 3HJAA 4JX8A 4KMSA 2A1TS 1L5SA 2GN1A 1AV7A 2JBAB 2PRIA 2XZTA 3KCNA 4IYJA 4IH9A 4S1TA 1D2AA 1YI0A 2P67A 1K7CA 1QMPA 3G2QA 3IMEA 3L8CA 2WYVA 3MLBA 1KDZA 2A4KA 5FQNA 3CLSD 3EYWA 4R9NA 3HZOA 4H0NA 3O74A 4HEA1 3PKJA 4XOUA 4BNNA 3IP8A 4P33A 4HNHA 1G2PA 1TU4A 1L4YA 1X92A 3DE6X 4JT9A 4EG3A 3EIFA 3UGJA 2ATCA 1PI3A 4BQFA 2CGEA 3ZWQA 1SCDA 3TVTA 1HDGO 4ARIA 4EPVA 3GUYA 2FQQA 3H5LA 3K35A 2DUNA 1V25A 3K9GA 3M6UA 4PO8A 3NX4A 4DIFA 5I8PA 1VL8A 1YGYA 4CFYA 3H5VA 1BVHA 5CFRA 2W2VA 1VKRA 1GV0A 3GH3A 1Z5ZA 3ZCUA 1FTNA 3AEQA 5FT9A 1CRZA 3CJRA 1MH1A 1W4RA 2WVJA 2XH8A 1O57A 2BFNA 2WKQA 3B6IA 3E1KA 3JZAA 1MAWA 4U2FA 4UBKA 1P4GA 3DVAB 1VHQA 2OC4A 3TZKA 5EFOA 4YXFA 2XXAB 1CIJA 2W37A 3W9UA 4P8RA 3HCOA 3SR0A 3WLIA 2RG1A 1NHGA 3CRW1 3NHFA 3FOEC 5EKDA 5YASA 2Y0BA 1KEUA 4XLLA 4XH9B 1IG0A 3NV7A 2Q3HA 4L27A 5B36A 1M2NA 2HF7A 2P2LA 1MB2A 1O95A 3W78A 1XQ9A 1XKTA 5AUPB 5CDHA 4E5DA 4YUWA 4TL6A 1D9ZA 2W83A 1TIBA 2YZNA 5A4FS 3STVA 5IXJA 4UKDA 1UBKS 1Y9EA 1ZM7A 3U5TA 1I5OA 3RU7A 2PAFA 3NTRA 2OHHA 2H3HA 1NNEA 3J7AC 3SF8A 2R84A 1BYIA 1OI4A 3RIMA 5E3HA 5CCEA 2CNWA 4DJAA 4PYIA 4ZZ0A 2PZMA 4QOJA 5AVXA 2I4TA 2RAPA 3OZEA 4CHTA 5BVGA 2Q46A 1Z13A 1W59A 2C5LA 4HXGA 1QK5A 5BYKA 4MPTA 4BNKA 4N6NA 1Q3KA 2Q29A 3CUVA 1ACJA 3K9LA 3Q3EA 2IOFA 4KBGA 4EX6A 1EUDB 2BSAA 3NTLA 1ZBDA 3NXKA 5EJFA 2XCLA 1VB3A 3FPAA 3HDJA 4DLUA 4MARA 2P75A 3OY7A 1TA0A 1WCWA 4G0WA 1VPVA 2CVZA 1K97A 1NAIA 3D5TA 3ZCVA 3OHMA 1JR2A 1GRNA 3KQHA 2C2XA 2WW8A 2NXWA 2FW9A 2R7LA 1YU9A 3GA5A 3KHSA 4RPJA 1C7EA 1GKIA 1HC7A 4UEKA 4ZVRA 4DSOA 4EAAA 5CFOA 1S2NA 4O2AA 3GDHA 4PSAA 4CKWB 5JCJA 1C1DB 1HOXA 3ORSA 5TMBA 1CETA 5BWCA 2R4TA 1IK6A 2Y1GA 2PO5A 4MQMA 1LS1A 3ZOKA 2L82A 4XM2A 4M9SA 2C0QA 1NL3A 1TXGA 3HU3A 3IXLA 2ZT7A 2VG8A 5L40A 1AM4D 1E7MA 2J3DA 4MP6A 1PNQA 5HP4A 2HR1A 5BW5A 1U1CA 3KOWA 5EGNA 4ZV7A 4CL2A 4OU5A 3EZLA 1GRVA 3G5AA 4G0MA 4K9PA 4ZOCA 1GDHA 1ZCAA 3WS7A 1RM4A 3ZZNA 5LUAA 2AMFA 3IIEA 1G7RA 2A86A 1DEKA 4QHSA 3LF1A 4LYJA 4CM9A 4DC1A 3IDZA 3TXAA 3RTGA 3AR9A 3QWIA 4ENPA 5CG1A 1S6YA 2Z95A 2HA7A 1QQ5A 3IJRA 1Y3DE 4MR7A 3W4IA 4BE7B 6REQA 1YR2A 3JPYA 4DADA 4GDFA 2O06A 4R8VA 5DSTA 4DJFC 2IIQA 1S02A 4LXGA 3VZSA 2HWXA 3L1UA 3MWKA 4OYYA 2NUBA 4QXQA 3WLQA 3EW7A 1W4ZA 2I71A 1YGPA 3WNDA 3CVJA 1YRYE 1I80A 1NVMB 1SC9A 3ASZA 4GLOA 4LV5B 3HLKA 3O94A 3QMPA 4OLAA 5LKRA 3V42A 3L7IA 4BQOA 1QOPB 2H0AA 1YE5A 4REQA 1E2DA 4WNAB 1CE8A 4B6FA 3LGSA 1R0XA 1UBMS 1W0JA 2VJPA 3HUDA 3RK1A 1L1EA 1UUFA 1RI3A 5IHPA 2REQA 1U2RA 4LX0A 3NEPX 1LPAB 2ZBPA 4TYMA 3VC3A 4EKIA 2PUHA 4D6PA 4MOWA 1CNMA 1R9JA 1QGUB 4I5EA 4F8EA 3NWEA 5H3LA 1GIAA 1GTSA 4IF6A 4TKVA 1DXQA 2BBTA 3O0DA 4XGRA 1MHPA 5FOXA 3T34A 1JAYA 4Y9DA 2J6CA 1WAMA 3GEPA 3FG9A 4NU8X 2ZSHA 4UEWA 1X1EA 2XUQA 1DT3A 4TMXA 4UUOA 1SOUA 3PLRA 2PSHA 3N2GA 3G13A 1D2NA 4KLZA 3TQOA 4NECA 2XQGA 3BHIA 2Z5LA 3FYUA 2JLWA 3OZVA 4FPXA 1JVNA 1UC9A 2H7XA 2IBTA 1M2EA 2QT9A 2RGAA 4UHBA 1UFKA 4XIGS 2H85A 2VRNA 2AA3A 3BXHA 2G40A 3ET5A 5T4EA 3W5DA 1ZLXA 1MAUA 3INTA 4ZO7A 3LJKA 4F8YA 4GKBA 1M75A 3OX2A 4B09A 1REQB 4ZC8A 4HVCA 4AUEA 4F93B 1JIXA 1MC1A 4LF4B 1EGQA 3KV3O 1YOVB 5BQPA 2EBWA 5PNTA 4OUDB 2XA1A 1W88A 2EAUA 3W8DA 3L8HA 1R5BA 3KZKA 5DWVA 3SJUA 1EIZA 1QFYA 1K6EA 3WKBA 1T8YA 2VT2A 1SA0B 3O4VA 4F56A 3O95A 4HYQA 2CXSA 3CX7A 1R0ZA 1TD9A 3LUBA 5F76A 4FMCB 1U8AA 3O21A 1GSHA 2PSDA 3EG5A 1HDRA 4GR9A 4ENUA 1ECGA 4KH1A 4KVAA 3HA7A 1GTVA 4YXWA 1NJ5A 2JCBA 4IBOA 4P22A 4YMSA 3M83A 3AV3A 5LBIA 3UTCA 4CKBA 1SVNA 4RD6A 4CQLA 2J7PA 1Y8RA 2XWJI 4LF7B 4HDNA 4DA7A 3FLAA 5HDBB 1P0FA 1JBKA 1HRKA 1EK6A 4OFXA 3GT7A 4R7ZA 3DUWA 3RB8A 1ZMOA 1KTIA 3GLQA 1BXKA 4J75A 1BCRB 3NFRA 1O7JA 3DNPA 4J43A 1JXOA 3LVBA 3DE0X 1QONA 3ERCA 1E3JA 3HJUA 4KR3A 4BX0A 3L01A 4R2HA 4Z3OA 2MMCA 2WD7B 2GCOA 2HCTA 2AYYA 1X8XA 1H93A 2HU2A 2PX0A 3DV0A 3OH8A 3PJEA 3OD1A 4GI3A 3V8PA 1OJLA 2PZ8A 2GA8A 2ZRIA 4J16A 5I9IA 1CQXA 1EJ2A 1QH1A 1UAGA 3Q0TA 5F73A 4F8JA 5B2EA 2XZLA 1PL8A 2GZDA 3NDIA 3DQPA 1OZHA 3K1ZA 2VAPA 4DDTA 1FDUA 1MRSA 1ISMA 2YHSA 2JAUA 2ZYWX 3RARA 3VR5A 3H18A 4UXHA 4B81A 2EU8A 5AIBA 4BO7A 4DEXA 4KZPA 4BMDA 1QHFA 1YE8A 1F14A 4HWOA 4KV7A 8AT1A 3C1TA 2FPSA 2YVLA 2HV8A 4FQ5A 4MWTA 1E5TA 1IONA 1MQAA 2W2LD 3H84A 3N2KA 3OMLA 4OU4A 2FA9A 3QVKA 4HVLA 1I7QB 2QP3A 4G9EA 5CP8A 3DVQX 3GT3A 2FPIA 1WU7A 2QMEA 1XTVA 3HFSA 1X9HA 3QVGA 3CJTA 4M9ZA 4NMMA 3UOGA 3JVDA 3M6AA 4C5AA 2IYRA 1DIOB 4WAUA 4EQ6B 1GTRA 3WYEA 4BP3A 2Y8EA 1RJ9B 1M1XB 1L4KA 1U7TA 3ZHQA 3L0CA 4HQ6A 1YL5A 4DLLA 2ODTX 4URFA 1I7SB 2HSWA 3Q7PA 2VTEA 3N39C 1UMKA 3TZEA 2OPBA 1G8GA 2EVWX 3HXKA 5MN5A 3AO0B 4C2TA 3B7GA 4LW8A 4NP6A 4NS1A 1LBQA 5D5QA 5EXDA 4B32A 3F49S 3CNHA 1F2UB 3Q3GE 3USCS 4KE7A 1JYEA 2RGUA 1SCNE 1ZD5A 5AW6A 5JADA 3E7PA 2BHLA 4UPDA 3SAJA 5LBUA 4BVLA 1O6GA 3HVKA 4EJ6A 2F55A 1A0OA 4GKKB 2JGLA 3OPYA 3QY9A 4Y6LA 5JJLA 4MHTA 1FUEA 1S1MA 4QU5A 3UGKA 2I91A 4RJKA 2M6LA 3ZDRA 5K0SA 2B6NA 3BGWA 1AC5A 1XAGA 1P2DA 1R0BA 1UFRA 2P4HX 3QWAA 4QGBA 1ZMBA 4BNXA 1RADA 2QRVA 1E5LA 1G20A 5I9TA 5ITWA 1OBVA 4B74A 3MUEA 4JROA 4N5DA 1D6NA 2R1UA 1TDJA 3K5WA 2MSWA 5J40A 5BOVA 2G9NA 3N0VA 1E4YA 1XU4A 3DOCA 3TGPA 3MTQA 3KV1A 3JQQA 3U56A 1KMQA 4UDOA 1KJJA 1HETA 2JLSA 4WEQA 4P0PB 4R81A 2HHAA 1AX9A 4LDJA 1NURA 5EQDA 3DOEA 3NTVA 3UGQA 1W7AA 3MSCA 1L5FA 4I4LA 1SUWA 2ZP1A 3AX6A 1NT4A 4RHUA 1Q20A 3RC1A 3V1UA 5A04A 2OUKA 3IUNA 2XKAA 3OZWA 2Q3FA 1MO5A 1RTTA 1IRXA 4HG2A 4YAEA 4LZJA 1IOLA 5GJWC 1VA5A 2ZUFA 2X2FA 2IP2A 2ZB8A 3M2TA 3RUIA 2WHPA 4BUZA 4Q47A 1B0ZA 1BROA 2C5GA 3RRNA 2BF4A 3IP7A 4F06A 3QBJA 4GC5A 4QSHA 2BMAA 3GEMA 3K0FB 1JR3D 4J0IA 4D4KA 3F3YA 4YRGA 5I4IA 4EA9A 3KJQA 3WL3A 2GT1A 2VZLA 1UZMA 3BRWA 3I83A 2PM8A 3NHWA 4HGYA 1SQFA 1XRJA 2ZRPA 1NYRA 1OVGA 2GB4A 4L15A 5AXDA 3KQOA 3HCFA 4UE6A 4O4LB 4AQDA 1UKYA 3DDCA 3LIPA 2VK4A 3W6NA 5KWEA 4NG5A 3PP8A 3ZHBA 4HMQA 1S1CA 1QRSA 1JWLA 2MR6A 3BERA 4GWGA 4QU0A 4D57A 4D4HA 1V7PC 2J67A 3EPLA 2O8VA 4KAJA 2FUEA 2FZWA 3RJTA 1R3DA 2ZBRA 1I6LA 3JQBA 3RJMA 5EIFA 5BT9A 1RZRD 2CL5A 1O54A 2Q6TA 3O4JA 2H51A 9ATCA 5A02A 1KK3A 4FM9A 3BRSA 4LDNA 3AQIA 1W44A 5E4YA 3DNFA 2HEIA 2PH7A 1C2YA 3L46A 1UBRS 1UJ5A 3FLMA 1LSSA 1XK6A 1GZSA 3OESA 4OCZA 4EHFA 1PNVA 2OLKA 4R8LA 4BBZA 3FB1A 4O4JA 5JYBA 3FB4A 4IGEA 4R9VA 4LCJA 1FDIA 3GJ4A 3FBTA 5FAXA 1SH7A 2NM0A 4KDFA 1YA6A 3EMVA 3TLMA 3DMPA 3PWZA 2V0NA 1RCTE 1QV6A 2GRJA 4I1UA 4W63A 4MV7A 4BN4A 3C6XA 2CNBA 1QIGA 1LZLA 4HQFA 1P2VA 3F5SA 4LRSB 4UU0A 1MDFA 2A5YB 3OTHA 4MVJD 4OQ4A 4XI9A 4BNDA 4M1ZA 5JYEA 4MW0A 2C2YA 2GI4A 5LIRA 3DZCA 3U4QA 1IDN1 3MLEA 4Z4GA 3CF0A 1RWPA 3DPSA 4Q3LA 4N3BA 1NIPA 1AN9A 1ES9A 5E9WA 3F7MA 1ZRMA 1LRLA 1GCGA 1Q95A 3C3EA 1H2ZA 2F1HA 3PK0A 4M1TA 1VKOA 2BGWA 4PHTA 1KQPA 1C3OB 2K2WA 5K99A 1ZH0A 5G3YA 4D9KA 4MP3A 1NDUA 5AW3A 4HNAA 4Y2GA 1IK4A 1OXKB 4I2NA 1TRHA 4X00A 1LPPA 1NW9B 3PI7A 1SCBA 1V11A 2ZBVA 1G8KA 3DTVD 3BTSA 3JWPA 3GHYA 2W43A 2X0EA 3OT4A 2VDNB 2IQIA 2WOOA 4KN9S 4O2BF 2XBMA 2D3TA 4W5JA 2R25B 3OCXA 1KS9A 1IQPA 4M88A 3Q3HA 4NFHA 2NUTB 4QHYA 2IX3A 2IEBA 3K5PA 3SLGA 1MZVA 1IEQA 3PFKA 3UK1A 3NYQA 3OETA 5EWMB 4IQGA 5T3UA 3AEXA 3OFNA 4NNPA 1Y5LA 1W47A 3A2NA 4KXUA 1B26A 4ZHQB 3PXGA 4WLOA 5JSQA 3CRQA 4O2AF 1QC5B 2ZIEA 1W5TA 3I8OA 3TDNA 4OKSA 2R751 5EI5A 4BNYA 2WOJA 5IRCD 1RLMA 2G17A 1YFZA 4HMOA 2NV0A 5A7HA 3ZHSA 1TTPB 3NVMB 4MYCA 4BO0A 1U2PA 3IEXA 1CUDA 3NHPA 3FZGA 3QKSA 5FNVB 3Q7SA 4TWIA 1SG6A 1OOEA 3BILA 4FOOA 3O9MA 1RC1A 4ZC1A 3ZYCA 3GN1A 5BN4A 3B1FA 1ZRNA 4BDTA 3FRHA 2DFVA 2NSYA 2I4NA 2E48A 3LX6A 4DIEA 4RMIA 5DM2A 2JLZA 3SS9X 5H02A 5TSDA 3DL2A 3OZ7A 1P74A 3Q12A 1ZM4A 4MLCA 2HL6A 4PGMA 5JU6A 2ZE8A 3JWGA 2MU1A 5JVDF 3R8FA 3IDQA 1KP2A 1V1MB 4E0BA 4NHEA 1GNTA 1F6DA 3RM3A 1RQLA 3MJFA 2P3QA 4V0KA 5IMBA 4EMUA 4Q19A 2JAQA 4RENA 1K3UB 2DHQA 4X90A 4MRVA 1FU4A 3LL4A 2ZUVA 4OYHA 1BWPA 4RD1A 4Y1GA 1N78A 4FEAA 1YZLA 1CQZA 2DRIA 4LXQA 3SNHA 4PG8A 3ZV6A 3PT9A 4M1EA 5IXYA 1ZI6A 421PA 3Q8MA 2O8FA 2XBUA 2PS3A 4B7CA 4LVUA 3A0UA 5EIWA 3RFVA 1XVLA 5IJWA 1D0VA 4DF3A 4RQBA 4MLZA 1WCIA 5HIIA 4ZANA 4JXJA 1T5BA 2G0NA 3A3OA 4WNYA 1WX1A 3V4LA 2QTRA 4DIUA 2X22A 4ZHQA 3ZJYA 2OBNA 1U2ZA 4URHA 4Q9LA 1DKUA 3ZY2A 2W70A 3DT6A 2FPGB 4N82A 4NE2A 4ZAYA 1WF3A 3IVRA 3K5IA 3TI7A 5HRCA 5JBIA 3DWGA 4DLAA 3DE7X 1Z0DA 4I55F 4BNGA 5B30A 4FVTA 2CY0A 3DL7A 5JWHA 3WWCA 4DXAA 1UINA 4N6GA 4ON9A 4GUDA 3L7YA 3ZQ6A 3K0CC 4DA0A 1PJLA 2OZPA 3IH5A 1C80A 1CB0A 1JJ7A 1FYVA 4F2WA 3W7BA 1FBTA 3JU3A 3THSA 1YOVA 1K89A 3FLEA 3SXUA 1M2OA 2GEFA 5K8CA 4R1LA 3QEAZ 4B6GA 3SD7A 4PWYA 1U0RA 3KSRA 3O1JC 3SZLA 2FZLA 2V0GA 2BKAA 4OQYA 4P0TA 4PLYA 3MPOA 2HSJA 1QHHB 4U2DA 3M9WA 4WXEA 2B8NA 1DJNA 1KYVA 3LXUX 1L5RA 4RKFA 5BWOA 1RXYA 1U3VA 2Z08A 2NU8B 1XTKA 3LU1A 2O3UA 2WAXA 2OG2A 3DFZA 1QAQA 3N0TA 2VRCA 3ZIAD 4NE9A 3ZEAA 4J0CA 2GXAA 1FBNA 3O4GA 5A03A 5FV7A 1H9BA 4D82A 4AK9A 1DOHA 4B2IA 4B82A 4AN0A 1C3XA 4Z0NA 3I5XA 1O03A 1X13A 1ZRHA 1HFJA 3AMVA 3TCKA 4F71A 3CB4A 3R6LA 3VZRA 3QV1A 2WHYA 4CR8A 3NH6A 5BUSA 4GM1A 4F3CA 2GXQA 1O08A 1YR1A 3WLMA 1NF9A 4P7FA 4QD3A 3Q9UA 2OMEA 1L4FA 3HKBB 3VNUA 3DHYA 4MEAA 4MSUA 1ZZEA 5H5JA 3VR3D 2HRQA 4U7JA 5JAMA 3W5UA 1W8IA 1QH1B 4Y6SA 4BFSA 2GZ1A 4C08A 4OO3A 1CT9A 1T3SA 3GJ8A 3D4PA 5D01A 3A10A 1FDVA 3TECE 3K70D 1EUCA 2WSMA 5A0FA 5TVGA 3RRYA 4D8UA 4EFNA 3B6KA 3QJ5A 1Y7LA 3PLNA 3NEJA 4I8DA 3ZHUA 2I8CA 4B6QA 4GRIA 3R5KA 1ID1A 4B0PA 3BKXA 4AM8A 1CSEE 4NFSA 2RHDA 5CPFA 1NF2A 5LZ5A 1WKBA 1VE6A 1CY0A 3DVAA 4N0PA 1GN9A 3L6CA 1DS6A 1RAEA 3EDCA 4IJQA 1LW7A 3ZI0A 4JWKA 2O8DA 2WIGA 3FI0A 1IM8A 1RJFA 5FHRA 4K9QA 2F7SA 5KSYA 1L7EA 1AK1A 4H7PA 1VL1A 2B69A 4KN8A 2JF0A 4HDOB 1BW9A 3H3JA 4U6SA 3DEIA 3VR3A 3EE6A 3ZIUA 3BTUA 2F9FA 4XD7A 3K7EA 3TQCA 5IS2A 3TTUA 4PRLA 4C5BA 4I9UA 1MPTA 4E2WA 1N6PA 4YMTA 4M46A 5BYAA 5KVCA 4WN3A 2F1OA 3WWZA 2G1KA 1AS0A 2NVOA 3OKFA 2VXBA 1GQRA 1PJ2A 1X19A 5EWLB 4IKOA 1P81A 3QOWA 4L8FA 2YYYA 3UAXA 3WV4A 4KXXA 1JAHA 1GDDA 2DPGA 2WY2D 3A9VA 3ZJTA 4U00A 1HGXA 2YV1A 4KRYA 4Z9AA 3BMCA 2DFNA 1OU0A 2IEGA 3EUFA 3SEAA 2VUHB 3EOZA 1YB1A 1PEDA 5KNBD 3IHTA 4BFLA 4MKGA 2GD1O 1KR5A 1PX2A 1V95A 2Y0EA 3HV2A 4PIPA 1RYBA 1WKCA 1FK8A 3A1NA 3FFAA 3KHUA 2C2HA 1HE4A 2ORED 1IZ7A 3MRTA 3OX3A 3UO8B 4E51A 1NW6A 4G4GA 3CZ5A 3ZTWA 4IVPA 4TV8A 4UQOA 4QOSA 3ZWBA 2QNIA 2D8MA 2Q5JA 2JFYA 4WRRA 4ZYZA 4JHXA 3ZGXA 4XWWA 1E94E 1MX1A 4AKHA 2DPXA 2UXBB 4XQEA 1Z83A 2V96A 4YACA 3WC4A 1BGXT 2O05A 3H0KA 4OQQA 1YJ8A 5EXEA 4P08A 3IMGA 2PMFA 3WGVA 1UP7A 2YV4A 8OHMA 1OBHA 1GJRA 4X5OA 4ZALA 2CHQA 4IUBS 1ML3A 1NN1A 2Q6IA 2CV2A 1Q22A 4MKIA 5DBEX 2Q3JA 1VSTA 2WWRA 3E70C 2VLBA 1EX6A 1DIBA 1N3LA 2O6HA 4HMPA 2OESA 4JJGA 4U7FA 3EFBA 1QH9A 5LQAA 4EVIA 1JG7A 1QM5A 4TT3A 5LL6P 2H17A 2QG9A 4BZQA 2QY6A 3D8RA 3KKNA 1JIKA 3NYWA 3R7DA 3GHHA 5I45A 3GD7A 1XDZA 1ZXLA 1Q92A 3H97A 2R48A 1Y3AA 5LQDA 2WAMA 4KQKA 3SQXA 1NDQA 1T5IA 2AF4C 3FDZA 4CFSA 2OO3A 3DBLA 2IYQA 3NIWA 3OLWA 4PAWA 2Q9BA 5TC4A 4BZPA 4KN5A 1ZHFA 4YPFA 4GPBA 4OIFA 2FN8A 1XLTC 2QL7A 3AKEA 4KZKA 3E6AA 3PVZA 2N47A 4HR7A 4A5OA 1JSRA 3LXMA 2FG7C 4P86A 1SULA 4Q4CA 2QZPA 2VNKA 4CEIB 1XMPA 821PA 2QZSA 3ADKA 3A1CA 1K66A 4NONA 1BRTA 1P4SA 2OXIA 4DLXA 4YECA 4LZZA 3SQMA 2XNDD 5FL7A 4EA7A 1XZ8A 5CH5A 3RS8A 1Z73A 2BBWA 4XLZA 4Y8VA 1W75A 1DAEA 2QYTA 1XKQA 4X97A 1T6YA 4URUR 3GG9A 3JARA 1J9EA 2BGLA 3JQ7A 2IF2A 1TT5A 5KYWA 3U1BA 3R41A 4EW6A 3OEHA 5C8YB 1TEZA 4AY3A 1YQDA 3TSYA 1QF7A 4O4JB 3A4MA 2V45A 2ZI7A 1NW8A 4LVOA 1I36A 4I36A 3TOCA 5LXTB 1EDEA 4E4YA 1W19A 4QOFA 1GPH1 4O4IB 1DJOA 3IDSA 3JQGB 3Q9LA 1DC4A 1WW2A 3LCCA 4RSMA 5DXFA 5C81A 3EF0A 3W9SA 3VDXA 1KK0A 4JLVA 4NPCA 5LLDA 1ZMTA 2QEQA 3CUTA 1CEXA 2CVOA 1SZJG 3LHDA 3OEED 3OT1B 4H0FA 4OOFA 4XWTA 2YQZA 5K3DA 3W3ZB 4BNFA 1X1TA 2R87A 3GRKA 1XCOA 4X8OA 5DOVA 4MYHA 4DMUB 3T1TA 3H9BA 1XQ6A 1IXKA 3CRNA 1LWNA 2YWCA 2C8JA 1QRRA 1ULAA 1I4WA 3ZWKA 3QG5A 2Q3MA 3GN2A 2ZSJA 1YS6A 2HFJA 2KBEA 4ISBA 2P2NA 4OREX 4WX2B 4E5SA 3QUSA 3T99A 3PQCA 1EWTA 2FZVA 3MT7A 2LBPA 4B7ZA 3FCYA 3OQNA 3QXXA 4MLDA 2YJ6A 3IP1A 3BQNB 4X66B 4DPLA 4U7PB 1MU0A 4HB2A 5IF3A 2OB2A 2WNHA 1ZDMA 4CDGA 1AZWA 1TK9A 2O2SA 4U8GA 2E18A 1UFOA 4ZODA 1ZONA 2D8AA 4L5AA 4BB5A 2FAXA 1WETA 3RDPA 5KC8A 3WK5A 1YS2X 3M2PA 1YZGA 1NOIA 4EF5A 3QHPA 2JIOA 3JSXA 5DI3A 3S99A 3TLKA 2QX6A 1VDZA 2JIZD 1G42A 3L1JA 2GD0A 2ZYAA 4NEHB 3MWFA 1TU3A 2DZDA 3D6UA 3FDIA 3AUJB 3UOWA 2PH1A 4J2TA 2X0RA 1NLFA 1G1AA 3HJNA 5EJ2A 1Z33A 3QXGA 5EKUA 5AW7A 3PXAA 5LZ4A 4TL9A 3WQQA 5JBQA 3MRSA 3FDJA 2EFHB 2NPIA 2GPAA 2I6TA 3FGZA 2ZJAA 3GVCA 3U09A 4IDDA 3LHIA 2ZI5A 3W5SA 3E7WA 2HWYA 5A3SA 2Z2ZA 3KT0A 3OCZA 3KUCA 3PHJA 1RYZA 1Z4JA 2C8VA 2G1JA 2G72A 4IEFB 4D6YA 3AONB 3UWPA 3U7GA 1VIVA 4KNWA 2NNLD 5ALHA 2BMJA 3BE8A 1P39A 4UNNA 1YS1X 3BWBA 4JB8A 5DHRA 4CMAA 2VT3A 2X4LA 4LG1A 3AF5A 1DO0A 4L7QA 2ODAA 3AILA 4KVZA 4AJKA 4AYXA 1FNCA 4OHKA 3KTDA 4GI1A 1L7NA 1B41A 2QY9A 4JP8A 4XM1A 3LUCA 5CFPA 5KWIA 1OZGA 4E14A 4C4SA 4N76A 3WJAA 3NVKI 3LRXA 3E82A 3K2QA 1T5HX 4IDQA 2X8AA 3PEWA 5FI0B 4TS4A 3FE2A 4XVCA 4RLSA 4Y0NA 5EE5B 4KJZA 2DUUA 3PPXA 5HMLA 4GMHA 4M0DA 2ZI9A 5D5HA 4ME6A 1VHJA 1T1EA 3HADA 5IAGA 2CE7A 2KBFA 3ER6A 4IEEA 5K6AA 5CJJA 1FXWF 2IF0A 3K20A 2WSSA 3KTOA 2PSJA 2R44A 3JZMA 3QKIA 1KQGA 2HIGA 3PU6A 3EGEA 1KH3A 5IEJA 3VPGA 1GYPA 1XTSA 3S6JA 1DIGA 2CFOA 1CHNA 2V7GA 2HLDA 1ZJYA 4RPLA 3ONVA 4OEHA 1E7SA 4NU0A 3KAQA 1KH1A 4JP3A 1EFKA 3BPSA 3GZNA 3PHGA 5JZBA 1Y5NA 3A6GA 2C2OA 2XW6A 3HN2A 1J9GA 1VI6A 2Z0MA 3RQSA 4OJMX 1JVBA 2AJDA 3FHOA 3FVVA 3KUUA 1WCXA 1C7QA 3MS4A 4DDKA 3NYIA 1NP6A 1V2HE 1V47A 4WZAB 1MENA 1I4DD 5K20A 2E3JA 3NP7A 2GAAA 4PYJA 3RAEC 3HA3A 1QRUA 1RI4A 1O5OA 1ZUWA 3LOQA 4U7GA 4JJIA 1JFFA 2W6CX 1NXOA 3GCXA 3I09A 4X64B 4BQPA 1FS4A 3R3VA 3M6FA 2XYPA 1N36B 1SQSA 1ZITA 2Q4TA 2C7BA 4QOHA 3MPUA 1XC7A 1EA7A 4UVHA 1ZIYA 4CQNA 4ZVPA 1PGQA 3BMOB 3SHVA 4H77A 4JBGA 3WOHA 1MN6A 5FUBA 1E2LA 2M2IA 5E6SA 3ZLJA 4AW9A 2XGGA 4M98A 1VCIA 5I7OA 2GM4A 2BE7A 2ZTHA 1I7LA 2I2DA 2ZYVX 1U9CA 2CCGA 3KLPX 3THXB 4CW7A 1NP3A 2VUUA 2FMUA 4DCVA 1XU9A 1ZOLA 2GKOA 1FLDA 3BAZA 3R0IA 2VJLA 2Y4NA 3X1WA 4B85A 1JB9A 1E3DA 3V7FA 1A9XB 2P9JA 2ZKLA 5JO0A 3L06A 1KORA 1H23A 1EXVA 3JZFA 2ERCA 5IDWA 1CY2A 1DUVG 2ECPA 3JWEA 2A9JA 4LMAA 4EI9A 3MT9A 2F43A 2OWEA 3ONFA 2IYAA 2VC2B 3FMIA 4J1TA 2X4DA 3VPHA 4YPVA 2YXLA 1I6KA 5ALFA 1KEPA 2C59A 1RJ9A 2VKTA 5ER9A 3WYNA 5JCJD 1FFGA 2CXXA 4X85A 4KK4A 3JAWB 4DT1A 1RSZA 1B76A 1GZ7A 5I3ZA 4NYJR 4Y2XA 1JL3A 2PH5A 3OCWA 3DJYA 3H1GA 1FPMA 4DCUA 4RQUA 2V7UA 3PGMA 4P3OA 4YJDA 3QPAA 4PIVA 2XCOA 4BATA 4MVCA 4ALIA 4RIGA 5D2CA 1GCUA 3WBFA 4NSNA 1XVIA 4DMGA 3KQVA 4NWIA 3OWXA 4HDQB 4IUDS 4WINA 4PX5A 1ZL2A 4X8LA 2P2SA 2V7QD 4W8GA 3LRPA 1B3RA 1KNXA 3C43A 1Y1TA 1YHNA 3L6OO 2P6RA 1THMA 1HL7A 4L0CA 4KE6A 4YIKA 4DNQA 3RVSA 4US0R 4FS3A 3OI7A 3DOIA 2FLKA 4J0FA 4FOTA 1DKMA 2RKWA 2PR7A 1Y1LA 2XE8A 3V9PA 2X77A 1CV2A 3H2GA 3PDWA 1NSTA 2CDAA 1F2VA 3E7FA 4GE0A 3I37X 2W93A 3Q4GA 3DVRX 4FGZA 4MV0A 1ENYA 5HE8A 4YEDA 5TNXA 1ZUIA 1BFDA 4ZYTA 3FKJA 1LWOA 4NBNA 2IU0A 1UADA 5CNKA 3G1UA 3MSXA 2QX8A 3THRA 3VKWA 3UK0A 1NXXA 1FJ2A 4Z86A 3ANNA 2Q62A 4R2LA 5L3SA 1JIIA 2AKAB 1M6VB 3I52A 3K4QA 3H42B 3RF7A 3UB4A 3K31A 1EJ0A 2D74A 2IZZA 2ZTUA 2VL7A 1JA1A 2YV3A 3FXAA 4L95C 4PO3X 2JD2A 2C61A 3IXMA 4BIIA 2X9GA 3LM8A 1KDYA 2C88A 3LZ6A 1T8WA 1DP4A 1GT6A 5DLQC 5BN5A 4PLGA 3BBPA 3RYIA 1Y8ZA 4CMGA 5I47A 5EJ4A 4LSMA 3GFRA 4GYYA 4E11A 2JA1A 1YNSA 2C4MA 2R6HA 1XCGB 5DTMA 4BC1A 1JSCA 4U7WA 3TR0A 2J9YB 2WT4A 5IARA 3A37A 1NRXA 2ENUA 5H8WA 2Y2VA 3LUHA 3AF3A 4MROA 1ISIA 1H69A 3C6KA 4Q00A 5JXJA 1EAYA 1Z39A 1SBQA 3N53A 4N7JA 2DY1A 5EYPA 4YMLA 1Q7GA 1UXHA 2ZJYA 3F6BX 3UMJA 1Y6JA 4XSHA 1TA9A 4M54A 1C9DB 2LTAA 4YJFA 1FNMA 1P4RA 4I3HA 1OAOC 3UNXA 4KKXB 1E69A 1NLYA 1ZX1A 2YWBA 1SK9A 3V1KA 5FPTA 4LOKA 3R5JA 4BLRA 3PFFA 1XMIA 1NN3A 2FEXA 3WP1B 3QOFA 4D3YA 3VVLA 4ZJYA 5E1MA 3EXFB 4MJ7A 4BHTA 4D0LB 1W48A 4ZEVA 2M1XA 4YUAA 1FDTA 4HLUC 3KOMA 2DUJA 3AVXA 2L17A 4IH1A 3FPFA 5IHXA 4MVJH 4GVPA 1OB5A 4BAUA 4ROTA 2EJVA 3PZBA 3U3DA 4TRNA 1I5EA 4GX0A 4H3KB 1KI6B 2OHIA 2QYOA 2X1HA 4A0SA 4PZZA 1BDJA 4X7RA 2BZSA 1GQFA 1N7IA 1ZINA 3W2FA 2H2FA 1E98A 2BP7A 1SC3A 5TMPA 3BCUA 2CMKA 4AMZA 2QMZA 4G4JA 2QSYA 2GYWA 4WN9A 4DIKA 5JH7A 1V8ZA 1YJBA 1COWA 1IUNA 4JVOA 1DE0A 5CMLA 2NU6A 5ARBA 4FXPA 1KJNA 1HQDA 2Q3LA 1EJ6A 5EYPB 2ZRCA 3OJWA 2IV7A 5BSVA 5I8WA 4AKGA 2I3GA 3TSCA 1UEIA 2WFMA 1ODTC 1WUYA 5GZ1A 1D4OA 3F74A 1IY0A 3MWDB 4G1EB 2EQAA 1LH0A 1MNAA 1Z8NA 3B1JA 4ZTZB 4OOEA 3H9CA 4MB2A 2OQVA 3LLSA 3KLBA 5LR6A 4AU1A 2FPUA 2PXXA 2JHAA 3B82A 1YJAA 2VT6A 3PFIA 3CLTC 4RKYA 1L5HA 3ZVNA 5F9FA 4O4LF 2ZETA 4DSTA 2I1WA 1M74A 1G16A 3ENVA 5ALQA 4MB6A 4TQ9A 4Y2SA 1PJAA 4QQRA 3AU8A 3K72B 4OAPA 4RPIA 1GCIA 1KWKA 2PZGA 4M7RA 5GOTA 1M34B 2X76A 1E32A 1DKNA 3IUBA 1XJ0A 2EHDA 4OGGA 1MB0A 2H00A 4LXIA 4P4NA 4BYMA 1UOOA 1OGIA 2OHXA 1Q44A 2GVNA 3OMXA 4B6RA 2G8LA 4BUCA 4C78A 4RTPA 3H2SA 1T2AA 5HG0A 5F1OA 4JJ4A 1HMYA 1Z3IX 4S35A 4AIRA 3QI2A 1DPFA 3E9QA 5FJJA 4GDMA 1JJBA 1PEYA 2J31A 3AVOA 2X0DA 4XVUA 1U5CA 3C41J 1K6IA 1I30A 4B40A 1AGPA 1GNSA 3PITA 4NOLA 2CLKB 3M70A 1Z5NA 1AH2A 2FK7A 1R0WA 1UJCA 1ZJWA 2YZ7A 4QSMA 2P90A 3J80A 2Y93A 1O8BA 1SBHA 3UFXB 3CLVA 3CA8A 3OM9A 3CRVA 5TQ2B 3WL7A 1JQ3A 2FW8A 5I4CA 4FKMA 2GPNA 5DHQA 5HCNA 5LQNA 1MB4A 3ZDZB 2O8FB 4QASA 4ZICA 1GPLA 1JECA 1XRQA 1Z25A 3OLQA 4LYEA 1Z2NX 4DLTA 4RSGA 3PWTA 3ZJ4A 4NU5A 1C7RA 1XT6A 2Q3BA 3TRJA 3KQLA 3TBHA 1QKKA 3ESBA 2WHRA 1KXZA 1S89A 5EAIA 5ALWA 3Q8LA 1ZHOA 3D0OA 3HVJA 2O3JA 1R9MA 4DB2A 4YUVA 2PS0A 3LRTA 5TF4A 2W6NA 3R3YA 1N0UA 4LVNA 4BU1A 1D1TA 4ZOLF 2P4EA 3DDSA 4FFPA 3UUWA 5GINE 1IN1A 4BMCA 5A4JA 1H6CA 1DJQA 1R6TA 3PFCA