The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
74
|
sequence length |
217
|
structure length |
217
|
Chain Sequence |
MSLRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDNHIVEFEG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
X-ray crystal structure of a phosphoglycolate phosphatase from Aquifex aeolicus
rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Aquifex aeolicus
|
| molecule keywords |
Phosphoglycolate phosphatase
|
| total genus |
74
|
| structure length |
217
|
| sequence length |
217
|
| ec nomenclature |
ec
3.1.3.18: Phosphoglycolate phosphatase. |
| pdb deposition date | 2006-11-21 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | Putative phosphatase; domain 2 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | HAD superfamily/HAD-like |
