2NYVA

X-ray crystal structure of a phosphoglycolate phosphatase from aquifex aeolicus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
MSLRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDNHIVEFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycolate phosphatase
publication title X-ray crystal structure of a phosphoglycolate phosphatase from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 74
structure length 217
sequence length 217
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2nyvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2nyvA01
1CR6A 5ALSA 3ED5A 3PDWA 3ZWKA 1RLOA 3S6JA 4EX6A 4YGYA 4NFLA 4DFDA 2P27A 3OCUA 4DCCA 3SHQA 4ZEVA 3SD7A 1WR8A 1Z4MA 3WKEA 3W5BA 1XP5A 1FEZA 1X42A 5A3QA 4CE6A 2Q4TA 5AVZA 3AR4A 5JJBA 1YDFA 5AESA 1F5SA 4OHFA 1L6RA 2WM8A 2PR7A 2OA0A 5AIBA 5AW1A 1T5TA 2WF6A 1Z5GA 2RAVA 5AHXA 5ALQA 3ZX5A 2MU2A 4HGNA 3A3YA 2JAWA 5AKGA 3TLMA 1LVHA 5ALOA 3L8EA 2YJ3A 4HGPA 1ZOLA 3DDHA 4UMVA 2YMQA 3AR2A 3MC1A 3U7EB 1WZCA 1WVIA 3L8HA 2I33A 3J7TA 3ET4A 2G80A 1TJ3A 1ZRMA 1Z5UA 1L8OA 2G08A 3ONNA 3ZUPA 5AW5A 3B8EA 3AR6A 2ZXEA 1NF2A 1WPGA 3OTQA 3OPXA 3CNHA 5ALUA 4YCLA 2YMLA 3QUCA 2RARA 5A3SA 5AKKA 5IT4A 2B1QA 3WKBA 2FPWA 3WK9A 1Q91A 4BKMA 2R8EA 5ALPA 4C4RA 1KYTA 1T5SA 3A1EA 3ZTYA 3AR7A 3FGOA 3KOOA 2W11A 1EK2A 2HX1A 3E58A 2I54A 2ZBFA 5AVUA 1RC8A 1S2OA 1O08A 3N07A 2WF5A 3QU7A 2ZBEA 2Q5EA 1U02A 3AR3A 2QLTA 1EK1A 5ALLA 5AK6A 2MSNA 2PKEA 5AI8A 2ODAA 3L8GA 4KNVA 3ZVLA 2B8EA 1ZD2P 4UW9A 4BBJA 2VKQA 4C4SA 2AGVA 3U7HB 4UMDA 1NNLA 2OM6A 1RMQA 3D6JA 2GHTA 4HGRA 3R9KA 4KX5A 2C4NA 4UARA 5AVRA 2CFSA 3ZW7A 2CN1A 1RMYA 3L0BA 4G9BA 1IWOA 4YCNA 3UMCA 4Y2RA 3ZVNA 4L6CA 1L7MA 3NALA 1AQ6A 2YN4A 4YIHA 2B82A 2IA5A 4EEKA 1RKQA 1YMQA 3RF6A 2GO7A 3EF0A 1S8OA 3M1YA 1QQ6A 4Y2UA 2CFTA 2ZOSA 5AW7A 3FZQA 1ZD5A 3AR5A 1RDFA 1L7PA 1Z4QA 2FDRA 3QNMA 2P11A 3QU9A 3PGLA 3FM9A 5AKJA 1Z88A 2I7DA 4FE3A 3N5KA 1CQZA 5AVVA 3EWIA 4Y2JA 4L6AA 4J2TA 2WF8A 4Y3UA 1O03A 4AP9A 5AKXA 3EF1A 4F72A 2HI0A 1Z4KA 2EATA 3W5AA 1YV9A 3ZI4A 3UMGA 3KC2A 3FPSA 3K1ZA 2AMYA 2O2XA 3B9RA 3NRJA 1Z4PX 4RESA 5AVYA 5A3RA 2R8YA 3FPBA 3ZVMA 1NRWA 4JB3A 4B6JA 5ALXA 5ALHA 4YH1A 3ET5A 4UMFA 4J03A 1QQ5A 4QQFA 3L0CA 1RMTA 2BDEA 5IS2A 2NYVA 2HEGA 5ALRA 3U19A 3I6BA 2G1AA 4UAUA 5ALWA 2JGAA 3WK7A 5AW8A 2FPXA 1ZS9A 2YJ5A 1L8LA 3DAOA 4Y2PA 3IJ5A 4KX3A 3PGVA 1QH9A 4H1WA 5AIAA 2RB5A 5ALGA 5AM3A 5AW2A 3IB6A 3N28A 3MN1A 1TJ5A 4HGQA 2BDUA 4QJBA 2YBDA 3R09A 3NUQA 1Y8AA 3W5DA 5AW9A 3AR9A 4EZEA 3QU2A 1VJRA 2DQSA 5AK4A 2HO4A 4Y2VA 4XQ0A 3ESRA 3I28A 2YY6A 3U26A 3ZU6A 5AI6A 5AKEA 1RQNA 1Z4NA 2ZG6A 2OBBA 5AICA 4BEWA 4UAVA 3OCYA 2R8ZA 3L5KA 1YNSA 4DW8A 2HHLA 5ALJA 2AH5A 4NV0A 5T41A 2FUCA 4BYGA 1TE2A 3HLTA 5AW6A 3L7YA 3I1YA 4BEVA 2W43A 4CF4A 2WHEA 3QLEA 2IOHA 3GYGA 3SLRA 1J97A 4Y2TA 5ALIA 2BY4A 1ZRNA 3QYPA 4UU1A 4UU0A 5AVTA 1RPZA 4BX0A 1TA0A 3KD3A 5FP0A 2I6XA 1Z4LA 5AVWA 2IOFA 3U7GA 3M9LA 5AW3A 3KDPA 1RLMA 1SWVA 4KNWA 1Z4JA 3QU5A 4F71A 2FEAA 5AK5A 3MMZA 2B1RA 3U13A 5AM2A 3NASA 4GIBA 3SF0A 1XVIA 2IYEA 2HDOA 5AVXA 3B9BA 5AM5A 5AKZA 1SU4A 5AI4A 4AS2A 3WKCA 5ALKA 5AVSA 1PW5A 1L7NA 2C8LA 4YIKA 4BNDB 5ALDA 2FUEA 4O8CA 4NABA 3WK8A 2IOFK 1Z4IA 4IFTA 5AKYA 4DWOA 3OCWA 2YMPA 5ALFA 3RFUA 5AKLA 4FFDA 1VJ5A 3WK4A 4Y2XA 4Y2YA 1XPJA 1RKVA 3MPOA 4MWOA 4JDPA 4NWIA 3NANA 2YFYA 2EAUA 2YJ4A 1Z4OA 4EENA 3PCTA 5AI0A 3UM9A 4BNDA 4EELA 5AKIA 2HCFA 3A1CA 3KZXA 3L0YA 1N8NA 3CZ4A 3SMVA 3OCXA 2W4MA 1U7PA 2HF7A 3P96A 1ZJJA 3L8FA 4UATA 4I9GA 4BX3A 3L1VA 3BA6A 2B8JA 3U7FB 2WF7A 3A1DA 3EPRA 3AR8A 1MH9A 1U2SA 3WKAA 2P69A 2FPSA 2YJ6A 3DNPA 2HF2A 2G07A 4E88A 2C9MA 5ALZA 3NIWA 3N8GA 2R8XA 4OFZA 1RLTA 1VFPA 2O9JA 1U2TA 2X4DA 4I9FA 1ZD4A 4KYTA 3WKDA 4Y2SA 2WF9A 3KBBA 4HYTA 5ALVA 5ALEA 2PQ0A 5AM4A 4YCMA 2B0CA 2P9JA 4UM5A 2B30A 4ZEWA 4IG4A 4PNHA 4XPZA 3ZTWA 4OCZA 2C88A 2ZBDA 3F9RA 4UASA 1K1EA 2EARA 5AI9A 1RQLA 4RETA 1RKUA 5AK3A 2FPRA 2GFHA 3QUBA 1RRCA 5AKHA 2CFRA 1YJ5A 3L1UA 4UMEA 5AM1A 4OD0A 4Y2QA 2G0AA 2I34A 3SKXA 1J8DA 3I76A 3ESQA 1JUDA 4ZEXA 2NO5A 3HYCA 3QGMA 5ALNA 3QX7A 3WK5A 4C4TA 2MU1A 1L7OA 2GMWA 2HOQA 5IT0A 2G06A 1QQ7A 3QUQA 5AW4A 1TJ4A 1SWWA 2Q4RA 2FI1A 3E84A 1T9ZA 2GHQA 4GXTA 5AM0A 2ZBGA 2WFAA 2JAOA 1U7OA 1ZD3A 2OYCA 5AI5A 3DV9A 4L57A 2C8KA 4KN8A 3WGVA 4G63A 3QXGA 3WK6A 3UMBA 3OCZA 4MUMA 5ALTA 1QYIA 4CF5A 3OCVA 2FPUA 4CNQA 1LTQA 5E0OA 3N1UA 5AVQA 3BWVA 3QUTA 2JARA 5ALMA 2AUTA 3FVVA 4FYPA 2G09A 4EX7A 2YMMA 2NO4A 4XE5A 1YS9A 4UM7A 4HAIA 1Q92A 2JAUA 3E8MA 4XOUA 4CF3A 2RBKA 2QYHA 3R4CA 4HGOA 3ZWDA 3IRUA 2HSZA 3NAMA 2D2VA 3W5CA 3VAYA 3SKYA 3WGUA 3QU4A 5ALYA 3ZX4A 4AS3A 2I55A 3E81A 5AW0A 4NAVA 1N9KA 4BX2A
chains in the Genus database with same CATH superfamily
3IP7A 3LT5A 2XB2A 1MO6A 5AVKA 3P45A 2NV2B 4QUBA 1D4OA 1X7DA 2WDPA 1EWRA 4OOEA 5KNBD 2QMOA 1US8A 5HVNA 3GFGA 1YZLA 2ZRIA 3JYOA 4HWGA 1YB2A 3AV0B 3RG2A 1OYVA 1DT5A 1KY5A 2JIDA 4GBED 5C31A 4KBGA 1C9NA 3K20A 5LXTF 2NVUA 2V0NA 4ZO7A 5CX4A 4JJEA 4WK2B 2DR0A 2WVAA 3MTJA 2WM9B 3IDFA 1PFQA 1YQGA 2I71A 1JIVA 4R8MA 4HAZA 3ZNPA 4BMVA 4FR5A 3IV9A 2FKNA 2NPIA 4CQMD 3U3DA 4CFZA 4ZVKA 5A5DA 3MFIA 3ZGYA 3IDOA 4PCAA 2CB9A 1RD4A 1LZKA 3GRKA 4IH1A 4C8LA 2D6FC 4W9NA 1BPEA 5GWXA 1CNEA 4JX9A 4NL9C 1U8EA 5J58A 1NNLA 1U45A 4GVXA 3WGMA 3U61B 3ZKWB 4MV4A 1EIWA 4PRYA 1PTJA 2P9TA 4BKRA 4M0KA 1J8VA 4EKEA 4L51A 4X20A 1C29B 3KKZA 1V3QE 2I7DA 1WWVA 4ZT7A 4IJ5A 4LXHA 2FWIA 2I4NA 3I3SR 3A7EA 2BEVB 2X5JO 3T1VA 4X64B 2G36A 1JG1A 4CMIB 1FS5A 2JCSA 3MJSA 3HA5A 3TSAA 1S96A 3BS5A 3PC3A 3MMNA 4W5QA 3GHHA 5TX7A 5LUAA 3FYDA 2PKWA 3IJ5A 4N3AA 1R0KA 3U1TA 3D6FA 2G1UA 4TTQA 4YK7A 5DSTA 2RIPA 2PUCA 1GFSA 3DMNA 2DG2A 2VOJA 3FDSA 2B69A 4DLWA 1BXGB 2WWGA 1YB4A 3QU2A 1KMMA 4JP5A 2VF4X 2B7BA 4L3WA 1W36C 1FIQA 4O4LA 2JIMA 4TVSA 1V1RB 5A4IS 4H1UA 2PUGA 3L7YA 4YCCA 3WJAA 5KFHA 2A3VA 3QELB 4CMGA 4OU5A 1EUDA 5J59A 4RORA 1TUBA 5HKKA 4BATA 3ABZA 2DFKB 2YWXA 4G5YA 4EF5A 3LO5A 1R6VA 3U7GA 4GEGA 3OZTA 1BVSA 4FFRA 2J8ZA 3IA2A 1HSZA 5LMUB 4QWEA 3AFGA 2GGSA 2Q4OA 2FSPA 3ZCXA 5HPYB 4IGKA 1OY1A 4ZOEA 5GTHU 4R1TA 1CQPA 5EKUA 1JFSA 4LBZA 4D5EA 1WP9A 5AK0A 3QZ8A 1QIFA 1TJYA 1C7QA 2PRSA 3G5LA 4JDPA 4DJ5X 2OAQ1 4LYJA 3L0YA 1OJLA 2VHZA 1R74A 1S3SA 2FWBA 1O5TA 4UDYX 2Z1DA 4ZQEA 3MINA 2IC5A 3DOJA 2ASJA 3F3YA 4ZYTA 1MVOA 3HR7A 4IEIA 2QLJA 3D2LA 4INZA 2IFTA 1BS1A 1KMNA 2WC1A 5AXCA 1MT0A 5JS2A 2O9JA 3C5FA 2J4CA 2EX0A 1IAQA 2ON6A 3VSCA 5JALA 3ZCTA 1HJPA 2C59A 3PNYA 4YUXA 1M75A 3Q8MA 3FTQA 3WQRA 4N3BA 2VUHB 9ICQA 4RE5A 5HJ7A 2IX3A 2F1KA 2GJSA 1BPDA 3U4MA 5E6RB 2QAGC 5KVSA 4KUHA 4D4JA 1ZD3A 4CLDA 2M2IA 4YRLA 5TS2A 5F9NA 4GRDA 1QBGA 1TU0A 1JDUA 5G1NA 1BYUA 3GCXA 1RC1A 4QJFB 4HQOA 4ZCMA 2QQFA 4YDQA 5BSWA 3MMXA 4EPVA 3DUFB 4C6TB 3ZLBA 4EG0A 5FA8A 1XWIA 4X1KA 1G2QA 2M9MA 4J9RA 1Y1KE 1DXSA 4YMNA 4CT5A 1EPUA 3BL8A 1U4NA 1UXIA 2Z8ZA 4HDNB 3NX4A 3DXFA 1EJ2A 1Z7GA 4R1LA 2PT6A 1DV2A 1GFIA 2NU7A 1MSWD 4U4AA 3T1TA 4ZQIA 2W6QA 4U39A 1NVWQ 1D0VA 5JU5A 3FSGA 3BTSA 3BD7A 1VPVA 1W96A 3NPAA 5AVZA 2IKSA 4JGGA 3AR4A 1LD3A 2DHEA 4DV6B 3P2JA 4JFRA 3HBJA 2YXBA 4IH4A 5IRCD 5K0EA 1TF2A 1UPAA 3HR4A 4BGIA 4Z9AA 3VC7A 2ZUEA 4MQ5A 4PZDA 1IEWA 2E55A 4AWXA 1JHYA 1M83A 3IP9A 5KT4A 5EE1A 1L8OA 1GVHA 3IQFA 1MW8X 2JB9A 4QOGA 3S7TA 1WLYA 3EOAI 1QCCA 2C2KA 3E2MA 2WWHA 4FP9A 2OTCA 4EJSC 1VJ1A 2YUTA 5EZQA 5J2FA 5NULA 4Z9FA 3EFOB 1P33A 1XCPA 3F73A 4UAYA 1YRLA 5IC6A 4I2IA 1DKLA 3FTEA 1HYBA 4K6KA 3WGHA 2OKGA 3TR6A 3PMLA 2FOXA 2PRKA 3SDSA 2YJGA 4BN5A 4D6PA 1SKWA 5AUNB 5E0KB 3K16A 4YAKA 1M6EX 3P20A 4XCVA 3R77A 3KB1A 4JLAA 1QQ6A 5E6SB 3UHAA 2VJQA 1RAHA 4AF6A 4ZAYA 3THSA 2V7GA 4P5DA 1GTRA 1DP4A 4O4LF 5F35A 5KFIA 3GOQA 2Y9UA 3ANNA 2H2GA 4AJHA 1P1BA 4K9LA 3ZCRA 1NMSA 1ZGHA 3QEMB 1KJYA 4KXXA 1JIQA 5K0SA 5DG7A 3G2KA 3FJOA 4BGEA 4ZPJA 1NVXQ 1DRGA 2X7XA 4O08A 4KJZA 2IV7A 2ZYGA 1WZNA 2I2FA 5ALGA 1I36A 4RJIA 4OBEA 5DT9A 1DIBA 5F1OA 1HDXA 2NUPB 1ADJA 2BE7A 3AR9A 3WV4A 3K1TA 2VDRB 5F4ZA 3E3NA 3M6VA 2J0SA 1OYOA 1EWQA 3CIOA 1C4OA 1WCIB 4LZLA 4H08A 3KOUA 2HQ1A 4BC1A 5DJ5A 3D1LA 3F4LA 3U6BA 3BERA 4Z1MD 5DDMA 3I4FA 5EFZA 4Y2GA 1V38A 1DV1A 4QNMA 1D09A 2AL7A 1CHDA 2Q46A 2KX7A 3MQFA 1QRSA 3MMZA 4IIDA 3AESB 2ZYDA 5G5GA 1JHZA 2OZLB 4BWGA 3G8CA 1ZQGA 4KYUA 3CUEF 5ESDA 4PFSA 3WHKA 1BGXT 4NABA 4N40A 4DSJA 1L1EA 2J3MA 4LTMA 4NCAA 2DKXA 4GX0A 1WEHA 4NENA 1YRBA 2VHXA 3DHYA 3ETLA 3OCXA 2X23A 3DB1A 4BX3A 3LYAA 1JA9A 1IIPA 2VNKA 4RLSA 2QN1A 4DMRA 3OAAD 4JJ4A 4UHDA 2MR5A 1PGPA 4TZTA 2Y0SF 1I2MA 2G5GX 4YJGA 1E32A 5K6RA 1SUWA 1X6JA 3KL4A 4MKRA 3A9CA 2N1RA 1EHYA 4JBLA 1XJCA 1KEJA 3GQVA 5DP2A 2GK6A 9ICGA 1TU4A 2H57A 5EJ7A 1JJBA 2G88A 4F5YA 4QTXA 4X8LA 1BA2A 1K6IA 5JU6A 1YZHA 1EMDA 5M2QA 1N6RA 4GX2A 1TJPB 4JUBA 4ED1A 2XWQA 9ICUA 1B6RA 1M2VA 1ZGAA 5F23A 4RH1A 3KKLA 3NONA 2Q0QA 1FO4A 1GPUA 2P35A 3GJQA 4CCYA 1O9BA 1OQAA 1EWYA 2XNJA 4EPWA 1QVZA 4TWJA 3KEOA 2GRJA 2VXBA 2ZTLA 3IQDB 4E12A 1AZLA 5H68A 4WGFA 4EATA 3GA5A 2J31A 3MGKA 1UC9A 5ECYA 5FORA 5EIXA 2MCFA 1UAGA 2F1IA 3PQ2A 5CR9A 3MFYA 2XB8A 3THYA 4FKMA 4JJKA 2XOKA 2XCRB 1A9QA 2TS1A 3VTAA 3TB4A 4P4PA 2ZYAA 3A1UA 4O3RA 5KNCD 1Q74A 2HN9A 3VO9A 5T3YA 3DDWA 4JI6B 3TZBA 2VFAA 1V0JA 4NARA 4L9AA 5JSZB 2VJKA 3UG6A 3GLIA 5EC8A 3SQMA 4CU2A 5CNKA 2O8EA 2DFNA 1LH0A 1NU6A 3IBFA 1DGJA 3TGPA 2WJWA 2W11A 2PLNA 2V5VA 3A9UA 3IAS1 3SHVA 3Q3JB 3PQ5A 2XCAA 3WWZA 1KFSA 4H7EA 4W8HA 1VMEA 5EXSA 4ND8B 4KFRA 5IUKC 1PGQA 2AGVA 2A5FA 1T1IA 4XEHA 1IM5A 1NR7A 3U37A 4OI1A 4CIWA 4DQVA 3SS8A 1BHQ1 4Y2RA 3EXEB 3NTRA 1V8ZA 5IH7A 3NWEA 1FNDA 3AETB 3Q98A 4BMCA 4IINA 1Q8KA 3WMWA 4D9EA 3RYHB 3RS8A 2QS9A 1T9AA 1G3RA 2DHCA 1BX3A 1P2BA 1IDOA 3DZHA 1HYHA 2CXYA 4JWKA 1RHJA 5F12A 4MV6A 2ET6A 1RP1A 4GNRA 1WD7A 2PMKA 4WFIA 3BCHA 5DKWA 4Q7LA 4MR7B 4UNPA 5HQTA 1GAQA 1NKVA 1PO7A 2P4HX 2JAPA 2TECE 4TKVA 5MGBA 3A11A 3H11B 2QW1A 4DS4A 1ODTC 4O0IA 5HF5A 2R97A 2LXNA 1XLTA 3A26A 1SN7A 2HDNB 3VJKA 5CM8B 5AI6A 1Z7EA 3GO4A 1WHSA 4MUGA 4EZIA 5FO0A 2ZCUA 5JAIA 3LQFA 5DNAA 1CIJA 4BASA 4FHEA 1ATIA 3I42A 1U3WA 3KYCA 1LJLA 1Q1ZA 4NZMA 2CHQA 2HLDD 3DOIA 4KZKA 5IT9A 1DXHA 1N60A 1W4LA 3FYUB 2IUFA 2R5NA 3OTIA 1ED1A 4JT2A 2RJ3A 1EA7A 4ZV4A 5H0IA 3RDPA 4BVKA 2XMQA 3ABSB 2HDHA 2QY6A 3E0XA 4IVNA 1Z8HA 1X0VA 1PI3A 4UNQA 4NNOA 4I2HA 4FNOA 4EJ6A 1HEUA 3E9DA 3CLVA 2C61A 3ETCA 4DR3B 1U7PA 1P4SA 1G64A 4OP1A 2CNWA 1QK3A 2J46A 4C07A 3JR7A 1T6BY 3Q3IA 3RTVA 4XDZA 4MVXA 4YRTA 4BKUA 1W49A 4DIFA 4OMUA 2RHDA 3IO3A 1W4AA 2B1JA 5K4AA 3LIPA 1FUEA 2GZAA 4KREA 5D87A 3GUHA 2DUJA 1D07A 5IP5A 4CUKA 1Z3IX 4UUAA 4I1VA 3C5WP 4U8HA 2HA2A 4FVTA 5CXUA 2C0PA 2YFHA 1JUDA 3I09A 4FX2A 3R5FA 2BEUA 2NSHA 4YNBA 2CHVA 3ZY3A 3QX7A 2UVWA 4CQMA 5I9LA 2AKYA 4C7MA 3EVFA 4NOMA 4QIHA 1EP3B 1QIEA 1JIJA 1YS2X 5SY4A 2GHQA 4FR2A 5CEEA 2WFAA 3WL7A 2GRUA 2WRZA 2ZZKA 4C2TA 3D7KA 3H5TA 3GDWA 2WQ7A 4GPD1 4Z7OB 4KMRA 1PGJA 3WB9A 3MWKA 3DLBA 3LUGA 1CDZA 2WTBA 1ZA2A 4ARZA 2ZI6A 3NDPA 3TH5A 1H6CA 3RS4A 4U02A 1ZRHA 1QONA 3TQHA 3QI7A 4KE8A 2HBZA 5G1PA 1BG6A 4L8FA 4NLNA 4QU5A 1E6WA 3WLIA 1A9YA 4UVEA 4AO7A 1FJGB 5DX8A 4CMEC 4EK9A 3P4UA 2XHEA 4ZAFA 5CBKA 4O3MA 3MT9A 1E99A 1SCIA 2Y6VA 3A6GA 3H1BA 1AHHA 1XCJA 1Y6JA 1GOTA 3HZOA 3LZDA 3X44A 1CQJB 3HVJA 1E2GA 5BWBA 3M7IA 1I2DA 3GLGB 4AZ0B 5JBIA 1SL1A 3C3XA 3L0DA 2AFIB 4BQOA 3RFVA 3IV6A 3SZGA 4A1FA 1BWPA 3IM1A 2QTVB 1FPQA 1ZJWA 2MSWA 3KE9A 3L8ZA 1G5PA 1CBUA 1UK8A 1ADCA 2V6FA 4GI7A 1PLJA 4J9UE 3L1KA 2PRYA 4US0R 4D2IA 1NMQA 3UAWA 2H4FA 4AFNA 3R5XA 4EW6A 4P54A 2PGJA 4HWTA 2BJVA 3AI7A 2F00A 3CWCA 2VAVA 3BQ2A 3OZEA 2HK8A 2QZSA 3FPGA 1GDTA 1JA1A 3M1YA 2HJ9A 3AM4A 2P91A 1LS6A 3AM5A 2RHTA 4ZA2A 3EIXA 3F7NA 4G0QA 4Y30A 5F2EA 3NEYA 4RPGA 1KDHA 3WB2A 3WMXA 3P26A 3NBZC 4GPTA 3GJZA 4KBFA 3T3FA 4G0XA 1T3LA 4DLXA 3EGIA 1D2HA 2RGNA 4M9HA 2BR3A 3CUVA 1P45A 4OX9B 3HLKA 1KI1A 3P4XA 2O0JA 1PG0A 2PKQP 3AKEA 3DLIA 1DPGA 5B57C 2WSLA 5FWXB 4IIUA 5GINE 2HSWA 4PG6A 1PR6A 2RRDA 4YRKA 4P3YA 1GT6A 3AJ9A 5DYTA 4LJRA 5YASA 3CMMA 2OB1A 4QYIB 3ESRA 4L7QA 5I7RA 2XMCA 3H05A 2QW8A 3V6JA 5CA0A 1S2NA 4HDMA 5JY1A 4MYCA 3TBHA 3FNFA 3VKVA 1V8DA 3A37A 3PRYA 4UQOA 5FL7D 3KD3A 1TA0A 3B1KA 2CB0A 3IOCA 3EY4A 1SBZA 4DB4A 2B6HA 4KYIB 2WJZB 1WJGA 5JD5A 5CD9A 4WASA 1YIAA 4B43A 1E9DA 1LRJA 2D0OB 1NAIA 4V0MA 2X1MA 4JUDX 4KO4S 2X8JB 4LDAA 3OO0A 3JQQA 5F9MA 3FTFA 4G0PA 4OJLA 1YS4A 2I1QA 1GY8A 4KGZA 2ZB3A 3LDHA 5D6OA 2ZSAA 2H8GA 2V96A 2AJ8A 4ZCSA 4Q4JA 2H51A 3IRVA 2OOKA 1JB1A 4LY3A 2ISOA 4F2SA 4KN7A 3EXG2 4LVUA 3M2PA 2Y9TA 5F33A 3ZLUA 1SQ0A 3K4GA 4PAGA 1Q95A 4FI3F 1I1OA 3N05A 1PHRA 2WF7A 5J4HA 5DNYB 2YZ2A 4F5WA 1T15A 3ZKAA 4YFKA 2I80A 3SXUA 5TR9A 3H5NA 5K0BA 3TD2A 3FOAA 2OCDA 5GIPE 5EGSA 2GAJA 4BNWA 2QRNA 2O0LA 1RWNA 5ALEA 1XXHE 4N7MA 4OIMA 5C52B 5DI3B 2QG9A 1F2UB 4C30A 3U3XA 3YASA 1D1PA 1IN1A 1N75A 1G5FA 1EA5A 2P65A 2YZ7A 3PP8A 1DQSA 3DV2A 3I04M 8ICUA 1O1YA 3LV8A 1BMTA 2FFRA 1EVZA 3ELDA 3MR3A 3LBIA 5E79U 1JEEA 4BQFA 1AS0A 2GEUA 4ESOA 1BE6A 1BVYF 3GC6A 3H1FA 4IEEA 1JEAA 1EAMA 1BDBA 3DE2X 2MMCA 2O50A 1DTEA 2QUBA 4BCBA 2FDXA 4XD7A 3E27A 1TM3E 5T8KC 2KN7A 3MW8A 3IXQA 1WCYA 2CUTA 4FHFA 4H77A 3OCUA 3AKZA 4EITA 1FU4A 5FWNA 5EUBA 1FEZA 5LQKA 2XUGA 1A9RA 4P32A 3ENWA 1TGYA 3REOA 4FC6A 4KLMA 3QXJA 1J07A 4INAA 4EGFA 4F4IA 1GPLA 1YMVA 4Q93A 2IYPA 3K0SA 1NK8A 1EJBA 3QK7A 1FOEB 3QBDA 1E79A 5AHXA 2XTZA 1VG0B 3FXAA 2KE5A 3GAFA 1OR8A 1EDOA 3PT9A 3RC8A 1JQ5A 3CRRA 1R18A 3TLKA 2XAUA 1W52X 4URUR 3AVQA 4JYZA 4L8LA 3DOHA 4CCSA 3BGIA 3QEJA 2WKSA 2POCA 2ZIXA 4ESVA 3NC4A 2HBMA 1NJSA 4IAOA 3N59A 3ND9A 4IILA 2Q5EA 4BB5A 3K2QA 1W87A 4EHJA 5KOHB 3J81k 2ECKA 2VDNB 3H1GA 5CB4A 4C4SA 2G25A 4KQHA 1KYWA 5A2GA 2IEBA 2PKXA 2NXJA 3HE3A 1RPLA 1FX0B 4WH0A 3HMKA 2ID7A 4QA9A 3KAJA 4E1BA 2Z2XA 3BC1A 4DA4A 4NCJA 5K8TA 1E6KA 2GN8A 1MA3A 1VMKA 4NAHA 3RABA 3ACBA 3H0KA 1F2TA 1DQRA 1KXZA 1RPJA 2EJBA 5CA0F 1KZ1A 2GS9A 2EJTA 1XC9A 4F7DA 1J1UA 2Y0PA 2HTFA 3GUVA 4MJXA 4JB2A 1GNSA 4EAQA 2XIDA 2VF5X 1GQ2A 1F0PA 3VU1A 6AT1A 1I6LA 5JWHA 1N2CB 1M1NB 3UA3A 2NW6A 3Q7SA 4I99A 1LQUA 4CLRA 1U47A 3OKPA 2QVXX 3QVXA 1CHNA 3PYMA 1TK0A 3A9SA 2JCVA 3R0VA 1OFHA 4RPCA 2BGKA 4DF3A 4CM9A 3T7CA 4QYMA 4HBZA 1QQTA 3BICA 4UUMA 4ECXA 2K60A 4BO6A 1CFZA 1KL9A 2CMHA 3P9ZA 4BO9A 1ZQMA 1Z47A 4OHOA 3I64A 3IO5A 2BY4A 4UOEA 1D2AA 3BXFA 4R63A 5GJBA 5IIOA 1MJGA 1FRNA 3KB2A 1ZR4A 4LZAA 4RPHA 3QA9A 2MDTA 5DW0A 2IQIA 2HK9A 2NSDA 4KV7A 3LJKA 3CX3A 4KXVA 1SD5A 9ATCA 4A6EA 1XMQB 1ZVMA 2R8KA 1XZCA 5IDVA 3F7TA 4RBNA 4ACBA 4ZEMA 4RKWA 3LF1A 4V1CI 2OZKA 3RAQA 5AI0A 1Q2UA 2CHEA 3P96A 4O33A 4AB1A 2X6QA 4OXXA 2JK1A 4I2BA 5FTJA 4BWYA 4WPGA 1THGA 4YMGA 4RKFA 3RBVA 2WM3A 5I7WA 4JBXA 3N3BC 1VHDA 3THXA 2OFWA 5KNCA 5IWAB 3JPNA 1UKYA 2PPVA 2F59A 4MYRA 1YK0A 2B30A 4PNHA 4XPZA 1SKAA 2JJ2A 3DEKA 4XX0B 1UFOA 1CUYA 4BVJA 2ZWOA 5LQMA 2IU4A 2X2OA 5BV2P 4GPEA 1EM6A 1FU8A 2KJ8A 3HBNA 5DGTA 3W7VA 3E0QA 1VLQA 4PIVA 1GNTA 2VOEA 1D6JA 3MJEA 1RQ2A 3BXXA 3UH0A 4UU8A 4WOPA 4BKQA 2O48X 4OJNA 1M6HA 3UJHA 1T6ZA 1N5WA 2PKQO 4OXRA 3SEAA 2VQEB 4J49A 2JV3A 4PSUA 3AHIA 3FMFA 3ULKA 3ANLA 1H5UA 1GLVA 5EJAA 4MRMB 1KK3A 9ICMA 2R18A 4OI0A 2CXPA 2O5VA 3V2IA 1HOXA 3K94A 1XJWA 5D4BA 3WJ1A 3VR3D 4BRZA 3GJ6A 3U1BA 2F8KA 5BSTA 1BX1A 4PXYA 2CL6X 1R4ZA 3UC5A 3WZLA 2XQFA 3BRQA 1SBNE 2R8OA 4J16C 2PCLA 5J2HA 4IP0A 5C8VA 2OGUA 5CB4F 2GVNA 3VV3A 4DYVA 4RQMA 2JFFA 1W0KD 1Z62A 2VPPA 3MDCA 4C8KA 2JFZA 2ZJFA 3E53A 1JL3A 4NF2A 2Z1MA 3SR6A 1R9NA 3KXKA 1YQWA 2F4NA 1TK3A 2VCHA 1IXKA 1XZEA 3PD0A 2EH9A 4X3CA 4S1TA 5T67A 4K0RA 2NZYA 3ZV5A 2HRCA 5KYUB 5E4JA 3L7IA 3PJRA 5BR8B 4X94A 1E5XA 3ZGNA 5DHRA 1FVOA 2H0QA 2XKKA 4ZHQB 1TGVA 2RP5A 4NCXA 1A8QA 2Z8YM 1YL5A 4OK6A 2CSXA 3KLPX 1EWTA 1CF9A 4YRZA 4UUQA 3N7SC 3A9VA 4KRGA 3HJUA 3TXXA 4TQAA 4GLJA 3ZZNA 2QNBA 1BSVA 3KU1A 3BEOA 3PX4A 2QXYA 1D4AA 4P0PA 4HZUA 2XI9A 4DLRA 1QIDA 3GP5A 1IHOA 4A0FA 3VHLB 5DBAA 4L27A 1CQXA 4Y67A 3A2KA 3KXIA 4QLAA 2HLDA 3X0DA 3IJPA 5IJZA 3ICEA 1RKQA 1DRVA 3CVJA 2FDRA 3LLMA 2BEKA 1JV2B 3D6NB 4GKVA 1FTGA 3F96A 2YRFA 1OFGA 1CQWA 2QRLA 4ELTA 5CVCA 5EE3A 1IUOA 1XUOA 1OA0A 1WA5A 2GXQA 4QPPA 3LXUX 4MRSA 2QL7A 3OU2A 2BTOA 2QNRA 3EIQA 3M6LA 1QQ5A 3PCXA 5BMOA 1CRLA 2ZYSA 3F2BA 5CP2A 1BOOA 5H2FU 1TW3A 1QTRA 5I7OA 1F12A 5HF8A 4U2FA 5EQDA 2HY7A 3I5AA 2BE9A 3NWOA 2YYYA 2QT0A 2PUBA 5KTMA 3VO2A 4Z51A 3K7EA 2VJOA 5ER6A 5LFAA 3IPYA 3ZQKA 5LZ9A 4OLFA 1XF9A 4UHHA 5I7SA 1YNSA 4C0KA 4I3FA 3KZIU 1OXTA 1L5UA 3DMHA 4Q8FA 4K4HA 1YD7A 3H2GA 4TV9B 1V7CA 4HXYA 2H1WA 3C97A 1GLNA 3MR6A 3R7LA 4NRDA 4RSHA 4TN1A 3LC2O 2IOFA 4FGJA 4XVQA 1VSVA 2CD7A 2BD0A 4ZU6X 3WYEA 4C3ZA 1KVTA 3ZJTA 1ZQJA 1QX3A 5JRJA 1U7WA 1LS1A 5I3CA 5LCXA 3NO4A 2C5BA 4YRRA 2G5HB 2BZFA 5JTUA 2P0AA 5LVAA 1G6KA 1XZDA 3UOWA 1OJ7A 4LRXA 3VM6A 1TAQA 4TT3A 3RANA 1RPTA 2PGNA 3OT1B 3T38A 3ONVA 3RBZA 2H5XA 4YJ3B 3WMGA 1YBHA 2PAFA 1YR9A 3HVKA 2AKAB 3ZVKA 3RRJA 3AHEA 2A78A 2PDAA 4XYGA 3AZOA 4B75A 4MUKA 4JLBA 3ZBQA 4Z9BA 3GWZA 3R75A 2KV2A 2RGWA 8GPBA 1VBNA 3IUEA 4IEFB 3KEFA 1WUTA 1PNRA 2PE5A 2WUDA 1QTQA 3R3ZA 4QXOA 1QRUA 3IAEA 1KEPA 3QGMA 2SKEA 2W6ID 4DLUA 2XNDD 4PQRA 4BLOA 4BN4A 3G2IA 3NEJA 2AJLI 3QX8A 3T3HA 3ZI0A 2QN6A 3TFRA 3ZHYA 3TLJA 5CM2Z 1DFGA 2ZIUB 4IRDA 4QXQA 1HE1C 3R24A 1BKDR 3KXPA 2FWMX 2PZ8A 1XWLA 3HKEB 2QD1A 1WB5A 2QLNA 2UZ4A 1WDWB 1S9HA 4G4SP 3WS7A 2JFUA 1V47A 5AW0A 3L7JA 3QQ5A 2GBLC 4FDMA 3DXXA 3G5TA 1M34E 1BXKA 1LUAA 4KUEA 4R84A 1QYCA 1P91A 3C4QA 3TKYA 1EJ6A 3WKEA 1YL6A 4NEGA 3IUYA 6PFKA 4MA0A 1SJ9A 2BHNA 5HR6A 2WHYA 4FQ5A 1Z5OA 1ZCZA 4ND7A 4PIMA 4DPKA 1I9GA 3V8BA 2VCYA 1HE8B 5IK2A 2QUAA 5T6MA 2YXPX 2AF4C 3DLHA 4F6RA 2CYAA 3AR6A 1OOEA 5AKKA 4C2BA 2SBTA 2PYZA 1H9BA 4GKKB 3RJKA 2HX1A 1EJ0A 5EUQB 3FNIA 2AG5A 4USAA 3WDMA 3PLRA 1IZ7A 4K5QA 1W36B 5DZSA 1QVRA 1PUJA 1F9EA 2ILTA 2R751 4PGGA 5I4CA 2I9GA 1WULS 1T3QA 3ZHZA 4BQPA 3O82A 5CYGA 3R23A 4PLGA 5BN4A 4N7BA 2IXTA 4MICA 3ZNNA 1DWQA 1MDFA 2E2WA 1FMCA 5BNFA 1G5RA 3OG9A 1R12A 2VBIA 3GT0A 3MMPA 2VEDA 3EISA 5F9HA 3PW2A 4LK3A 2XPCA 1G2OA 3JWPA 4WJKB 4F2GA 4LDQA 5C1IA 1G17A 3AJDA 4MUEA 1PEYA 1B42A 2FKAA 1ULZA 3LFUA 1DVRA 1HV8A 3L40A 4MW9A 2VHWA 4TTIA 3AG5A 2SNIE 2BMVA 3UWSA 9ICLA 4EHNA 5ALHA 4OJMX 2DFTA 4O4IA 2HEGA 4ZJYA 3C8ZA 4QVGA 1WXEA 4LGCA 3GDFA 5AOBA 4NIMA 5KFGA 2HJHA 5HQ3A 4QJBA 4IMJB 4X62B 3W5DA 3CXUA 3ZGXA 2Q99A 3QXSA 4HLUC 3GQCA 5TSDA 3L6RA 4XX1A 3ONWA 2ZK7A 5BYJA 4ECQA 1BRTA 1UMCB 1OV4A 5BSVA 3D8BA 2I4LA 1L1RA 3KCQA 3LKBA 4KR3A 3G0IA 5D51S 4TUQA 1KAMA 2ISQA 3D0KA 1UDRA 2IELA 4GIBA 4AZVA 3I3OA 1SU8A 2QAGB 3BXEA 3BREA 3OX2A 3IE2A 4EVQA 2P4UA 3RJMA 1AUOA 9ABPA 5BNIA 1NPDA 1JIXA 3NV9A 5D3ZA 4DL6A 4RVGA 4KMUA 4FFBB 1DC3A 4ICAA 4F5RA 4J0IA 2ZXFA 1OROA 1BVUA 1JE0A 2E49A 5HZGA 2Z2JA 2QRMA 3QVGB 2W4MA 3OSZA 2G77B 3K70D 4ISBA 3H9EO 4B7UA 1PVDA 1QH8B 2OO3A 4YAEA 3QM1A 1WSDA 4NG5A 4KIGA 3Q6IA 1MH9A 5JFOA 2JD0A 4PONA 2CXUA 3MOGA 2IH5A 3DBOB 1KAGA 2ZRMA 1RLTA 4YONB 4X44A 4CTJA 3SVTA 4ALNA 3NFYA 1F7VA 5KWJA 2GLTA 1P6XA 1XRSB 5C3UA 1MNQA 2D1SA 5DGBA 3W2FA 5JCOC 1CNMA 4EOGA 4MWCA 3BK1A 3BUSA 5TF4A 3VNUA 4JSTA 4JUIA 3QMWA 2ZIEA 5AKHA 5D1HA 2IHBA 4DL7A 3KT0A 3OM8A 2I6QA 2QTWB 2OXOA 1V6SA 4URHA 5CVJA 4BV8A 2FZ4A 3JVIA 4OQMA 2XVAA 5EHXA 3RTEA 3I5YA 1XTRA 4EJSB 4DBLC 1O87A 3CB2A 1MC5A 5HRAA 2AFRA 3ZD9A 2R68A 3QXGA 3JAWA 3WGGA 3EIHA 2OSBA 1W59A 1QV9A 4EG6A 1GUFA 3M49A 1O77A 1Z18A 1CW2B 3WMFA 4XIIA 4AS3A 2ZB8A 1P7VA 2A1UA 2J3LA 4C6HA 3WBFA 3ETRA 4BVHA 4QJIA 4YGYA 1Z6TA 2LYBA 4P4OA 2ZQYA 3UMMA 4URFA 4IKEA 2VTKA 3AP2A 1ADFA 2GZHA 3GPIA 1UOQA 3PVCA 3DUWA 1D9FA 3WQBA 1RT9A 1QGYA 1VLVA 3WLKX 3RRNA 2QB0A 3G23A 3L43A 3HCDA 1UBUS 1MG0A 4KI7A 1XYVA 3ZLJA 4Y1GA 1M6VA 3LP5A 4GMXA 1C0LA 1ZJYA 1JHQA 5DCLA 2P6MA 3JCZA 3PKJA 1M6NA 1JMSA 5KKAA 1CR0A 3ZTYA 4QYWA 4KLNA 3OEYA 3I0ZA 1W4ZA 1F6WA 2AXQA 3KDAA 3BGWA 4J07A 5J2UB 4IPTA 5ITVA 1U28C 4LZJA 3KBOA 2PV7A 2B8EA 2W9XA 2RB4A 3OZCA 4O4IF 3NHLA 3B13B 4ACOA 1D0SA 4CTKA 4AMZA 4Z86A 2QU8A 4TL7A 4PIPA 4NE2A 3NALA 4V0OA 2Q9BA 5TE9A 4O6VA 4MHOA 2Z0MA 2CYBA 1ZI6A 1H3NA 4HX2A 4RMNA 5KT3A 1UL1X 4LXTA 3NKFA 4BIIA 1B8NA 2OHXA 4GXNA 2GA9A 4L6AA 3F6CA 1MRZA 3VX4A 4Y3UA 3NIDB 1NIPA 4WFKA 1PEAA 2K2QB 5LKRA 3C5CA 1GYRA 2XRMA 3DJYA 4JBWA 4CMKA 3ZVMA 4AY3A 1J99A 3DL7A 1D1TA 1AKNA 2E21A 2DWQA 1SC9A 4EH1A 5JY6A 2BRUC 4ND1A 3WIEA 2P2ZA 2GZDA 2GZ2A 2NQ8A 2VUTA 4L50A 3DCIA 1AX9A 2XD4A 2QTLA 3FRIA 2F7SA 2H1LA 3EEQA 4LYHA 4A0QA 7GPBA 3UHOA 4XDHA 3PXXA 1Z75A 2IYRA 1W76A 4RO0A 2X4IA 3UK6A 1UFKA 3H0RB 3RYTC 2ZWIA 1MF7A 2WG2A 4M6WB 4UPDA 2FPIB 1CR2A 4KQJA 3G0GA 3C6MA 3DDSA 2V7XA 5THQA 1CZHA 4N01A 521PA 1Z5ZA 3RK4A 2GUGA 1QGOA 1Z1VA 2WFLB 3ZBPA 3DPIA 3B6KA 4QYSA 3HO6A 2JVKA 5K4LA 4M9XA 3CF4A 2GI4A 2XY7A 4M87A 1ZJMA 2HJVA 3DBRA 4B3JA 4MGHA 1HY3A 4BLWA 5C1DA 5JS8A 5KJCA 2WI8A 1XTTA 2AE2A 1PZHA 4GYWA 2ZXUA 2OD2A 1M10A 2CLHB 2W4QA 2I7CA 2W2PA 3T3DA 2RHFA 5FPKA 4IXWA 2DWUA 1S6YA 5L9XA 4LW8A 5JD4A 4HVTA 2ZJAA 1NJXA 1HUZA 7ICRA 1ZD4A 3SSMA 1XTVA 3S70A 1BDMA 5A4MS 2C2WA 3S8YA 5JQGA 3I9OA 3FC4A 4B33A 4CIAA 3QWHA 2AUMA 2CFRA 3DWGA 1X74A 2WKQA 3PUIA 1F9AA 5BQ3A 2YYZA 2E5LB 4XXHA 3CE6A 2L5YA 1PT8A 1ZQ9A 2ZYUX 4NU6A 4X1IB 1O94D 3B7GA 3TSZA 1ZHFA 3HKBA 2XXBA 1OGYA 2XLBA 1NY5A 4IYJA 4OTZA 4W5NA 3BGVA 3WK6A 1Y9JA 2BIFA 3MJCA 1DC4A 3FHLA 4LDJA 1HLFA 2CCGA 2WSBA 2HIHA 1S4QA 1JG7A 3FCEA 3EMBA 2D13A 5F5LA 4IL5A 2BFFA 1MC1A 2FZVA 3PE3A 4ALJA 1SL2A 4UB4A 3IAS6 3HP1A 3MCAA 4U6SA 3DTVB 1E5TA 1Z16A 3AF1A 4DDKA 3E6AA 1YUBA 2OWDA 2JGIA 4KR2A 1OGJA 3FKSD 2PQMA 2BCSA 1UJMA 1P0MA 3AJ8A 4I8DA 3AM1A 1SC4A 1GPH1 2ZJOA 2YIVX 4DM3A 4DFDA 1BWQA 3RB0A 4F4XA 4B09A 3BXOA 3E3MA 1RQRA 2IZ7A 2Q4TA 1ND6A 5KHAA 1V8BA 1Z0KA 3NB0A 4L6IA 2R7MA 2N0SA 3ESYA 1L3VA 3OIYA 1Q3UA 1KI8A 1TLFA 4M21A 3DMYA 16PKA 4JLUA 2YFKA 5J5CA 4YY3B 4DLKA 4WADA 5HFNA 4Z3DA 1JWBB 2VCEA 5J63A 3AOEA 4U7PB 5DE3A 5DB9A 1WYGA 4LECA 3Q3EA 1FMTA 5LC1A 3OLYA 2AOUA 4XRGA 4CKBB 4ECAA 5KKCA 4DJEC 1XDUA 3EGVA 2GXUA 2ZIWB 3PFCA 4NYMQ 4B8YA 5AH0A 2QB1A 2KJ5A 1FFCA 2PZAA 3PUZA 3RWOA 4UEWA 1CJBA 1CTQA 2O1SA 3AP1A 3L8GA 4EYKA 4Z8YA 1N2XA 4H4DA 5LB2A 3KQYA 1I14A 5EE0A 1SCNE 5GP1A 3FPHA 4G36A 4F8EA 3DKIA 2HSJA 2Q0ZX 2QROA 3PXCX 4ZZ3A 1YOVB 3PNPA 1FQKA 3OT5A 1HT3A 4I2CA 1KJ9A 3QBTA 3V7NA 2R8HA 1KP2A 1JHPA 4X85A 2C4HA 3RWBA 1YS6A 4RHXA 4M0EA 2C8VA 2RBGA 5AVVA 2H31A 4IDOA 3QLVA 1UBFA 2ZCVA 4NSNA 4RQ7A 1KDOA 5TQ2B 5D00A 1T3HA 3FNRA 1I10A 4HAOA 3WFZA 4G5QA 2XWBF 4B3IA 4BO0A 2FPXA 5B53A 3I9KA 1Z9BA 1JRLA 2R9VA 3L0OA 3LVQE 3KQTA 5D46A 1TCUA 1B22A 1R0YA 2HGZA 4B31A 2D0PB 3C3EA 2IVFA 2YB4A 3LWLA 3SEQA 3FIUA 2PG3A 2EP8A 3NH9A 2YY6A 1K4MA 2OD7A 1MTZA 2GKSA 1RXYA 3VYVA 3LOPA 1PNTA 3IEPA 4M9ZA 5CDFA 5B7PA 2VXOA 4ND2A 4YBRA 3RASA 2SKCA 4YT2A 1I7PA 1FZTA 3CZ5A 4IH9A 1TK2A 1F44A 2YJTD 3L01A 4UTZA 1PQYA 3I58A 4MEJA 4OJKA 2R0QC 4P08A 1EUCA 5E38A 1SXJD 3M81A 4QUJA 3EZ2A 1LSUA 4PG5A 5B1EA 2BR4A 4EW1A 3Q11A 3KFLA 1EFPA 4ZVNA 4MCAA 5AVXA 4IUCS 4MGIR 4JI8B 4RVFA 1VE9A 3WGIA 3V1NA 1SOUA 4Q4LA 4GNKA 4EGSA 5JQGF 3ZG6A 3RFFA 1Z68A 4BQNA 2A88A 2O3TA 3L0IB 4RQ3A 4KWTA 4LRSB 3UYLA 5K01A 1RHRA 721PA 2FE4A 4D5GA 5CJJA 4IQGA 7ICJA 5D01A 4RJKA 4OKSA 3L79A 1KYXA 2C5LA 4S0XA 3JD1A 4E7PA 2VNIA 2HWKA 3DD1A 1V11A 3O3OB 1RKBA 1PWYE 2FV8A 3AKCA 2HF2A 1N32B 4BNTA 3JQAD 3MGCA 4F46A 4IJKA 2XGJA 4ZJPA 2WNHA 4EJFA 5B58C 4PYNA 4NLGA 2XA1A 2AOTB 1VIDA 1QPGA 2AMLA 3TG2A 3QNWA 3A4LA 1R88A 1L1QA 4F9EA 1QV7A 9ICEA 5JDCC 1FTQA 5T7BA 3GDOA 1O4WA 3U62A 1O8CA 3KNZA 2JIPA 5JDIA 2FPMA 1USIA 3ZE1B 4K0KB 3LLSA 3UBTA 2RQ5A 5EIFA 3AEXA 4QG3A 2EDCA 9ICCA 3FI0A 3NQ41 2WQ6A 4TRMA 4FXPA 1KGSA 2D5BA 3SZLA 2QARA 4KO8A 4JEUA 2H3HA 2NV6A 4B4KA 2JLWA 2W6MA 1FNMA 5ALMA 5JMOA 4Z0PA 4ISCA 3V97A 5JUWA 3N0VA 3S55A 1GL3A 2EFCB 1IHXA 4Q1FA 2NMVA 1KOJA 1TUIA 4YCXA 5J1SB 3FAZA 3NAMA 7ICIA 2Q6KA 4KGXA 1PG5A 2UZ1A 3BD9A 3BRCA 1DK3A 3UUEA 3F74A 2HB6A 4FEEA 3GFPA 3LKZA 4XB2A 1Z0DA 4WZAA 3L7LA 2WINI 1MAWA 5HF6A 3QENA 4TS1A 2OQVA 2QZJA 1P61B 1JFVA 1Z5PA 2XBMA 5ESRA 5CW2A 2HO5A 1Q0RA 2QTCA 3TBFA 2QA5A 5JZ9A 4LI0A 3T3NA 4E21A 1JAHA 5THXA 1WKVA 1XAHA 2HMAA 1M1YE 8ICXA 3TD6A 3B8EA 3TL2A 1RM0A 4H0NA 3RVLA 5EMKA 3BSFA 3IQIX 4P4TA 1EYZA 1OE0A 1QFZA 1JYEA 3O4FA 3P4YA 1B4FA 4U3JA 3VOTA 3T5AA 1JB9A 5K8VA 5LYYA 2VTBB 1GCAA 4PW0A 4DV0B 1PVPA 3R5TA 7ICQA 1ZD2P 3IKJA 3K6SA 4UBBA 4GGMX 2UXBB 2G7ZA 4QXMA 4PHTA 1V9PA 3ZZ1A 3U4DA 3M34A 4RY9A 2CUZA 1ABBA 4MIYA 3JPQA 5DK4A 2DBQA 2ZOSA 3VSEA 1EX9A 2L2QA 2YX1A 3HILA 4HX9A 3NAZA 4WK6A 3AEVA 5KFDA 1Y88A 3TZCA 5EMLA 1O9GA 2PD6A 5EYPA 2Z2KA 1W75A 1H0SA 3OQPA 1YCFA 1R37A 4EMSA 1GUYA 3GN1A 2F8TA 5FBWB 4OPMA 4WCVA 3ZTTA 2I2DA 3VPDA 2WWFA 4CM8A 1WMAA 4E1AA 4FYKA 5KNBA 3P5BA 1UA0A 3GJ4A 1OFUX 4H1WA 4GE3A 4B6FA 3P9NA 4DNFA 1P0FA 2HJGA 4MKXA 4XQ9A 3PSFA 2IPLA 3CVOA 3G5MA 4Z7QB 2ZT7A 4BMZA 2AX4A 2A67A 3ETGA 1P8JA 2O06A 1GD1O 5JUMA 4LQDA 3GMIA 4RFSB 5EOVA 1LLDA 4GPAA 4ER6A 2FSUA 3VSAA 5KJ1A 3PSPA 2HFKA 4M9LA 2CNBA 3QQPA 1RP7A 4Q9NA 1DCKA 1EFCA 1ZRNA 4PZ0A 4NULA 3SIXA 3DG9A 1QGUA 4TRNA 4AO6A 4RZXA 5HNKA 2QVZX 4LZOA 5HA5A 3KLMX 5CVVA 4PGXA 3P2EA 4ESEA 4HADA 4BS9A 4I5DA 1T3GA 1Y4UA 4GMFA 4YQWA 4YRJA 4FM9A 3DBLB 3AVOA 4DLGA 4G5OA 2B0JA 1X8XA 2AN9A 4B6EA 3DKKA 2CCKA 1MAUA 2PX5A 2X5XA 1PR1A 3C6BA 1QTMA 5FNVB 3HKDB 4AXBA 4XSVA 3HBMA 3TIFA 1G8SA 1E63A 4UFOA 2J5QA 4MR9B 3RIXA 3WO0A 4BMSA 3OUTA 3X1JA 2AYZA 3CW2A 4TSKA 4ZOAA 1AS2A 3VZDA 4RA9A 1FMLA 1NVAA 4JFAA 2WA1A 2ZB4A 3LX5A 1LRKA 5J0WA 1ZEJA 1BW9A 1KI6A 1BJTA 2AZXA 5BQOA 9ICVA 1OAKA 3OURA 4HDSB 3S5JA 3AY6A 4L8YA 4NCNA 1NJ5A 5CNMA 1ZI9A 1COWD 1H5NA 2QBYB 2DFLA 4R8KA 4PM4A 3W2TA 5K8CA 1G20E 2NIPA 3NVDA 1E7MA 2KFZA 3TCNA 1PL7A 2ZI5A 4BL5A 5JV5A 4G07A 2VH5R 3QG5A 3BJMA 2FMHA 4NYMR 1GL9B 2Q5FA 3COWA 1T5OA 1KE1A 4GI3A 5JS7A 1JYFA 3I8SA 3C2MA 5FEMA 3ZHUA 3DV0B 1DHRA 4C4AA 2IPMA 4TYMA 1K89A 1XHLA 4H1VA 1S3IA 4FMCB 1H66A 2ZKIA 3B6MA 5ITSA 1YVEI 3R7AA 3IN5A 2R1TB 2WIAA 2ZRJA 1ZAKA 4MZDA 3DGFC 3NGMA 2R87A 1G4HA 3R5KA 1XLTC 2O0KA 4DRXB 1VL5A 4OHZA 2AGOA 4ZDWA 1XDZA 1IPHA 1EIZA 1W0CA 4CQLB 1FDTA 3NRZA 1K3UB 1GSOA 4JQOA 2P66A 3THOA 3G8YA 2GCIA 1P44A 1WQ4A 3ZHBA 3H7AA 1ZOLA 1N5RA 1RJ9A 3AF2A 1VA5A 4O29A 2CUNA 2A0FA 1QXSA 3S81A 2AEFA 2DBVO 4RANA 4FC7A 1GDDA 1L9KA 2PL3A 2KICA 1F20A 4JIMA 3W8FA 1TAGA 3GELA 4HAWA 4KDRA 4TVOA 1X9SA 3I6YA 3M6FA 1ZLYA 3HDHA 2PL5A 3AR3A 2ZIAA 3HCCA 3TVYA 3FLEA 1PBTA 2VS1A 3DQZA 2XQKA 5EXPA 5JC1A 3T35A 4ALLA 1EQUA 3K9LA 1FP4B 4FXOA 3CN9A 3QFCA 3QEAZ 3LRPA 4ZMSA 2COKA 4BGUA 3AEYA 4DMMA 3OU7A 3EVAA 2GO7A 1SBTA 2JG3A 1ES9A 3I5UA 3T7AA 4LXUA 5DDYA 1KU6A 3CJTA 1PNOA 3ILSA 5A7HA 5JHGB 3ZQJA 4NBSA 2VYND 4OJ5A 5C53B 2OYYA 4MVJE 2DU8A 3DBIA 1RYZA 3VYWA 3MGHA 3EF1A 3GPLA 4QTZA 1ZNWA 3CKMA 4NLBA 1EEHA 5K3AA 2XJ9A 5EWJA 3K75D 4IV8A 5HKBA 3TAXA 2NO0A 2XMDA 1OLXA 3DULA 3EXG1 3PYXA 2G8LA 3VKGA 1ZINA 1N2BA 3H04A 4UXIA 3K0FB 2G1AA 2VDWA 4WZ6A 2NXNA 3TI9A 1W46A 3VDQA 3GJRA 4Y2PA 4I4NA 4KH1A 3W7BA 2H1VA 2VQSA 4JK3A 2B5WA 3PR4A 2RKOA 1XRJA 1P60A 1RCFA 3UWPA 1KQOA 4PC2A 2LI6A 2FZCA 2D1TA 2J0UB 5HX7A 2KEYA 1FFSA 3AW8A 4Z0TA 1J4AA 5BV1A 5AHRA 5I9SA 3C24A 2G5TA 1O54A 1BEEA 3C16C 5EIWA 1RYMA 3IUPA 1U8AA 4ZU1X 2WZBA 2BCVA 3MTAA 4J9PA 4EIWA 2GEVA 3ZDEA 1TMKA 1XTPA 4H9GA 2XCPA 1E2BA 2V0GA 1Z34A 1ZMXA 2Z8XA 5JARA 4TRJA 1OX6A 4W1QA 4GFDA 4GOXA 3WQQA 1IUNA 2FOLA 2Z83A 1JP7A 4PYMA 3WK4A 2OAGA 2I62A 2WKWA 4CG1A 1PZNA 4GMGA 5GGXA 1LW7A 4AF8A 3CZ4A 4WOJA 1CPYA 1J6UA 4KLSA 4RACA 3WLMA 5IJ0A 1Y89A 5FA6A 1X1RA 1NAHA 1MR3F 3T95A 2QL9A 4BXOA 5BT8A 4JMLA 5ELLA 4E88A 1F8GA 4DEVA 1JBKA 2PMFA 2JHFA 4MMYB 2H4WA 3PKZA 4X7BA 2MSKA 3SJ7A 1C41A 2JI6A 2IOYA 4LAFA 3TEMA 4J8PA 1QV6A 2ZVJA 3TPCA 1ODFA 3QUBA 5EP2A 5GIOE 3O90A 4L5JA 1FFHA 4O3OA 2V7TA 4QGHA 3DZDA 2V6GA 4QBFA 2DQ4A 4BJHB 1DBWA 2AZTA 5BT9A 3FYSA 2Q49A 3MUEA 2OV1A 4J29A 3WHLA 3U16A 2KVCA 3ANMA 4Z1MA 2FR8A 4B73A 2YFQA 4B87A 1NV9A 1QZZA 4TV8A 4LVNA 1Q92A 4K4IA 3IPCA 1SIBE 2ZDGA 5IBRA 3SDBA 3E9MA 2WZQA 1W25A 2IYTA 5HQJA 1U5BA 2IXAA 4YYEA 2A9JA 4YMIA 2BJWA 4ZO8A 1WR8A 3W5BA 2IEIA 1SUCA 2CYCA 2C99A 1XYYA 5C3MA 4LFBB 4KRYA 4KVFA 3T9BA 2AXNA 3R20A 5AIBA 1JJ7A 4O3PA 3AG6A 2ZIVB 1M8JA 3OQBA 2CV0A 3A3YA 2I6FA 2HLPA 5KNIA 3OAAA 2BHSA 4DGSA 2FF5A 4A8JC 4TL9A 4XWOA 3LO8A 2FMTA 3NTXA 3QUCA 4HWSA 4GECA 1NXOA 3ER6A 4Q48A 2XY5A 1JIUA 4XUEA 3EVCA 3H19A 1F4LA 1GA6A 5A7GA 4HQ6A 1GZ6A 4ZCQA 3QU7A 1PWXA 4MPDA 1RYBA 1EBFA 5AK6A 2IIQA 5AVOA 4DV4B 1T2VA 4UTVA 4BBJA 2HQBA 4ZTZB 4GXKA 2CMKA 5CHGA 3ILVA 3E8SA 3H4VA 1C0IA 3WWOA 2WHPA 3O5AA 1SXJA 1W581 3KO8A 1GDHA 4C21A 2QQGA 1O95D 5P8WA 3O1IC 3R3VA 1Z4QA 5J3JA 1QIKA 4UREA 1LPOA 2ZBQA 3BE5A 2GXAA 3U4GA 2P9ZA 2GBGA 1GGJA 1GZSA 2P62A 1RZVA 3JSAA 3ZWCA 1VSQA 1YUMA 4QLBA 2BTQB 4MKZA 2J45A 4D98A 4PFQA 5K3BA 1BCRB 1VPLA 1H3FA 2PGOA 2G17A 4I5GA 2JIQA 4KDCA 2QM7A 4QW9A 3HABA 4O1MA 1U2ZA 2DT5A 5BMVA 1FX1A 3W6NA 4B3GA 2WVJA 5DISB 3THRA 2W9MA 3LPCA 1FNBA 4YRSA 2QSZA 2OXCA 1J09A 2ZTUA 4I7EA 4UOZA 2BFEB 5BSHA 4EA8A 2O2CA 3V5NA 1MXHA 1OSNA 4RK5A 1E9EA 3QLEA 4RL4A 1FY2A 1PUZA 1MX1A 3CUWA 3AEQB 1E7YA 1TIKA 1CIPA 1JEQA 1J0DA 3LBAA 4F1WA 1KDTA 5ILGA 3K5HA 1QGAA 1S3GA 1UINA 3U13A 1KBQA 4UCQA 1B0PA 2I2WA 4PGYA 3HJNA 1X7YB 1BDHA 2A4MA 2EEPA 3V1UA 1VBMA 3R3WA 4KC0A 3ADOA 3M6ZA 2H54A 2AN5A 2HQOA 3DYVA 2R8IA 3EJWA 3NW9A 3GT4A 3E7XA 3LLVA 5IHXA 1KI4A 2HJRA 2WZDA 5AKIA 4ARBA 3U3MA 4LZNA 2CLEB 1V5IA 5IJ9B 5A5EA 2PBFA 5LBTA 4HSEA 3W1VA 3KKAA 2FLKA 2VWPA 1QP7A 1VMAA 4BE4A 4YRCA 1YDGA 3OZDA 1WP4A 1JLLB 2QYSA 5CBPB 3EDQA 4UEKA 4QSMA 3ZZUA 4P82A 5DBIA 3QPCA 3F2IA 1DIGA 2D5IA 3L7NA 1SBIA 1QFSA 4TV8F 1IVSA 1QIHA 2XIQA 4YCMA 4P98A 4W9RA 3JVDA 4V2UA 3NHYA 4Q9LA 5G0TA 2GZRA 3UF0A 1V6CA 4OBWA 3R9IA 2XYRA 4TLDA 1VIVA 3PTLA 2V3CC 2J0QA 4J9NA 5G02A 1U31A 4ERNA 2JRZA 2Y71A 4N0MA 2MR6A 2VVTA 3WLEA 2JEGA 1XD2A 5IDQA 5T3UA 1JXEA 2HHHB 3M83A 4Q01A 1A5BB 4REOA 1DX6A 1PR9A 3KM0A 1CSEE 1SZCA 3ZI7A 5C8YB 3RK1A 5LDDC 1S0OA 4R2LA 4B80A 4CL0A 3KUUA 1L3IA 2IYUA 3GJ8A 3DHWC 3RJEA 2EZYA 3C6YA 4E0BA 2IYXA 1JHAA 2VP2A 2R8PA 2VDMB 2QRVB 3RWMB 1E2LA 2VNJA 3ASUA 2ZJ8A 3UUWA 5I7EA 4DE5A 2K8CB 4D46A 3DMGA 3UXNA 3VZQA 4C4OA 1NK4A 5FD8A 4F12A 3AJRA 2JMGA 4AMGA 2H0RA 4E5SA 3EW9A 1F0KA 1RJDA 3GUZA 4NXMB 3V8PA 1P0IA 1Y8QB 4GW3A 3HDVA 1I4EB 4ZVSA 1PT6A 4TOIA 1PL6A 3K4HA 4TRRA 5D3QA 4WMLA 2VPIA 1PQWA 2H1HA 5IAKA 5KOJB 1XMSA 3CNHA 1H2RS 4MI1A 5G0WA 4XQCA 3T06B 1T4DA 2JA2A 1PVRA 1NY6A 2I76A 1UT6A 3HQ4O 5G0SA 2WFZA 3WHPA 4RELA 4DXAA 1AV6A 4FK8A 1TA9A 4DYHA 1B23P 3LDGA 4LJSA 1C1XB 1CUUA 3Q8KA 4RVOA 2VSNA 1U1CA 2FMSA 4KFSA 4U7JA 2Q0SA 421PA 3U0VA 5BMVF 3CA8A 1W2HA 2PNJA 3WAKA 5FLYA 5D1NA 2Q6IA 3ISDA 1OVMA 4AG5A 1Z7WA 1P1HA 4B9MA 3FDZA 3VXKA 4K9KA 3KKEA 4FE3A 1ZC4A 3HB7A 4E03A 3EWIA 3CZQA 2RKBA 2MUTB 3BZCA 2OEHA 3CC8A 4XPIB 3AF5A 1WCV1 2AIRA 2WB1C 4OAPA 1Z4PX 1ZAYA 1ZNZA 2AEEA 4K1XA 5KFLA 3ABRB 2ID4A 2O3JA 3TD9A 3FGZA 4XA8A 4L02A 1QNFA 1IPFA 1PWHA 3PXDA 1ENZA 5EJIA 1XRMA 1D2RA 2C8JA 1NYRA 2EIXA 5HBGA 5LKAA 3S27A 1P5FA 1GP2A 1K8RA 3T9DA 1RCTE 3AL2A 4JDUA 3GLHE 3IQWA 2LCIA 1BJKA 2W7OA 2IOHA 2ZCJA 1JEOA 1YRYE 1D7OA 1YNOA 2P41A 3GLFB 1J1ZA 3UUGA 3E15A 3ZH2A 2OORA 5K3FB 4E6PA 2JHPA 5FI3A 4LFCB 1Z0FA 1MD9A 4RDCA 2MSLA 2HXGA 4AS2A 1IMJA 2GJ8A 1K7XB 3T9CA 4C7BA 2QD3A 1UK6A 5IVKA 1R27A 4GVPA 2HZBA 1ZQEA 4W7SA 1X7WB 3H13A 3H2SA 2K4MA 4MLCA 3RAPR 2G3YA 3TX2A 1PJLA 3K1AA 3PX3A 2QJOA 3HS3A 1BH6A 3G8BA 1WHTA 4R16A 4JLDA 2Z7JA 2B34A 3OZWA 1JQJC 2V9WA 1COOA 2G9NA 1CF2O 3WGLA 4BQIA 5KI6A 1IJFA 2GILA 1N5IA 3OIDA 3PB3A 2X6RA 4A73A 4C8NA 4NV3A 1XIVA 4I8IA 1HFJA 3ECSA 2QPAA 3AL3A 4XW2A 4M8IA 4XUDA 4GP9A 1SHKA 4QNRA 2XTJA 3O8QA 1MFZA 2HBJA 2C95A 2AU0A 2J6HA 3L6EA 3TW8A 2IV2X 2C07A 3A3KA 3HY6A 3P2MA 2TMYA 2AZ4A 1NUQA 2P6RA 3B5IA 3L1UA 3VU0A 4DJDC 4OBXA 2Q27A 2FWNA 5ADUS 5L3SA 3UMJA 4K9RA 5ALNA 3RFTA 3HU1A 5L3ZA 4GEKA 3W9UA 4PGQA 3N74A 3HA7A 3EXFA 3JALB 4C3UA 1LPBB 1U7OA 4C2UA 4KE9A 4M83A 4E30A 1XAIA 2IT1A 4CKWA 1MJ5A 3U44A 1ZH6A 4FX5A 2EAPA 4LOLA 1S7CA 1IEQA 5CH5A 3UT6A 3BQ9A 5FL7A 1N9GB 4BWMA 3CEMA 2GKGA 4NJEA 4RHEA 4JVLA 5DBOA 1K6JA 5DB6A 3F5AA 1YC5A 4PZAA 1F4VA 2IH2A 5DX0A 1P5HA 2IHZA 4QYXA 3AUSA 1I2CA 4C05A 2DB3A 1A1VA 4UC0A 4BQSA 3Q8LA 4FWBA 4IV5A 2EG9A 4XYLA 1QFXA 3Q6NA 5FPQA 1N6LA 1GFZA 1A50B 4WFJA 2COUA 4B79A 1WIWA 3VCBA 1C1DA 3ORQA 2D5LA 3DDHA 4FZVA 1P7WA 3RYFB 3DGEC 4RGVA 3NJ8A 4GBMA 1RM4A 1RFLA 2ICAA 2OILA 3KZ1E 1FFEA 1NSYA 4K9DA 4FSXA 2DPJA 1IFXA 4LHEA 2J6UA 3ITDA 1R4AA 2JIRA 1PVOA 3GRUA 4PBTA 4ENVA 4FDLA 3K72B 1PAUA 4DFPA 4KLIA 4MVJH 4L2IB 3TGWA 5U9CA 4RMGA 2ZDHA 3AP3A 4FOOA 1IIBA 5EHZA 3AJEA 3KV3O 4X3PA 1AKUA 3UJ8A 5K0NA 1DELA 3G5AA 1ML4A 3D3NA 2AW5A 4PSKA 1YZ3A 1Q1EA 2VPYA 1Y6ZA 4HQNA 1ZIYA 4OXIA 4YPFA 3NKVA 3UMCA 3ALRA 1IK4A 1ZUD1 4LF6B 3AQ4A 3AUOA 4RUCA 2WJPA 4B1FA 4RY8A 3LYUA 3STHA 2I4OA 3WMRA 4R3UC 1ECWA 4HNRA 3AR5A 5ENVA 1X7ZA 5L1JA 2AJTA 3DMRA 2J32A 2HBRA 3ZY2A 2HAEA 4QVKA 5AKXA 4PY2A 5BWLA 2ACWA 3MYYA 1YR2A 2HMXA 3GGSA 1Z22A 1OXMA 1W9HA 3GRCA 4QDKA 3TIXB 1G2IA 1GN9A 2O7VA 3AVWA 5IBCA 1S1MA 2W3RA 4EAAA 1TXGA 1CB7A 1ZVVA 5ALRA 1EWVA 4UJ3A 2DLDA 2Z5FA 2WB4A 1KE2A 3GB9A 4EHHA 4HAUA 3C29A 1TF5A 2XGPA 3HUFA 3KR9A 4BNYA 3JVEA 4DIUA 2AVNA 1E9VA 5EUMA 8ICGA 2OBFA 1ORDA 5GTIU 4Q7EA 3ZU6A 3EA5A 1VG9B 2VHCA 5AJYA 4C7ZA 2CVFA 4H6WA 2ZR7A 1NKCA 4JZYA 3O2JA 2DF4B 5CYPA 3QLUA 4JI3B 4RQTA 1NX6A 2QRQA 5AVWA 1J5PA 3FAKA 2ZJBA 3E3AA 4BO8A 3BCRA 3KHRA 3DZGA 4Q9JA 4KLEA 2JKVA 2WU8A 3TRJA 3DXYA 3N87A 2QT1A 3E5HA 1E1DA 3OCWA 1XNRB 3PW7A 1L5SA 3AK4A 2I7VA 4CUZA 1UBNA 1KJNA 3BS5B 3NMUF 4WLNA 3OWXA 5FEUA 5ER9A 1YDWA 1B41A 1SGWA 2E4UA 1S97A 4ZYLA 1YFZA 4DSLA 3BE8A 3GMTA 4YV0A 1HDEA 1F1JA 1TZJA 2NUTA 3ZLVA 1DOQA 1YAHA 2I3ZA 3TI7A 1WO8A 4CODB 1KTVA 1BU5A 2H9AA 2JGFA 5TB5A 1OIXA 4MLZA 1XU4A 1NTRA 1QTNA 2IITA 1GTZA 5BW8A 1H9CA 2WG1A 5DNEA 3NORA 1H1DA 4R51A 2F67A 1DGQA 4JEIA 4YJDA 4POAA 4RIGA 3EPHA 1EUDB 3WTBA 1PT5A 3L0SA 4RFVA 3WQHA 4U7WA 1KBOA 4ZDJA 3VHXA 3T7RA 1J8DA 4DSZA 2OWEA 1PFWA 1KWGA 2H5JA 3D7MA 1E2QA 5L1KA 3RC3A 5IZCA 4FW8A 1CVRA 1DBPA 2YH2A 1DG1G 1UOPA 2KPOA 4QL3A 5ENZA 1L7VC 3O75A 4G63A 1UMBB 4C0ZA 3N6XA 3CR8A 4RWEA 3MGBA 4FYXA 1ODSA 5KFCA 4F9FA 3LQ2A 1LFDB 3N39C 2W8BA 4QPDA 1QH1A 4U9HS 3KLNA 1Q3HA 1QS0A 3T0IA 3M1IA 1H38A 5DWDA 3RH0A 4HCJA 3PGJA 5I5EA 1WVMA 2PLWA 3ENVA 4UTNA 3QA3E 4FMPA 3O26A 3HJAA 7ICOA 2B5OA 1ZOIA 4BFYA 1O95A 3E1GA 2QT9A 2PMCA 3GNLA 3IVRA 4FEYA 4DIMA 5K1ZA 5JHHB 2P9FA 3BMCA 4EHDA 3PVZA 4DV3B 5F51A 1ONPA 3M6XA 4RDXA 1A72A 2A9PA 3GJSA 4N8SA 1GV0A 4REQA 1Y6GA 4NMXB 2DEUA 2M32A 1EFHA 2AX3A 1VYVA 1IUKA 1G2PA 1SG0A 4GX1A 3SVLA 4MHTA 3V3KA 2I3BA 4G0OA 4YP6A 2WQZA 4G4SO 1P2UA 1MOSA 3STTA 1JG6A 2JLBA 3R41A 3JXEA 2REQB 2B8WA 1SHUX 3CCCA 1Q0SA 2R2AA 5ERYA 2B25A 3FWYA 3M5PA 5G0UA 3PIIA 3VYTB 1RXSA 4WXRA 4PAOA 1MOQA 4CMHA 3A3OA 4LN1A 1RI4A 1A2OA 4UARA 4OHMA 1BAPA 4LWPA 1YWGO 2VSQA 3CEPB 4B9TA 2GLEA 4DJJA 4F4FA 1T36A 2A4KA 2QNIA 2EIHA 2FRXA 3NDIA 2XNSA 4QO8A 1G7CA 3P2IA 4HBGA 4UE2A 2OT3B 3U49A 4JT9A 3G59A 3VR3A 4G5RA 2DUUA 5DNUA 3DE3X 6Q21A 4YCAA 2OESA 1VIAA 3UW3A 4J1SA 1H6AA 4KBYA 2P68A 2HCTA 4U7TB 4KEAA 5ULLA 3TINA 3DZ8A 2V7WA 2V8OA 3SK0A 2YZNA 1ICEA 4W9NC 3KXLA 5MFZA 3FJ1A 1W0KA 1KNQA 1EU1A 5H59A 2Z6UA 5JCJD 3I2FA 4QZVA 3U26A 4N39A 5GMOA 2XDYA 4L1KA 1R4MA 1LFAA 4TLBA 4EO9A 4CF4A 5T57A 1PTJC 3RGGA 4BKOA 1TVMA 4Q3KA 1C3LA 1QDEA 2CFCA 1MMFB 4ZREA 7ICHA 2AZMA 2W9AA 1S0VA 2H9YA 2WYHA 4CL2A 1X2IA 4NU0A 3KG2A 4ROTA 2VJ4A 3AKDA 3KB8A 1NVMB 2O3SA 4TUSA 3ZXUB 1L7NA 4UTPA 1YGPA 3LX4A 3OFJA 3SX4A 2EJWA 4HVAA 3E7DA 1LK7A 2ZIGA 2HBYA 3HB0A 3GV5B 4FS1A 5E2AA 4GWGA 2QX8A 2B1IA 1I5OA 2R00A 4NYIQ 4Z99A 3MAJA 1R66A 4FE4A 3L6BA 4HYYA 4EGQA 4L0CA 2R3SA 2AKEA 2OFOA 1NUHA 3SAJA 1C3EA 1WRBA 2G83A 5E4YA 3ZGZA 2VWHA 5CFMA 5JD3A 4W5TA 2ZWMA 2QM8A 4XJTA 5J2KA 3PC2A 2WLSA 2OCKA 4TKLA 3SV3A 1T0IA 1Z08A 2AWNA 4BZZA 5ENDA 4P7FA 2PBRA 2QY9A 5KMGB 1RRCA 3FMVA 1WM1A 5GOTA 4HGYA 1V35A 2X2EA 1OTXA 1ZWLA 3KZNA 5H70A 1R9MA 1GQYA 3O1JC 3CR7A 5FLKA 4BVAA 3VSBA 2OB2A 4UB1A 3MD0A 4BVGA 2IXEA 1PYDA 2Q6OA 4WXPA 1SG9A 4Z6KA 3KLOA 4IQ8A 3H8SA 1AOXA 3REQA 1SBCA 5HRCA 1J25A 5C7YA 3TZ6A 3RBDA 2EKBA 1TMOA 4X84A 3DBHA 1E2HA 2YWCA 3PNBA 3GIDA 4X60A 1G21E 1J9EA 1MAHA 2WJIA 3PQ4A 3PF8A 4HNSA 4CR7A 4LRTB 3WE7A 2QX7A 3IRUA 1VTKA 3ZHVA 2F3QA 4U0KA 1C4KA 2W22A 2QTHA 5EP1A 5KSWB 4GHWA 4L8VA 4F21A 5JRZA 3H9GA 1KI3A 1Y6FA 4M49A 3RF7A 4ZAXA 4YTEA 5B1HA 3I23A 1L5GB 4R9SA 2IBSA 2Z04A 5JWRA 1DAOA 4HNHA 3EDRA 3HPQA 2IEYA 4D3ZA 2IIPA 4MQEA 2XA9A 3QXHA 3MMSA 5F3RA 4IDNA 4LHXA 1WE2A 1Y9ZA 3LCJA 2GJAA 4GYKA 5FULA 3ET4A 3UYKA 3RB4A 2ZYHA 5DFAA 1SIOA 4DR6B 4B9SA 2Y0SC 5IT4A 2BMWA 3KJXA 1OZAA 3GG9A 3DFMA 1LWNA 1TB4A 3KOMA 3NVYA 1O97D 2ZE7A 1KNXA 2BFNA 1ULTA 5DX1A 1UK7A 4AROA 3VU9A 1TAMA 1RAAA 3D8UA 3TFQA 4TX1A 4EFKA 4F4UA 1V96A 4F4DA 3PQCA 1BDIA 3RJGA 4UW9A 4JJIA 4R8UB 5JECA 3R9KA 3RRGA 2WT4A 2XQIA 4PNZA 1R8YA 1ECBA 5JSKA 3N2GB 3ZW7A 3PEFA 2W6IA 1GGKA 1AM4D 2XNDA 3WYGA 4L6CA 2YN4A 3THYB 2Z9CA 3O74A 2FMKA 4ETIA 3W8EA 1ZPDA 4BRUA 1SUAA 1WW3A 2Q7XA 3K9NA 1QIJA 4OK5A 2H5EA 1PV1A 5CB1A 2OBMA 3BMXA 3WRVA 2QL6A 3OF5A 4I4LA 4G56A 4UCFA 4AICA 1T8SA 4WNCA 3GEPA 1XTUA 2ATEA 2O2XA 2C3UA 3A32A 4JOCA 1FXWA 1GSHA 1R5BA 2XUAA 3HUUA 1LDEA 4RTQA 5JR3A 1E9CA 3GJ5A 3R7DA 1PQ4A 2BVNA 2ONCA 2SICE 2GA8A 3ND7A 1XP8A 5J5AA 1JDBC 3DLCA 1Y8AA 4WX2B 1LPPA 1JROA 2X8AA 3C4JA 1PQUA 3B9PA 4FMDB 2VAWA 3KZOA 1VLMA 2Q4EA 2DGDA 4DY4A 1RI3A 5COBA 1U1GA 2W2OA 4N5DA 1Z38A 4CFSA 3M4JA 4B85A 3EZ6A 2DCMA 1ST2A 2XV1A 2PKYX 1B3RA 2YRXA 5H3LA 1F17A 2XNKA 8ICIA 1WMDA 5C5JA 3MFQA 3CNEA 4QODA 1PU2A 4TYYA 4D9MA 4PR0A 3RI3A 5ALKA 4GXQA 3S28A 1H1TA 5B36A 4I1SA 3BOSA 1TFUA 2R7NA 2OBXA 1V5EA 4KZPA 2GZ3A 3HJGA 1L5LA 4M60A 1KDYA 5CJ2A 1JJVA 2P40A 5CLFA 1Q16A 2OSVA 4I0WB 4E4RA 4RH3A 4ABTA 4B81A 1FUKA 3UAGA 5CLIA 4TKVB 3DF7A 2FOIA 5K3CA 1BN7A 4DY6A 4GL2A 2G0NA 3NBQA 4EY4A 4NOJA 3ZD8A 1CUZA 4KMOA 3U09A 1GG8A 5T4BA 2QTNA 2EFGA 2A0XA 1NF9A 3UUFA 4KQCA 5EPEA 5TZVA 3OPYA 3KQHA 1WHSB 2WF9A 4KQMA 5DB7A 1IY0A 1LBIA 2F4VB 4BUZA 3B1ZA 5FTKA 3JPRA 2XUZA 4JP8A 4X8OA 4LA4A 3HXMA 1X94A 3OA0A 2BBWA 2H63A 4F60A 4J76A 3SS9X 4DT1A 3HBLA 2NXWA 1ZGGA 4NJ8A 5DB8A 2ZBRA 4DR5B 1JSCA 1F0MA 3N2ZB 1XD8A 3GIJA 3OCZA 2VSXA 5ALTA 5DNDA 4RPIA 2OHOA 3PX6A 2WYIA 2EGGA 1IOVA 4MHVA 4HUTA 4MS4A 5J47A 3SC4A 4N3NA 1U80A 1AXEA 4G0MA 1U94A 2OD9A 2Y67A 1I7QB 4DANA 5BXYA 1S2LA 4E4YA 1H4VB 2Q4DA 8ICYA 3HY4A 3ABQB 2IHYA 5L3QA 3EXHA 1XT6A 2VK4A 3C3MA 1Y7LA 4H3SA 1C9MA 1NZFA 3EGXA 4UZFA 1U6IA 1ODLA 2WK1A 3OVMA 4XWWA 3PO4A 5EWMA 2GR9A 3R5SA 3DNFA 3FBGA 2NPFA 1T13A 4A0HA 1N5MA 2YS7A 4MUXA 3QTLA 4HQ0A 4BZXA 4OJOA 3A31A 1ZGZA 2QQ5A 1EXNA 3S2UA 2J5RA 3RARA 1MIOB 4WZBB 2YMLA 1F48A 1IWPB 2XRFA 4ZZIA 3ZY6A 1FQJA 1D9XA 3KEGA 1X9WA 2WUGA 3BWBA 2XX3A 5AVUA 2CJPA 2HHCA 3A6EA 3I5XA 3MSXA 2HW8A 4JKOA 1FXWF 1O6ZA 2PGXA 3SC2B 1A9OA 4EFNA 2VF7A 2GSDA 3GEBA 1C8VB 3CZAA 3RTBA 3FOCA 1ZR2A 1XA4A 1ZESA 4YCNA 4MV8A 2GAFA 3OOWA 1RHUA 4JC0A 2CGEA 2IA5A 1IWBB 5FH9A 5E6UB 4EEKA 3SIPA 3NZEA 5DHUA 3UW1A 3OO1A 4WJ3B 1KSFX 4M0UA 1HURA 3ZZMA 2F2TA 1B43A 3PPIA 2HBKA 4PZCA 4NYIR 2W9BB 1W35A 1YDEA 3P27A 3WRYA 4LF7B 2I8LA 5G2OA 1S8NA 3SF8B 1G3UA 2HD4A 3BZBA 5KG3A 1RZUA 5EZYA 2HIMA 4BU0A 3NYQA 1VJTA 1NR1A 4L5CA 3FW1A 1TMYA 3AHJA 5DLDA 2ORED 2BV3A 1NZDA 3EGOA 1K0FA 1JJFA 3WI7A 3VI3B 4I9UA 2QJWA 3VUFA 2QPTA 3VDNB 4XKJA 2NX2A 4MQUA 4WERA 4I4CA 3CRXA 3DBVO 1N0IA 3KHUA 6GPBA 3VR5H 3F3SA 1TYAE 1N1EA 1IK6A 1KVSA 2YZMA 1EVLA 5KFBA 4JLWA 1XJ5A 2NTYC 3D6AA 4N76A 1TUGA 3JQGA 3VZRA 2X13A 2WIFA 2B1RA 5B66U 1NXVA 3FUTA 8ICOA 3TIVA 4MSUA 2AD5A 1UWLA 2VI5A 5DGIA 3FPCA 2XDQB 1EVKA 1SCUA 2PFNA 3D4IA 2XT0A 2XF8A 3RFUA 4MS3B 2J87A 5D7BA 4YX9A 3PGMA 4JN6B 3ZWQA 1YU9A 1F8UA 2G7MC 2OWOA 2NUAB 2C2YA 2F17A 4RTNA 5A4JA 1N6KA 1U4OA 3DNPA 3HR8A 3GPCA 3HWSA 2H7XA 4QZ9A 4OFZA 4MVJM 4BFZA 3D54D 2PZJA 1TRHA 4A3SA 1LW6E 5FUVA 1TZMA 2Y1EA 1XCLA 4NC9A 3LYHA 2PR2A 2WNSA 1R64A 2ZBDA 3BS7A 1DEHA 4ZT3A 3CF4G 2FPGB 5K0TA 4Y7DA 5DG8A 1UJBA 1U8FO 5SZIA 1V26A 1Q7CA 4X8HA 2OCAA 4PEVA 4A8JB 5CXQA 3BMQB 3T54A 4HY3A 3GDGA 3PEWA 4RMJA 1RXEA 1UAYA 3HNOA 3ZHOA 3ML1A 1USVA 3EDMA 1DBQA 2XW6A 2CCJA 2C0CA 3F7MA 1B1AA 2FG6C 2FP4A 3BQNB 1OLUA 4FLEA 3DTYA 4A36A 1ZLXA 2V6MA 4R98A 4HZIA 2A1JA 2GCPA 1G6HA 3W5CA 1JHOA 3T3EA 4ED3A 2AJQA 3HSKA 2HJSA 4YMSA 3C3JA 4HQKA 3B8HA 4O63O 1Q0PA 4BQQA 3X43A 2P27A 1GPAA 3EG5A 4CDMA 1NHGA 3T41A 2W8ZA 1TTTA 4FYIA 4LOAA 4RVDA 1JT2A 5BORA 1RYRA 2C82A 4GF5A 2C7VA 5BP7A 1DCFA 3L8EA 4DYDA 4OF4A 1HF3A 4ENPA 3VR0A 3ICQB 3SQDA 4FI3C 3TANA 5JMPA 2PD4A 2C7BA 3QUSA 2AE1A 3O03A 1WPGA 1KDRA 2Z30A 5H80A 4QPNA 3I37X 3INGA 3GXBA 4BE9A 2JPDA 3VKUA 1U2DA 3O1HB 4DLPA 1MCZA 4EDFA 1YB6A 3AI1A 5K03A 3BL5A 4F3YA 3MGGA 1K88A 4RVNA 3ZD6A 5IIKA 4DLVA 3JYLA 5IDWA 1QSYA 1BO6A 4AYWA 2H4XA 1QFYA 3RSQA 3RT9A 5EZYF 1HQYE 2QJFA 4Q47A 2W2KB 4D8UA 1O94A 2GZ1A 5EJGA 3EEYA 2E48A 1PDWA 1ISRA 1JKJB 3EG9B 2FLWA 4RU9A 1FVXA 3ZW8A 5TIIA 1OLOA 2BHLA 1A2QA 5FRDA 2YYSA 3RRHA 1GADO 3INRA 1P2FA 1C2TA 1G5QA 4HQLA 3ZBUA 3CF6R 3H8WA 1ITZA 3SSOA 2GN1A 4F97A 2M9NA 3H1PA 4QWDA 1QPBA 3DF9A 2NM0A 3FKSA 1N6NA 3JASB 3PT5A 4YJFB 4BVBA 2RGXA 2W8LA 2ZIXB 3T61A 1K3TA 4LHWA 3O4IA 4BJ5A 1E5DA 2QMEA 3D81A 4AJ1A 4URWR 1J8FA 4C78A 1ETHA 3D8TA 4BPRA 1SZDA 1ONOA 1PYOA 2OBBA 1FFUA 2VH1A 4NU5A 5J0OA 1KFBB 3GVHA 4KPFC 1Y4AE 3GLRA 1M5TA 1DBRA 1SURA 5IYZA 4MRVA 1YHYA 5DTQA 2UYCA 1NFQA 4ZC8A 1I7SB 1TIBA 3HEAA 5A2QA 3HB1A 4IGIA 4IDPA 5LZ2A 4F3NA 3PRJA