2NYVA

X-ray crystal structure of a phosphoglycolate phosphatase from aquifex aeolicus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
MSLRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDNHIVEFEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of a phosphoglycolate phosphatase from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords Phosphoglycolate phosphatase
total genus 74
structure length 217
sequence length 217
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2nyvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2nyvA01
1TA0A 5IT4A 2I6XA 2WF6A 5ALDA 3R9KA 5AK4A 5AW2A 1Z4MA 4YIHA 3E84A 1YJ5A 1ZOLA 4Y2YA 3WK7A 3UMGA 1VJ5A 4F71A 2JAWA 4UM7A 4RETA 5AIBA 3GYGA 3L0BA 1RLOA 1K1EA 3QU5A 2BDUA 1WZCA 2FPWA 4IFTA 2B1RA 4KYTA 1LVHA 1RQLA 3A1CA 3R09A 4XPZA 4HGQA 3QX7A 2HCFA 1SWVA 3N8GA 5AI4A 3U13A 2CFRA 3DAOA 3W5DA 4UMEA 1J8DA 3FPBA 4Y2UA 1QQ5A 4C4RA 2HX1A 2R8EA 5AW1A 3QU9A 3QYPA 5AW4A 4O8CA 4H1WA 1RLTA 3QGMA 3PDWA 3KOOA 4YH1A 4NWIA 1RRCA 2I7DA 5AKLA 2B8EA 3M1YA 5AW7A 1NNLA 2IYEA 4FE3A 2IOFA 2AMYA 1IWOA 3OCVA 2C8LA 1Z4IA 5ALXA 4UASA 5AVWA 5AI6A 3N07A 3U7FB 1YMQA 2OA0A 5AIAA 3WKDA 4BYGA 2MU2A 2ZBDA 3MMZA 3MPOA 3P96A 2EARA 2OM6A 3AR9A 1RC8A 2JAOA 1U02A 2VKQA 3AR8A 5ALHA 5AM4A 4UMDA 4Y2PA 4UM5A 2B0CA 3DNPA 3WGVA 2FPSA 3OCUA 2IOFK 3ZW7A 1Z4OA 2W11A 5AKZA 2YMMA 5AKGA 4KX3A 4ZEVA 4UAUA 4Y2SA 5AK3A 3ZWDA 4BBJA 3L5KA 2BDEA 5AW8A 4QJBA 3KD3A 2HEGA 2B1QA 3ZI4A 2W4MA 3A1DA 1KYTA 5AI0A 3I6BA 2GO7A 5ALTA 3B8EA 2BY4A 2D2VA 2YFYA 4CF5A 5AKIA 3WK6A 5ALVA 5IT0A 3SKYA 1QH9A 3ET4A 3ZVMA 1YDFA 3WKEA 4NAVA 5AM5A 4MWOA 2ZBFA 1AQ6A 1J97A 4KNWA 1Q91A 2HSZA 5AI9A 4DW8A 4BX0A 5AKYA 3CNHA 1L6RA 4Y2VA 3EF1A 3ZX5A 2JARA 1RMTA 5IS2A 1Z4QA 1U2TA 3RFUA 4FYPA 1Z4KA 3NANA 3U19A 3J7TA 3I1YA 1QQ7A 1JUDA 1VJRA 2JAUA 2FPRA 3ZU6A 3NASA 2AUTA 3PGLA 3DDHA 3NUQA 2NYVA 2B82A 2C8KA 3AR7A 4BNDB 3WKBA 2EATA 2RAVA 4I9GA 2RBKA 1T5TA 4XOUA 1L8LA 1Z4NA 5ALUA 4YGYA 1XPJA 1ZRMA 4G9BA 4NFLA 2FDRA 3WK5A 1SU4A 2YY6A 1TJ4A 1Z5GA 1XVIA 2ZBEA 3SD7A 4YCNA 2G80A 3L1UA 4DCCA 5A3SA 4UW9A 1RKQA 4JDPA 4RESA 1MH9A 2B8JA 4KNVA 4HYTA 5JJBA 4PNHA 3VAYA 5AVRA 4AS2A 5ALSA 3FGOA 4BEWA 2HHLA 2C4NA 1RDFA 5ALMA 1YS9A 2G07A 2GHTA 2FUEA 2O2XA 2P9JA 3SF0A 3L0YA 3SKXA 4EZEA 2WF5A 3OCZA 4OHFA 3ZWKA 4F72A 5ALJA 5AW6A 5AK5A 4HGPA 4NV0A 4Y2QA 4BX2A 5AVVA 2IOHA 2G1AA 3ZTYA 3KDPA 4BKMA 4HGRA 2HO4A 2WM8A 2CFSA 4HGNA 5AKJA 2I33A 1XP5A 5AVZA 2WHEA 3QU4A 5AM0A 1N9KA 1SWWA 5ALGA 1WVIA 2IA5A 3OCXA 1ZD3A 5ALWA 1NRWA 2O9JA 2YJ5A 1Z4LA 4HGOA 2PKEA 5ALOA 3U26A 3WGUA 3L8FA 4ZEWA 2HF2A 4CF4A 5AW5A 1CQZA 2HF7A 2YJ6A 2Q4TA 4UU1A 2FPUA 1EK1A 2ZOSA 3WKCA 4ZEXA 2I55A 3RF6A 3L8GA 3AR4A 1TE2A 3UMBA 1RKVA 3KC2A 4BEVA 3WK4A 5ALRA 1S8OA 5AI8A 5ALYA 1Z4PX 2Q4RA 3K1ZA 1O03A 1YNSA 4OD0A 4CF3A 1PW5A 2G0AA 1TJ3A 4UMFA 3S6JA 2B30A 3BA6A 4NABA 2WF9A 3EWIA 1Z4JA 5T41A 3HYCA 5ALKA 4GIBA 4JB3A 2PR7A 2HDOA 3M9LA 3N28A 3HLTA 3EPRA 2R8XA 3ED5A 5AI5A 1F5SA 3R4CA 3L0CA 3ZX4A 3FPSA 1CR6A 2YBDA 5AVQA 1O08A 4OFZA 4Y2RA 2P11A 3ZVLA 3SLRA 1EK2A 2FEAA 3L8HA 3QUQA 3FZQA 4C4SA 1Y8AA 1RMQA 3CZ4A 2Q5EA 5ALEA 3WK8A 3N1UA 5AW3A 2W43A 3W5AA 4I9FA 1U7PA 4YCMA 3PGVA 3B9BA 1T9ZA 2OYCA 3ONNA 2AH5A 2WFAA 1NF2A 1VFPA 4L6CA 5ALLA 2QLTA 4QQFA 5FP0A 2NO4A 2ZXEA 2WF8A 4EEKA 5ALZA 3A3YA 4L6AA 3L1VA 2NO5A 3DV9A 5AVXA 3QU7A 3A1EA 3BWVA 5AKEA 3IB6A 2YMQA 5AVYA 1L7MA 3KBBA 3E58A 2ZBGA 3PCTA 3ESRA 5ALPA 1ZD4A 3UMCA 4HAIA 3NIWA 5E0OA 5AW0A 3U7GA 4UATA 3L7YA 4UMVA 3IJ5A 1ZRNA 2YN4A 2GFHA 2PQ0A 4OCZA 3ZUPA 4C4TA 2JGAA 5ALQA 4Y2JA 1QYIA 4IG4A 4Y3UA 3ET5A 3ZTWA 1LTQA 3I28A 4GXTA 5AW9A 4J03A 1S2OA 3QU2A 5ALIA 5AK6A 4DFDA 3TLMA 3FVVA 1FEZA 4XQ0A 1Z88A 3MC1A 2P27A 3KZXA 1ZD5A 1QQ6A 2DQSA 5AVUA 5AKKA 4Y2XA 2RARA 5AHXA 1RMYA 3U7HB 2C88A 3NALA 5ALFA 1L7PA 3OCWA 5A3RA 1N8NA 1ZS9A 2I34A 4KX5A 3OCYA 2YMLA 3QXGA 1WPGA 3D6JA 4UU0A 2CFTA 3F9RA 2GMWA 2C9MA 3QNMA 5A3QA 4CNQA 5AICA 1WR8A 1L7OA 4YCLA 3OTQA 1Q92A 1RKUA 2X4DA 3ZVNA 1RQNA 3SHQA 2ODAA 2R8ZA 1X42A 4L57A 3WK9A 3AR3A 3NAMA 3QUCA 1ZD2P 2YJ4A 3E8MA 4AP9A 1L7NA 4EX6A 1TJ5A 2I54A 4BNDA 4J2TA 4UARA 4EELA 4BX3A 2YJ3A 5AM2A 1T5SA 4MUMA 2AGVA 3W5CA 4EX7A 3OPXA 5AM3A 2R8YA 5AVSA 4CE6A 2GHQA 3SMVA 2YMPA 4AS3A 2MSNA 5AKHA 2FUCA 3N5KA 2QYHA 3W5BA 1U2SA 4KN8A 4EENA 4B6JA 4YIKA 2HI0A 3AR5A 2P69A 1L8OA 3FM9A 3NRJA 3QUBA 1RPZA 1YV9A 4E88A 4FFDA 3AR2A 2ZG6A 5AESA 5AM1A 5ALNA 4UAVA 2EAUA 3B9RA 5AKXA 2G06A 3ESQA 1ZJJA 3QUTA 3MN1A 3QLEA 2FI1A 2RB5A 5AVTA 3L8EA 1U7OA 3I76A 3UM9A 4G63A 4Y2TA 3EF0A 2MU1A 3E81A 2G08A 3AR6A 2WF7A 2CN1A 3U7EB 4DWOA 2OBBA 1Z5UA 3IRUA 2HOQA 3WKAA 4XE5A 1RLMA 2G09A 2FPXA
chains in the Genus database with same CATH superfamily
5KFQA 1H93A 3S8MA 3VNSA 3VO1A 3TINA 1BQEA 2CEKA 1KZ7B 4I9NA 3V8NA 3CH6A 4LDAA 4LOKA 1X74A 4GGOA 1U0EA 3KOXA 3MA0A 4JELA 3VJMA 3LD9A 4E33A 5JFOA 5DDYA 5EWJB 5JSZA 4A5OA 1EVQA 3F98A 3W4IA 3PF9A 1CZLA 1Y8RB 3JQCA 3LLMA 4UD2A 5KWIA 4F9FA 4OHUA 2O5EA 4FDUA 3TRFA 4NL4H 4DLGA 3OZTA 3SZ3A 2ZI4A 3LO5A 3PPIA 3BFXA 3EIUA 3THYA 4I2BA 1HDGO 2QT1A 1NC1A 2VQSA 3IUQA 3P9KA 4OSEA 3PW2A 1NR5A 2ODTX 1N0UA 2P5UA 2MSDB 4G67A 3QU5A 5JAUA 1LV7A 1UFQA 1WZCA 1YHYA 1G8PA 1IEQA 1U9IC 4A8EA 2QVBA 4AQYB 1FYDA 4ZCIA 4PLYA 1T0JB 5HR5A 3WGHA 1KOJA 1ZQFA 4B8WA 4D0SA 5KNCA 3DLIA 4ENTA 2HZBA 1Q1BA 5GINE 4JBGA 2QG6A 4QE3A 4JI0B 1GZHB 1DO0A 2JIRA 3W3AD 2LKYA 4GWKA 3SDSA 3WGZA 2RD2A 3Q2KA 2CXRA 4H6PA 2IC5A 5D00A 5F12A 5KNCD 4HAXA 4Q9JA 3IOBA 1Q1AA 5FEUA 1GZVA 1MXHA 4YP7A 3VPFA 4B17A 4YFVA 5F23A 2F3NA 2R8EA 3WHIA 3NTUA 5EJ6A 2JFHA 4MWZA 3PGKA 1B8UA 4IXMA 1KP3A 5F3RA 4S35A 5L3RA 3LH5A 1DKPA 2KSOA 4UFNA 3UA3A 3M6KA 3WMGA 5J4YA 3F3KA 4NWIA 2FQ1A 2P2GA 1H0HA 3MJCA 3UJCA 2QTBA 4B9TA 4CCYA 2X6RA 1QYCA 3RIXA 1P5RA 1RU3A 2CVZA 2HHJA 3LWMA 3BK7A 1S8AA 1XZFA 4WRRA 5GOZA 3M70A 3RR7A 4TMYA 4YACA 4TOIA 4V38A 4ECVA 2QL6A 2H1FA 4O1IA 1PCXA 3RGWS 3FZEA 4BNYA 4IILA 5JSQA 4Z3OA 5E6SB 2QAGA 3VR4H 4FWIB 4DCGA 2WK1A 2AC4A 9ICUA 4O5CA 3CX6A 4DCTA 4TVKA 3OSZA 5EVCA 2QYTA 2ZBDA 3TL6A 3MPOA 4I1IA 2ASDA 3CU5A 4C30A 2XT9A 1WQ4A 2IXDA 4UHEA 4K9LA 4IY1A 1W581 2HNKA 4P34A 5KFYA 3MFQA 1BQ3A 2QY6A 3T99A 4CT5A 5HIAA 4YJFA 3ADBA 3OQHA 3BC1A 3HMKA 1SC9A 2Q1UA 3CKKA 4L4RA 5DM1A 3UV7A 4LGVA 4ENSA 3Q10A 4Y2PA 2YNMA 2JL1A 1JDZA 2WWGA 3DBHA 3VKWA 3ZBUA 4NAUA 5DG8A 3EQ6A 3RS9A 1P4SA 2A0XA 3L7BA 4I81A 1QDUA 2BCVA 4NKRA 4RF4A 1ULZA 4DV3B 2PA3A 5BOSB 2YYZA 3ES9A 2WPDD 1VPDA 2GHIA 9ICRA 1Z4OA 2P8JA 3HXPA 2H85A 1QVRA 4TWIA 4Y2HA 1RE0A 5EZ6B 3RW9A 3TSAA 2GZ3A 3A2KA 1CVLA 2WIJA 2A78A 3CLTC 3JQAA 4DEVA 4ER5A 3VNBA 4YXWD 3FKSA 5BSUA 3M3DA 5HOEA 1U0GA 2H57A 4GWGA 4D8YA 1RXWA 4NEGA 5DBBA 1PFYA 1GKLA 2W4MA 4QUJA 1UFVA 3K0AB 3PGA1 4RW0A 4DKXA 1XLUA 1AMUA 1JJAA 1JMVA 3DB1A 4LRWA 3B8EA 4P4SA 4W1RA 4P5DA 3TOZA 2DQNB 4PYRA 4L0QA 4B3TB 1ZGAA 4RZHA 3AY3A 5LYJA 2IHJA 4FFBB 5AOVA 1MRSA 3HKZF 3RAXA 4EKYA 5GM1A 2X0EA 4JQCA 2P41A 4ES6A 2IYZA 3ITDA 3JX9A 5GY7A 4KEAA 1E66A 2CNDA 3FOAA 1I7QB 4RQ6A 4KQFA 5IKOA 2F3UA 2ZRKA 3U1TA 4DQUA 3RTGA 4AY2A 2ZCVA 4RY9A 5AI9A 1BS9A 1LQUA 1R0ZA 1Z38A 2HUPA 5AKYA 4UDXX 1BHO1 4FLFA 4U8HA 2QTNA 1HUZA 2O3SA 2RGAA 2WFMA 5JVDF 2WMOB 3IAS6 5EXTA 3BWDD 2ATIA 3RT1A 1JPNA 1OXUA 3U4AA 4QU8A 1F3OA 3P2MA 2WTFA 1KY2A 4RSGA 3UICA 3NRWA 1JUDA 2ZSIA 3PDJA 3MGGA 1SCIA 2Z2KA 4K8OA 2PVPA 4WXEA 5EXSA 1ISFA 4IKEA 3SM9A 2UXBB 3JAMA 3FMFA 3LPNA 2C5SA 2B8NA 3D6UA 4RFSA 2QB1A 5E7IA 5KYWB 3W1VA 5J0SA 3UMFA 1CNMA 2Q1SA 2ZYDA 5KSZA 5LDDC 2X41A 3P71T 3AEVA 2XC9A 4QUEA 3W5JA 4QEKA 3BILA 4UBMA 3K32A 1L2TA 2F48A 2VZEA 2ZJ7A 5DNYB 3ZWAA 4AF8A 4DG9A 3LVBA 4HWTA 1TJYA 2UYQA 3LYUA 3RSFA 1KH1A 1EB9A 2W98A 2BZSA 4HD8A 2PKQP 4F3RA 5DQIA 1QP8A 2W7PA 221PA 3BZUA 3LPAA 2W00A 4IFEA 5LIPA 1Y7LA 3WIBA 2CXSA 4Q3LA 2ZBEA 4QZBA 2O1EA 4WCVA 4Y18A 1IC6A 1W0KA 5A3SA 2BFFA 2HBLA 3COWA 1J70A 1M34E 4YJKA 3T5MA 1ULTA 1XZPA 4HYTA 1XVLA 3AHFA 3K35A 4EL0A 3ROQA 4HB4A 4WLFA 1PSZA 2QQ5A 4N7BA 3OZWA 3NR2A 4C4AA 1GGEA 5EHGA 1TAHA 2PCLA 1HRKA 3PU6A 4ZARA 4BEWA 5FBQB 1W5TA 3NEYA 1K3FA 3JV7A 1U1EA 1ARZA 3OM1A 4C6SA 4YXFA 3KX2A 1EMDA 3MJSA 2IX9A 2FRDC 1VRWA 3CWQA 2WA2A 2Z6UA 4R01A 1NXXA 4RGQA 2VF5X 2JI7A 1QB8A 3WRWA 1L3UA 2PBZA 5TPWB 1GWNA 1JIJA 4Q9NA 2OHGA 2TECE 1BA3A 3N7SC 2YIJA 3TZHA 3WRYA 1RD4A 4AN0A 3HC7A 1DL5A 3T4XA 3D2QA 1PNRA 3AFNA 5FH9A 3E23A 2A9JA 3DL2A 3KDPA 3R75A 2ZBQA 3F5DA 1PJRA 3DH0A 4BKMA 1L9XA 1YS2X 2HO4A 1RXUA 4EO9A 3E22B 3WLTA 3KU4A 4P36A 4GVXA 5DASA 2ZXUA 3VV3A 3ZDAA 2FWMX 3PSPA 3ELUA 4IIDA 4CL8A 4EUKA 3MUNA 4Y9UA 3E9RA 3JATA 4NZOA 4P22A 1TA4A 2D54A 1JXAA 2E5FA 2VOJA 3AXTA 3DGEC 1N36B 4DQRA 1ZX1A 3TZCA 1VJ1A 4BAGA 1H38A 2F2AB 1ACMA 1IN8A 4ZEWA 1N1DA 1PV1A 2IBMA 2O1WA 3KZVA 3NM4A 3QE2A 4AUEA 5KVVA 3CUTA 1W5FA 4OLBA 1Y8RA 5F35A 4E1BA 5JQWA 1A97A 2WIFA 1W8DA 1DAFA 3VR5H 5CT5A 4ZRNA 4ZDWA 1XYVA 5LDGA 4IL6U 2FW6A 2GKGA 5KTPA 3PHHA 1JDTA 5TQ0A 1TVKA 2XMZA 3L8GA 5FL7A 2JCSA 3IIIA 4GDMA 3SFTA 1E2DA 3QEBZ 2D3DA 2ASJA 1FVXA 1N7GA 4OO1J 1JDVA 1YT5A 2JFGA 3C8HA 2IV3A 2FUKA 5DB7A 3RJJA 3FCXA 3PVSA 4IZIA 3TOXA 1JLKA 5JJLA 2ZI7A 1MV5A 3PX2A 4PIPA 4B6RA 4YV7A 3JQ7A 4G4JA 4PYQA 1NUPA 2J3JA 2XZOA 3FZNA 2BUBA 3JVDA 3SYKA 2IUFA 4Q3EA 3ILVA 4MW9A 1XU7A 2EDUA 3DWEX 3IESA 1VSVA 4P35A 3JQ8B 2G0AA 1Y8QB 3LA8A 4UBLA 3JR3A 1RIIA 2ZTEA 4LKRA 1V3TA 2GBLA 4BGDA 1E6EA 4DSUA 2QJRA 4Y6GB 1E9RA 3MS4A 1G21E 4QTUB 3D4NA 3HYCA 1DRGA 4QX6A 4QOFA 5IJ9A 3NT2A 4GIBA 4X00A 4OHXA 4RH0A 5JISA 2WUFA 1VIVA 3GV7B 1L4KA 4CKXA 4QG3A 5I4IA 1P1KA 2BBSA 3IUEA 1JEQA 2ESRA 1NJ2A 3AM1A 3WJ2A 2ZI3A 3AG5A 4ESOA 2FGKA 5DHTA 3LDHA 2CJYA 1N2XA 3AJDA 7ICSA 3HO8A 1L4MA 3C3XA 5AWFC 4PHEA 4UAYA 5TQJA 1QS0A 4MJ7A 4WZ6A 4DUGA 4HMPA 4XDGA 2QA5A 3I4LA 3PG5A 1TCUA 1XTTA 1ZL0A 3F6CA 1AUXA 5F52A 2H1WA 4XQ8A 3EW7A 2CNBA 4V2IA 1FVOA 3P9IA 4PPQA 2B1JA 5CIYA 1FZQA 3ID6C 3VU3A 1EUQA 4XQCA 1Z8FA 4V0LA 1OI3A 3ABOB 4EFKA 1CR2A 2JAPA 4D97A 2BMEA 3IGFA 4FBLA 4OBEA 5CDFA 5BUQA 4MO2A 1P44A 4US0R 2W2KB 4BPRA 3SZMA 4ITRC 5EQTA 3OLCX 4CGYA 2YRFA 2W43A 2W9XA 3B6KA 4KMOA 4M8SA 5TPZA 3M82A 1DWQA 1FP2A 4QYIA 1IZYA 4DT1B 1SO8A 1Y3BE 1HM5A 3PNKA 4YRTA 4CKCA 3AOEC 5JCXA 3D2AA 3GB9A 4KVFA 4QXRA 4BP8A 3PMNA 4MWGA 3QF4B 1GLNA 2ISSD 2OM2A 3FIUA 3TW6A 1M2FA 2ONYA 2ORED 1QH8B 3FXAA 4R5HA 4QZEA 3SXPA 5DOVA 2DUWA 4QQFA 1R0RE 3SICE 1TFRA 1F6DA 2P67A 4DXHA 4UBCA 5BNTA 5IN5A 2JZBA 1IJBA 4J90A 3LVQE 4UB4A 4CEJA 4HVCA 3OIVA 3GGDA 4BVBA 1LDBA 1EA5A 3IJEB 5T5QA 3DV9A 4A23A 1TOAA 2FWAA 5LR6A 5IBRA 1YZTA 4ZU3A 3WGLA 2CE7A 3LHFA 2UVQA 5LQKA 2H2WA 5KTSA 5C7LO 4JOBA 3W1WA 4E5YA 4MEJA 3M5PA 4NG5A 2DL0A 1RAAA 3O7WA 4MKGA 2OHJA 4HRYA 4JVOA 4W5OA 1KI4A 4LF8B 4UMVA 4ZQCB 1Z5PA 3IUBA 1T1JA 4GRDA 4M9SA 1JIKA 3B51X 1S4QA 3N0TA 3I9OA 1KRPA 4V0ME 4QVKA 6ABPA 1JFSA 3I6QA 4RELA 1GQFA 2VWPA 4PZCA 5J2AA 3AONB 1XHEA 4E2XA 2XJ9A 4G5QA 1T0UA 3QU2A 1M2HA 4Y2GA 1KE1A 1JFRA 1B1AA 1J39A 1UHUA 3GROA 1EFCA 3M49A 4ARBA 1YZ7A 1XD8A 3FSGD 3IKTA 5IC5A 3VSAA 3G6XA 2A6PA 1GZ3A 5DX0A 4IZHA 4MS1B 1ETHA 3H6HA 4YRJA 4FN4A 1CZNA 2P9HA 2BBWA 3EDCA 4K03A 2XTAA 3ZHXA 1CUUA 4O33A 3RBDA 3CR8A 1O94A 5DEOA 1GPAA 4ASUD 3U1BA 3W0LB 3YASA 2Y1JA 3FHJA 3PXUA 3KD2A 3N8NA 4XVCA 3ACDA 5JRJA 1DX6A 1CEYA 1A8IA 1YZ3A 5A4IS 4IICA 4KX5A 4KRXA 3PIRA 4O4LB 4QUDA 2ZT7A 1GG2A 4IOMA 3VR0A 4KUHA 5LP6C 4BWFB 1Q0UA 3E1GA 4EYHB 1V8BA 3PDHA 3PQ2A 1NTRA 1ZPDA 5ECDA 5SY4A 5AXBA 5IEBA 1S10A 3OC6A 1WR8A 1KBZA 2XMSA 4XGRA 1EXNA 4DJTA 4W5QA 1YU9A 3LHDA 4KIJA 3VHRA 2OAGA 3ZW8A 3AKZA 3BK1A 3D4LA 3I92A 4E2FA 3PKJA 2BCGY 2GZSA 4Z54A 4KLOA 5CNJA 1JEJA 3WK9A 3KTAA 3OPYB 4YTEA 1IUNA 1QCDA 3E9YA 3QUCA 3IR5A 3KYCA 4Z6KA 4KBGA 4K9MA 1DQRA 3JWEA 2G3YA 1MHPA 2HWWA 2QD1A 3ABSB 4KE8A 3VOSA 3WQRA 2H3HA 4Z9BA 3TDNA 1GFSA 5J63A 1Y5LA 2MYUA 4YQFA 1NAIA 2HMWA 2UZIR 5CYPA 1JX6A 3N86A 4TMWA 2JS7A 2VF8A 3C3WA 4LHZA 4R69A 4WL0A 4R71A 2Z98A 3I2KA 3SQIA 3JPYA 3JQ6A 1TW2A 5HZGA 3TL2A 1W36D 4EELA 2KIWA 4X93A 4FWTA 5AM2A 3W5CA 4N01A 4NLBA 4J9PA 3C14C 1QV7A 4QSHA 1RBQA 4TL9A 1IK6A 3UB4A 4BNIA 4EJFA 4NPCA 5HGXA 1PG0A 4IXDA 2DWQA 5HHHA 4GR4A 2AE2A 2D5LA 1B8VA 4I55B 4F2WA 2ORWA 1JI7A 1BVUA 1RWWA 2DWOA 3G5AA 3FAHA 3R3WA 2XWQA 5BMVA 3OE5A 1RWKA 2BHLA 1Z56C 2AN5A 3OFND 1NU6A 1XKQA 4QG7A 2G6TA 2B7BA 4LZJA 3H97A 3CWZA 2PUTA 3EC1A 2PH3A 1F12A 3C87A 3GJRA 1MRNA 1ECCA 1W0JA 3F90A 4WESA 2IHTA 1RHUA 16PKA 3GH1A 2R4QA 4GQIA 4HO1X 3HGQA 3H8JA 4EA8A 3GLGE 4FUTA 4O4LF 3AZOA 4WADA 1XN1A 3KJIA 3SXUA 2HR1A 1E1NA 2C2RA 4E12A 3I39X 2RKOA 2XGJA 1Z07A 4H3SA 4CBVA 1Y9DA 4DE5A 3TQHA 3TMKA 2EAUA 1ZNZA 2J3IA 1XKTA 4YRIA 1IXSB 4NICA 4MWBA 4TXNA 4C4PA 2OV4A 1DADA 4WZBB 4XLLA 5C32A 3QUTA 3A32A 1SR8A 4IUDS 3A0RB 1UZAA 1O94C 1XR3A 5EWJA 1X2IA 2HW3A 1XRSB 1YB6A 1KPHA 5JH7B 2CFOA 5EJ2A 2FQXA 3MFYA 2A59A 2PX0A 3ABQB 2VJQA 2D0IA 1JPJA 3JU3A 1TZJA 2XVXA 2G08A 3AUKA 1KKUA 5FNVA 5CDHA 4UJ5A 1GYRA 2QTMA 1K2WA 3OLVA 4IWNA 2O2CA 1T8SA 2WJ6A 3AKCA 1F7UA 1BCRA 4KLRA 2R6DA 3AT1A 4YREA 3LZCA 4B45A 5KG2A 1NONA 2V3VA 2WPDA 4D8UA 2ATCA 2XDAA 3EZ7A 3ZGOA 4EGFA 1SUFA 1YUBA 2QIOA 3KQNA 1RLMA 5IAGA 1TA0A 1UOQA 4FEGA 2I2DA 5CXUA 1MHTA 1NLFA 1SCQA 3F6PA 3X1JA 1HURA 1UDRA 4HB0A 1QYRA 1SAYA 5J0OA 3UAYA 5M7EA 2A0FA 1C14A 3ZKWA 3SDBA 3W7VA 1OT5A 1MENA 1UZLA 2Q3JA 4PHDA 1JEAA 1YU6A 5FRDA 5IM5A 3H0LB 5LU9A 4EYSA 4US9A 1RYZA 3GLFB 4X64B 2ZIUA 4Y2YA 1EEHA 4B3GA 3VR2D 1BX3A 3OMWA 2YYSA 3EAGA 5LA6B 5HG0A 1ZW6A 5BN3A 2YWJA 5DNDA 3IIJA 3O83A 2XT6A 3ZQJA 1O57A 1KQOA 1ECJA 4UM7A 1M1YB 1WHSA 1WUYA 3BRQA 3H2KA 1IOVA 2ZYIA 4KPUB 1K1EA 1BE0A 2P9TA 2J6UA 3K1JA 3L8CA 5FNVB 5CLJA 4HWSA 4Y9TA 2JCGA 3OHPA 2H17A 2H1IA 1VMEA 2PH5A 2WHRA 4LBZA 4WESB 3T3FA 1Z25A 2N0SA 1ADFA 3AF2A 2WOJA 1P7VA 3MJEA 4G23A 4UHHA 4XQGA 4HT3B 4TKMA 3ST7A 1FF9A 2CFRA 5IDXA 1T3HA 4ACOA 1LI5A 3K1AA 1TAQA 3QY9A 2OTCA 4KHZA 4B33A 4OJOA 2XIDA 1ZQRA 3DXXA 4LJKA 2PSHA 3VMMA 1KWGA 1I33A 3MBKA 2HHWA 1OV6A 1MIOA 3D6HA 2B2CA 5B1SA 2IUEA 4FCWA 4H7IA 3JYQA 3P19A 4M0FA 4R1TA 4DIUA 1UPFA 4K0KB 4A26A 1GPDG 2XUDA 1VCMA 1N6NA 3LX8A 3WL5A 4DPLA 5C5EA 2WTXA 5LNK1 3S7TA 1ZUHA 1N2BA 2B4KA 2C4MA 3DV0A 2ZIXA 4WTOA 4B75A 3LQYA 5KAIU 1M34B 4C2BA 2QQGA 4OB7A 3H6KA 3JVUA 4E3ZA 4F4CA 5I4KA 3NHYA 4PXSA 4LYAA 1BJTA 1Y63A 1DJQA 1HT1E 2VHQA 3DZHA 2J67A 3PUHA 3ZWQA 1PT5A 1T9KA 2GWHA 2AYXA 4JQSA 4I27A 3CUUA 3Q40A 3W3AH 4B7CA 5LMNB 4YRFA 1MX3A 2P6PA 1ZMOA 1QAQA 2XDQB 4QBHA 1L5LA 4E5UA 2BKEA 1LSUA 4TV9A 1ECBA 3AVWA 3O90A 3F74A 1Z68A 5L3QA 3VFDA 1HL7A 3EY9A 1AGPA 4EYEA 4FR5A 3S5JA 1JMSA 2J9GA 9ICNA 1BS2A 2A5FA 2I6FA 2OXOA 3LV8A 4I2GA 1C9JA 5D5HA 4FFOA 3S99A 1ZICA 1NOMA 3UXMA 3FTEA 1EHIA 4NV3A 1E1KA 1IE3A 1U02A 2Z1NA 5J2JA 3AHIA 1D8YA 3NYQA 1A72A 2DM6A 2XNKA 2XYVA 3O1LA 2IU3A 3OOWA 2HMUA 4LGMA 4QGAA 1Z29A 4MW7A 3MLAA 3HX0A 1FMLA 1ZNYA 3D3KA 3LC7O 1PJ3A 4N3CA 1G5QA 2CKDA 4FE4A 3FJYA 5EERA 3SZUA 3K72B 5FPTA 3DNPA 4D9MA 2FFQA 2H7VA 3GN2A 4GI3A 5KSPA 1OD6A 1G8AA 3BX1A 1W2GA 5TEWA 4CLRA 1A8SA 2AJCA 2ZWMA 4IQ8A 4PTZA 4DXAA 2QX6A 4ZV4A 3EVZA 3UK7A 4UAUA 2GM5A 2R1UA 3W05A 4JI7B 3FH0A 2QS9A 5ULLA 4IXNA 3TTXA 1SXJB 4JL6A 1RBMA 1IK4A 3CONA 5E1DA 3WL4A 3EJ6A 2BM0A 4NMXB 5HRUA 5WRFA 2Y2UA 3I2HA 4GOND 3BCUA 1PDWA 3WLQA 4F56A 1Y89A 2A9FA 2UUOA 2E82A 1U2DC 4G4IA 4WLVA 4YT4A 1DT3A 1EBUA 1U8AA 2E2WA 3PFBA 1S77D 3SMQA 4O4LA 3N6XA 3WK6A 1TEVA 1USIA 1AUOA 2W71A 3EPGA 1JYFA 3OICA 2L69A 4PYMA 2O06A 4JLOA 1T36B 3EW9A 3FYHA 2UVWA 3F7MA 3N75A 1VKZA 3QJYA 4NAVA 4Q93A 4I8DA 4O3FA 3HKCB 4E08A 1R6XA 3TFWA 4QO8A 3IDAA 4MGEA 3ZYZA 3TAHA 2G67A 2PMBA 3MTIA 5DU2A 3TRJA 4QVIA 1P60A 1ZHFA 3ZX5A 4Y2VA 1NHGA 2QPLA 4IHJA 3N2YA 4V0SA 3IMEA 1UBTS 2E1EA 1DO8A 1PJQA 4R1NA 1B4FA 2CYCA 2VSYA 2IIVA 1RYUA 4KR9A 5KTTA 2YHAA 2F17A 3Q8SB 2X1VA 3PUZA 4OK3A 2PV0A 3WG9A 4FZ5A 1U2QA 2D0PB 2F4NA 4EI8A 4OYYA 3EGIA 4B4UA 1U7XA 3UT5B 1HDEA 2ZQZA 3WMWA 4QPJC 2PFKA 2QRVA 2DKOA 3GDXA 4AP5A 3SVTA 1PYOA 1S2GA 3Q8RB 3B38A 3J80A 2A14A 2FEOA 2FSUA 2Z56A 1FSZA 2B34A 2YB1A 1FFHA 3KAKA 1JAXA 3PJDA 4KAFA 2AK2A 3A9RA 3PD1A 4BKUA 4C5BA 1OH8A 1ZAYA 3PNMA 5D7NA 4U2FA 4BLQA 7ICNA 3LKBA 5KZMB 3K05A 3PL5A 3WK5A 4IEEA 4H1TA 3KKZA 4IPTA 5L7WA 1HG0A 1RABA 4K87A 2D4HA 4U02A 1MN8A 1CKEA 1TJ4A 2O2HA 1E3WB 3DT6A 3QFFA 3R3XA 3WRXA 4NENA 1YI1A 1WBDA 4ODIA 3PVXA 3OFKA 5DN6D 1BQ4A 2BEVB 1OYOA 1QUFA 3GJ3A 3PFWO 1OQAA 1C8LA 1E18A 3NV9A 5H59A 4AICA 4CLRB 2YKGA 4O2AF 3O3CA 4A8JB 1EG7A 1K98A 2H4JA 4OFXA 1COKA 2PXCA 3VJLA 4U0JA 3B82A 3FVTA 1HKHA 2W90A 3R7BA 3X2EA 5EUQB 2VUSA 3MMSA 1XZIA 3UH0A 5KREA 2PSFA 4EB0A 1ZGHA 2ATVA 3GLGB 3T5BA 3IMKA 3L07A 3KL4A 3SF0A 3SKXA 3FUTA 4LV6A 3PR1A 5AK5A 2X8BA 3EVEA 2P8SA 1CRZA 4OLFA 2JJYA 1UC8A 3KHLA 3B20A 3BKWA 3IXLA 1UWLA 3NGMA 4OB8A 4XX1A 3UN1A 1NJYA 1S2NA 4G0QA 4KDRA 1VBMA 3M81A 3PW4A 3WGQA 4HDMA 3BG5A 3E5MA 5U1PA 1KNXA 3O38A 5J0QA 4JITA 2J0UB 1U5BA 5DB9A 1J06A 1P1RA 3PNPA 1KC3A 1QHHA 2AW5A 4MAAA 3VTKA 1QP7A 3RLFA 1WVIA 1GG5A 3LIPA 4NLNA 5BXYA 1N6RA 1PVOA 3CW8X 5EXPA 3VYRB 2IX3A 3L0DA 5JWRA 1LPAB 5A7FA 2A2ZA 2YWXA 2ZUUA 4DIKA 2BDTA 1IBKB 2EBHX 2WD7B 2WTNA 3DOEA 4Y6PA 1R4MA 5DI9A 5EMLA 5T3YA 3ZBQA 4YA6A 4D3YA 1QIHA 4DLKA 3T3OA 1VL2A 4CF4A 2RGYA 2H3VA 4HNAB 4G84A 3SC3A 1Q84A 1XDUA 2YJ6A 4GI1A 2GJ4A 4TKUA 2BKXA 5G4KA 1G9TA 4TL6A 4UU1A 2FFJA 4LBVA 2NPFA 3PNCA 3SYTA 2AZMA 2EXXA 2PRYA 1LU9A 1H8ED 5LCXA 4L85A 2EWWA 4Q9KA 5A7GA 4K6CA 1N6HA 4FT4A 4E46A 4XVUA 3C5WP 5BRNA 2J6TA 1YAJA 1L5FA 2YJGA 3KC2A 4IF4A 1GAEO 521PA 3SG0A 5CR9A 1U0BB 1HKUA 3R20A 2E9SA 2WIAA 5LXTB 4N47A 2C2DA 5IABA 1D0IA 3CIFA 2HV8A 1C8BA 1S3IA 1GA4A 1UOPA 2H7YA 2V58A 5F7XA 4KR3A 4CF3A 1VCOA 1E8NA 1KMHB 4R6XA 7ICHA 4BB0A 4NL9C 1JBQA 2HH9A 3IMCA 2GM4A 1C5KA 1SBIA 3GUVA 1N2SA 1GPWB 2W0SA 4K1LA 2BZ1A 2IP1A 3LUAA 2YB4A 4RPGA 1NVXQ 4NBSA 4EFLA 1M1UA 3EWIA 4RLQA 5DT2A 4Z0NA 1M10A 2C28A 2MYNA 3RROA 1QRTA 3PUYA 1H0KA 3QEKA 4PGYA 2O7RA 1PEDA 3R3JA 4FQ5A 5CU7A 1N5LA 1ZXIA 5DLFA 2NX2A 2WW8A 3PY8A 2PUEA 1S0UA 3B3AA 5E4FA 1AH2A 1T9CA 3C6MA 3ZX4A 4YS6A 3O8LA 3IP8A 4PGGA 1XE3A 4DG5A 3R76A 7MHTA 4LNAA 1YIAA 5ELMA 3TGPA 1RRGA 3N3AC 4B73A 4RPKA 4KLGA 1TLFA 4P0TA 5LB2A 2AMFA 1WW2A 2ON6A 4FSXA 3UK0A 4D3ZA 1GV0A 3I04A 1DEAA 2OP1A 2WVGA 4ZQGA 2BSAA 1WXQA 2WICA 4OMFG 2CHFA 3ER8A 2FUG1 3F78A 1I4EB 4EDHA 1M2KA 3DLCA 2FUNB 4TMKA 2W6JD 2HA7A 4C07A 4KP7A 2JK1A 2QRGA 3QXHA 2ZS9A 5KFRA 2OEPA 4R41A 2P9CA 4RHXA 5JFTA 5BSWA 2YS7A 2A4MA 1T25A 3CZ4A 3STTA 3HBMA 4WN3A 1OX5A 2VUIB 4WOKA 4FCVA 1GAWA 3NIFB 1UIMA 1Y7PA 2E48A 3KWFA 2BPCA 4IRKA 1IOLA 1JSXA 4J1SA 1YK0A 3TF5A 1T5HX 1IZ8A 4PZLA 4CRWB 4CXMA 3E9CA 2WYWA 4N6NA 3GFVA 4NZNA 1X1CA 4MVJI 1DUIA 5KYNA 2CHUA 3OETA 3V55A 3VHLB 5KFLA 3HUFA 4DLUA 3P4YA 4K9NA 4A4DA 2D1YA 4A0FA 2BPGA 1JR3D 1Q16A 3BRCA 3HG7A 1MJGM 2G7ZA 2NO9A 4ZK2A 2CZGA 2XQKA 3FKJA 3Q1LA 4ZO6A 3QKRA 2PH1A 5EIHA 2H5JA 1VLZA 2FWNA 4MRRA 4YP9A 1J9GA 2G28A 5CEHA 4UHCA 2YZNA 1BW9A 3CZPA 5KBYA 2NO4A 1DJLA 5E2AA 3B9PA 1F2VA 4BMPB 2PT7A 3MMPA 1D5CA 3NNDA 3DLAA 3OECA 3AB3A 4EPVA 4MUGA 5AVXA 3U60B 4PSUA 1U9IA 1Y1KE 1YRWA 1KEJA 2INGX 1JXMA 3P94A 1K6IA 2JAXA 4IDDA 4IDFA 3KBBA 5DM4A 4H4EA 4J0HA 4M88A 5ARBA 2OB2A 1P7WA 2W6MA 1DWPA 1L3CA 2F64A 1YS1X 1RYSA 2JJQA 3AMZA 3LXXA 1FSFA 5J0YA 4DIEA 3K0KA 4H17A 2EAMA 3CTPA 1KQPA 9ICXA 2DFPA 3ZCSA 4TTJA 8ICUA 1S8NA 2CNOA 2H5LA 4OHBA 1G41A 3LT4A 1Q1NA 4HH0A 2QVZX 2IQIA 4FNGA 4CMJA 4Y3UA 1VFNA 4I3FA 5TS3A 4IS2A 4LECA 3Q7RA 1F6BA 4AJ9A 3RU9A 1XQ6A 3R3VA 4H4DA 4RT2A 1LFDB 2RKBA 1C1DB 1AXRA 2YV3A 3ANMA 3IBSA 4I99A 1UWVA 4QPZA 4ZOCA 5KVQA 3GCXA 5EP4A 2WUWE 5BXQC 1G20E 3B7GA 4IYJA 3WNZA 1I6WA 2H3ZA 2CVQA 1BXRA 4MUEA 4C5CA 4GP9A 2H3IA 4XWAA 1S1MA 2QI9C 2PUGA 4J9KA 1JB1A 2WG2A 4JLKA 3TSOA 4C4OA 1CUEA 1LPNA 2A9KA 2VDWA 3HXTA 1X40A 3FHLA 4KWEA 2B83A 2AV6A 3V4FA 4JLNA 4Q1FA 4ZGBA 2RGCA 4TUYB 1A8HA 4JGIA 3VOBA 4TGLA 2NT4A 2VNJA 2YWGA 1XXHA 3FTQA 2AF3C 1BOOA 1N8NA 3L92A 4S0XA 5BR1A 1JVBA 5LYJB 2KB0A 3WFIA 1TIPA 1T1GA 3UW1A 3FPJA 1W6RA 2QTLA 4JYMA 4IIJB 5FFNA 3EZ9A 4CODB 3DAHA 2C0QA 4MRMA 3F5MA 1H5NA 1WY7A 3IOEA 3KFXA 3OVMA 3ORYA 3P4UA 3Q85A 4UEOA 4DOMA 1OBFO 5KC8A 3KJQA 4QQKA 1K8YB 4O6VA 4KQKA 1ZUWA 1AGRA 4TLLB 2X23A 3AM3A 4R8MA 1OWNA 1L1QA 4LRSB 3FRIA 1P29A 1TK0A 4C04A 1POXA 2YZGA 2ZIZA 2LCFA 3EIQA 3RJMA 1CY8A 1HYQA 1U81A 2QARA 1Z2NX 4RQ8A 1SCJA 1HTBA 4L4YA 4Q48A 3TADC 1FSSA 2GDJA 3B1FA 3GX1A 3ZZUA 1R4MB 2Y68A 2ZM5A 1PFUA 3DEYX 2PKWA 3EDYA 3D8RA 1FP6A 3H17A 5E8JA 1N60A 4UOZA 3RH0A 1R7RA 3PW5A 2FWIA 3VR4A 2Y1CA 1GXSB 1N2JA 3X2FA 3FI9A 1X7YB 4PX3A 3L4BA 3RRJA 5LIRA 3PA6A 1FFCA 5GGXA 1PFWA 1GGFA 2C0PA 6NULA 1UBEA 3BS5B 1ICEA 4DAOA 3AIMA 2DKNA 1I3LA 2RJNA 2WB1F 1FX0A 3BTSA 3HFGA 3KHUA 4H0NA 4O63O 3TX6A 4F11A 3JQPA 1YHZA 4IDEA 2R8YA 3EHDA 3F1LA 4PSDA 4CE6A 2NVOA 4EO7A 5FQNA 2LPMA 3QFHA 5HRCA 1IBLB 4JP3A 5JEEA 1YNOA 4DS5A 4OK5A 2K4PA 4V24A 1TM1E 5KG1A 1G2PA 1TMKA 1LLDA 5LBUA 4QT4A 1GN9A 5K8IA 2D2IA 2JD2A 1HF3A 2PQMA 1JW9B 2KICA 2I2AA 1NUHA 2NW6A 5FWDA 4QWMA 1KE2A 1R6UA 3A11A 1KDRA 3RVJA 2C31A 3WGMA 2ROQA 1MN6A 4NJOA 5DZSA 4ZCPA 4WUVA 2H2FA 2P9YA 3ZZTA 5LFAA 1GTG1 3RTVA 4GZMA 2AOXA 2GDZA 3LUFA 2FQWA 4KYUA 2BFEB 2C00A 4CEHB 2FKAA 4YAEA 3ZWMA 1V1MA 3CJQA 3D4PA 1CR0A 3SK0A 4LNUB 1YZ6A 3SSOA 3D3JA 4MUNA 4FS2A 1TZBA 3I9JA 2XUHA 1ZM4A 2ZK7A 1G291 3FUUA 1L3TA 4G86A 2ZE8A 4X6LA 3FMIA 4YYZA 3NDRA 2XYRA 2OD7A 4O29A 4DBVO 3V5NA 1H9AA 1USVA 3JQ7B 4RY8A 1ZHHA 2CNWD 3RRXA 5LD2C 1ADBA 4FMDF 5L4NA 2HT6A 1MB4A 1WCLA 3CMMA 4KE7A 1DZ3A 3U3RA 2AJ8A 2VBFA 1OLXB 1W4ZA 4BO7A 5TZVA 3D2SA 2I0FA 2IIPA 4KN6A 2QLFA 4DSOA 1W8IA 1I3OA 2EERA 1C7ZA 4EB6A 2BH2A 5B7QA 2V4RA 1NKSA 2W93A 2CMKA 1EG2A 1OXXK 3HNPA 5CYGA 3FMPB 3GIDA 4KQXA 3PX0A 1Y80A 5I7OA 3FD8A 1PS9A 2Z8ZA 3JD1A 2YINC 3A9UA 4N6GA 3L0PA 8ICEA 3LUBA 3UT5A 4BTVA 4UAWA 3AESA 3OZBA 3PXGA 4Z4IA 4OSPA 4YIHA 4JYCA 1AQYA 3FA2A 1ODSA 1WDTA 3UJHA 5KFCA 2WM9B 2YHUA 1X9MA 2WUEA 2DKXA 4QUHA 4UD6A 1KW4A 1E3SA 3A2MA 5CX1B 1DFIA 4IR7A 2FMQA 2F3TA 1QLWA 1KAGA 3H1TA 3MAGA 2DE0X 2QUIA 1QQTA 3RUAA 1VIYA 1Z6PA 4DWVA 5KWVA 1E3MA 3V00A 2W3RA 3DP7A 3UFBA 1M2NA 3ZD9A 3P20A 4C7MA 1WD7A 5HF5A 4MUBA 1YFKA 2HA6A 4IC9A 2WJZB 1A4UA 2FPWA 3PT5A 3S28A 5JYCA 2WM3A 2HB6A 1BXGA 2OENG 3UOAB 3PR5B 9ICOA 1QV6A 3CB2A 3R6LA 4CI0B 3KPWA 2EJWA 2XVYA 3HB7A 4ZCSA 3M9NB 5HS4A 3CP8A 1YC5A 2GEUA 2D5IA 4K6MA 1ZQAA 5DIFA 1YASA 1JB9A 1KSFX 2DY1A 1UBJS 1UXGA 2PMCA 4HTAA 4M9QA 1MB0A 1SD2A 4Y6RA 5KYYA 3D6VA 3DT9A 4A9AA 1QQ5A 3WWYA 3O95A 3VHXB 5DEIA 1VYVA 3CS3A 2I91A 1I7DA 1ZH4A 1R9NA 3QGMA 2B5WA 4IDHA 4TZ6A 3IP3A 3BD9A 2AQIA 3I4CA 3A4LA 4DTIA 3RV4A 3HA7A 3AHDA 3L7OA 4EBCA 1DLIA 2ZB3A 4X20A 4K4GA 4BZPA 2FPPA 1HEKA 1PDVA 4MZXA 4J9OA 1I24A 2KM1A 4AG3A 3DFKA 5J2UB 5CDGA 2ZZNA 4QXOA 3EWAA 2IU6A 3OCVA 1MOQA 4LJ4A 2D74A 1LDGA 3A9SA 3NTRA 1RQ2A 2VBGA 4D4LA 3IV9A 4PYOA 3L7NA 3LWZA 3M8KA 3Q88A 1QFSA 3AF3A 3R3HA 5K0ZA 1US8A 4D57A 3F4KA 1DUSA 1EBBA 2NTNA 3RS8A 1I2DA 1TM3E 1T4DA 4KUEA 3FPLA 2JMGA 1QHYA 3VZQA 3E35A 3E4CA 4CCYB 3I0NA 4UOQA 1SB8A 3HLYA 5EJFA 3NVYA 1XD9A 2YXNA 3FHOA 3NHZA 2FK8A 4Q1EA 2JKZA 4ZQHA 3UXPA 2R48A 4C88A 1P77A 1SCAA 4G2TA 1WVGA 5DISB 5GM2A 4RGYA 4YI3A 4F2GA 3ETGA 4EZBA 4HDAA 4BN0A 2EZ8A 1H6BA 9ICFA 3VKFA 1JG3A 3ZOZA 4I4TA 1ODTC 4JVLA 4D8VA 9ATCA 4G1FA 3BH0A 1L0BA 3LPMA 4L75A 4XSVA 3KEOA 4HBGA 2HD4A 1WZ2A 1D6SA 3ZWDA 1P4AA 2OG1A 3I6IA 2JIZA 4IVNA 3GVHA 3OE1A 2BSXA 5AW8A 2HEGA 4QHYA 3A1DA 2GBGA 1UA0A 1AOXA 3S40A 3GFOA 4U2CA 4JV5B 1XLWA 4ENPA 5KOJA 2RDIA 1SELA 3ZHRA 5AKIA 1X1SA 1U2EA 3R0ZA 2EGGA 4DOAA 1W76A 2ZT6A 1I4WA 3E0QA 3NOVA 4C3VA 3PDCA 1KBUA 3ET4A 3ZVMA 2IYXA 1E99A 1EFRD 4UAGA 2AD5A 4P0QB 1AHPA 1CEQA 1F9AA 3TRIA 1AQ6A 1AUVA 1QIEA 2Y1WA 4PHPA 3SBDA 2QQEA 2Z1DA 1MOPA 2FY8A 4DA7A 1A9OA 1L6RA 2IYVA 1JJFA 1N9GB 1F17A 1LDEA 1D1QA 3GP5A 1EINA 3N2GA 5L1LA 4G1CA 2O0JA 2JR5A 1KQ3A 2X5OA 1Z4KA 2IKSA 4FEAA 5B3KA 1HDIA 2AFIA 3KSZO 5FXMA 5A03A 2UYCA 5LQMA 5HHTA 1XZLA 5IG2A 4P54A 1DJNA 2YUIA 4RVFA 3IM1A 1JAZA 4LFCB 4MS1A 1ELOA 1TZ2A 3TJMA 3HA3A 5JWOA 1RXIA 2QW8A 3CEHA 5KNBA 4MIYA 3RFAA 3RYIA 2JAQA 2O3TA 1R0CA 4KXVA 5E7QA 2QGZA 3AR7A 1QSGA 1BA2A 121PA 2IY8A 2QN7A 4PSKA 5CBPA 2VT2A 3DSRA 5JNSA 3TZ6A 4AAYA 1DAEA 5KPDA 1V8ZA 2B1IA 1ACLA 1ZBQA 1X6JA 2W9CB 1LUAA 4DXDA 1FCJA 4KO2S 4P4SB 5J59A 3E8XA 4CIYA 3ZWOA 2AI2A 2KWIA 4XYBA 1LKYA 2FPIA 2D5CA 3W7BA 1MABA 4LWZA 4WKGA 2HKIA 1FQJA 1VE6A 1XRQA 2WKWA 3Q11A 1EFPA 1RYDA 1QF6A 2J0EA 3O1IC 4LY0A 3CINA 1UBCA 1S4MA 1TM4E 10MHA 1WNFA 1NNI1 3HVHA 4IGKA 1OFUX 2CL7X 4AJKA 1PD0A 3O5AA 4WJ3B 1LB2B 2G5IB 1AKMA 2PX4A 2W0MA 5JJBA 5H70A 1N2CA 1FFWA 4ND3A 3QVUA 1IV8A 3GJ5A 2OECA 1ECFA 1H0RA 1XA3A 4M0KA 4WEQA 5DWQA 3B6MA 3BHMA 5FO1A 3IKJA 4E3WA 2ODGA 1CNEA 1UOOA 4I2VA 3FTCA 4NDZA 4KFCA 4NCKA 1YS9A 2Z5LA 3OTGA 2FUEA 5H0IA 4O3RA 3CX3A 3LRTA 4G4GA 2WF5A 1CIJA 2I66A 1DPFA 2GBFA 5I7SA 4YN3A 1TYEB 1Z9BA 4EZIA 4LOAA 4MUJA 2F8TA 4XIFA 4BAUA 4D4HA 5BP7A 5CLHA 2KOBA 1BHQ1 3N2KB 3R0VA 4Y2QA 2J9FA 4YCBA 2V59A 4HJRA 3GUUA 3KZNA 1YWGO 5AVVA 3FSGA 1FL9A 3I23A 3VYSB 4DR6B 1OMOA 4N3GA 1XQYA 5AJTA 4A8JA 3NDPA 1AO3A 3PICA 5EPUA 3LWDA 3I1FA 2D5BA 1YS4A 4NY1A 1IJKA 1PYDA 3OJXA 5LKRA 4RQMA 5EAIA 3LAWA 5FAXA 1SWWA 4FONA 3DUFA 1KDZA 3DEIA 3KZCA 3L7DA 1KMMA 1HDZA 3G7UA 4XCQA 4DGQA 1KTIA 2P79A 1T3TA 4ZFNA 1LWNA 1NI4A 5CVDA 4OX9B 2W2MA 4UQOA 1NF8A 1Q7RA 3H86A 2C2MA 2G5GX 2ZRFA 1X70A 3ETCA 2GSWA 3LRXA 3OZ7A 2HXGA 4K88A 2HA0A 4O4IA 4RJKA 2QAIA 4B46A 1YRBA 1V8DA 3O2NA 8ICPA 3BJIC 2VYVD 2B3TA 2NAFA 4XD7D 3WJAA 1CZKA 3GHHA 2CCJA 4GPTA 3ZCUA 2ZOSA 4RKWA 4CZ2A 4YMUA 5I7AA 1G16A 1P9LA 5IARA 1G2OA 3FTFA 4AYBF 1W59A 5BN3B 1A9PA 1V7PC 3FDIA 5BUZA 1DJMA 2IGTA 1CV2A 1KKXA 2J85A 2OGWA 3RT9A 2CHVA 4IINA 1KVQA 4BNLA 1T91A 4Q47A 1GCAA 2PTGA 3W3AA 1KI8A 5DNAA 3V1KA 2REQA 3WJ7A 4BCBA 1A2BA 5JTTA 3DD1A 3HEMA 1GV1A 3EEFA 1MC5A 2DPXA 2H92A 2SKDA 3GH3A 3KVRA 4FI3C 4NJEA 4RQ1A 3CHYA 1AZSC 2VJAA 1LRLA 3CH5A 4ZT2A 4CFSA 3ROKA 5L6LB 1TUGA 1Z7GA 2QB0B 4ZO9A 1WHTA 4DLLA 1OBOA 4V0RA 2WF9A 3CZRA 3KB2A 2EEPA 3JQGA 4FR2A 4QNRA 4B40A 2B37A 4MV8A 3ELDA 1V7ZA 3MBYA 2AYYA 3BMOA 5HQJA 4BO1A 3QPUA 5J8YA 5IIMA 3BXGA 3KE8A 4PTLA 4D4GA 4W9MC 3BORA 7ICKA 2QMHA 3HLTA 4ARIA 3BGSA 3C2MA 1SBQA 1WUHS 5AI5A 3R5SA 5DTQA 2GEBA 2PL9A 2Q7DA 2NXEA 4IVQA 1J2NA 3OEHD 3CBQA 2RCYA 1O96B 3RJZA 4X3OA 1FUKA 1T9GR 1ZM9A 2VHEA 3T7IA 5BRJA 5JEDA 5IJ0B 3PFKA 4C7VA 3CF0A 4DYVA 2GS9A 2F8MA 2G4LA 4C89A 2N9UA 3W7AA 2JIMA 2KJ8A 1KMHA 3EG5A 4L27A 4QZIA 1DQYA 4JUZA 1DIGA 2FLVA 1NVDA 4YR0A 1CF9A 1PS0A 3MM4A 3RAEC 3HT3A 4N49A 2IYWA 2FEAA 4F6CA 1VSUA 1HZZC 2ZJFA 5KFJA 5COBA 2PRZA 5EUCA 3VVMA 3FZQA 4YGXB 4U39A 3LVWA 3W5UA 1A9TA 4F3CA 1O3YA 3AP3A 4BC0A 1Z36A 1NOIA 1E7YA 3LYLA 1ZMBA 5DBGA 1EDZA 1LS1A 4BVKA 1BE8A 4Q19A 2H4ZA 1RM4A 3SNHA 3V8RA 5TF4A 4DR5B 5ALEA 1STOA 4C01A 1I5EA 2IHNA 2KKPA 3R7WB 2ZGVA 2KV2A 1OFGA 1U7PA 2WU1A 5ADUS 1OYVA 2HSGA 1U9LA 3C70A 4KZPA 5ESWA 1GT6A 1OA0A 2FPMA 2GNPA 5HQ3B 3NXKA 4CLOB 1HR0B 3H1BA 3ZXIA 2V98A 1ORVA 1Y98A 3H05A 3LUHA 1SCBA 1CRLA 2QTVB 4BNVA 1MJFA 1IEXA 1JWAB 1PN3A 1IM8A 2Q3EA 3JSAA 3HP6A 3JARA 3A14A 1YQWA 4RQ5A 1XDWA 3GVXA 3NHWA 4J9MA 4JJFA 1QCKA 3OESA 5E4TA 3LLSA 2IV2X 3ICXA 1HFWA 1TB4A 5CAEA 2A1TR 3WYDA 1YCFA 4INJA 3PHJA 4L08A 4QBTA 4A82A 2WMNB 3CZMA 2R8BA 4R9RA 5CK4A 3AEZA 4ALLA 5IMBA 3CXRA 3DHYA 3CO5A 1FP4B 3MDCA 1NKVA 2OUIA 1Y5RA 2NXCA 3EPPA 3WP1B 1R6AA 4EB6B 2KW5A 1YZHA 1CDOA 5DB6A 5H81A 3O4RA 3T7AA 1X2BA 1BFDA 3EA0A 4HNQA 3HVRA 4LF9B 5ALPA 1URJA 2OQRA 3U61B 2D2FA 1YQDA 4YBZA 2AG6A 4LEIA 3I2GA 1YRLA 1ZIYA 1XQ1A 4U3JA 2PJZA 5DKWA 3MK31 4RD1A 2GFHA 2EP7A 2O0KA 5NULA 4ZVUA 4C4TA 3EMVA 1ULAA 3ZDQA 5ALQA 4UFPA 1BVYF 1NM5A 1ZEMA 2WHQA 3CKYA 2VS1A 1MA3A 3GD7A 4AN4A 4CDRA 4YRSA 1EI9A 1R0XA 1ZQKA 1JU9A 3RRGA 1G7CA 2IW3A 5ALIA 2WT9A 1Q0ZA 4QNLA 1P0PA 3H2JA 1KH2A 4OHPA 3N2NA 4GC7A 4G0OA 3SYZA 3H5OA 3PCXA 1HNWB 1S76D 1JMYA 2K5UA 2XQVA 2ZU0C 1UF9A 1LC0A 4ZTUB 1IDN1 5BUCA 2W2VA 2Q5JA 1I4TD 4F04A 4JKYA 1SKYE 1MPXA 4PZEA 3NB0A 4Q6WA 4QUIA 5FUYA 3I2YX 4WV3A 3FPCA 3F8SA 4LJYA 2B0JA 5A3VA 5KNDA 5HIIA 2OMKA 2I4NA 4B3FX 4F6RB 2XBMA 5E1OA 4CLXA 1E3IA 5D87A 1WDWB 5ILQA 4UXIA 3KFVA 5IIOA 2EX1A 3AQIA 4OUDB 2BI4A 2XKBA 4PC7A 1NZDA 4WN9A 4IIJA 1PG2A 4FGLA 1TF5A 4MV1A 3SS8A 4MQ5A 2ISOA 4BO3A 1TVEA 3D6AA 4IUYA 4QYSA 3GFBA 3STWA 2A9QA 5KT5A 1DQPA 2ZYUX 3IXQA 2Z9BA 4Q4JB 2VEOA 4F3YA 4FQ7A 4X61A 4K4HA 1D2MA 1EGMB 1W85A 3G0IA 3HBAA 4LIPD 5F3DA 3ZEIA 1XJWA 4DMHA 2VHJA 3GJTA 5CEFA 4CL2A 2AZ4A 4PC2A 1NFRA 2WTAA 5JAOA 2NO7A 1P0IA 5DJ5A 3C4VA 1GZUA 2G25A 3UGQA 1SD1A 1UAGA 3OE7D 5IZCC 3OG9A 3RBVA 1L1EA 3FJ1A 4LZWA 2VJ4A 4WUTA 3GW8A 5J2TF 3DYIA 5DSTA 4TQRA 4HFMA 5GTIU 4XX0A 3R7SA 3VPBA 1JJBA 4AKGA 3K1YA 3UXOA 2NZUG 4AP9A 1WAMA 2ISPA 2V74B 2ZFUA 4Y1RB 3T95A 3X1ZA 4DNQA 3ESBA 1SL0A 5HRAA 2RC6A 3PEYA 3OQVA 5KVSA 5HDQA 4F21A 2IHZA 2ZTHA 4EYKA 4LRTB 1XYYA 1WVMA 3VH2A 3THRA 4JB2A 3BXOA 3EXFB 5BQ3A 3FCCA 4GS5A 3DLBA 4ND4A 1Z1BA 3KB6A 1GQRA 3K2QA 4RADA 3RIEA 3OZAA 3NWBA 5AJVB 1JXLA 4EA9A 5J47A 3UBTA 1ODLA 3RRFA 2IH4A 4Y0VA 4KWCA 1AGXA 4B48A 3RJ9A 2E5WA 3QYFA 4A0RA 1CYEA 3EZGA 2ECOA 4N9WA 1RWOA 3ZGYA 4B4VA 4R0NA 1RQPA 3W2FA 1COWD 3Q8XB 4PHCA 3Q7QA 4BO8A 4Q1VA 1YGPA 4DO9A 1DFGA 2GZAA 3HU3A 4HSGA 1WDLA 2QEQA 2PY6A 4JLMA 5DCWA 4JL8A 3DDOA 3OQIA 3IELA 621PA 2BGGA 3GBVA 3WC4A 1D9DA 3JAWB 4ED2A 3WA7A 2I1VB 1U8TA 3T12A 4UUBA 3GLQA 2Q6VA 2O6LA 2R8JA 3VO8A 4BQPA 2WM2A 4B9UA 1B6RA 3BDIA 1QTQA 2GWSA 3OFNA 3L7LA 4BQOA 1W2HA 3IJPA 4E88A 1CLUA 5DBFA 3NEAA 3U4CA 1ZVJA 4DABA 1W44A 4EGSA 1NU8A 4B5KA 1W4AA 5KTOA 3OBIA 2X7JA 5ISMA 3DD5A 3ESQA 3MABA 2ZAGA 2PSEA 3G5UA 4M83A 2ZWAA 4WZAA 1G3QA 2AYZA 4EITA 3GLHB 2QX8A 4A6XA 1VG8A 2FEXA 3GP8A 5C37A 3F5EA 3SOZA 5HA5A 3UAOA 5C8VA 4DDUA 4Y2TA 2GCOB 4JU8A 3QE0A 2HOIA 2JEYA 2GTHA 5SY9A 4LDZA 1RTKA 1TU3A 4BMCA 4MV6A 1C1HA 4GYJA 4LJ6A 5LUAA 5D3MA 5K3AA 5CPFA 1U3TA 4MIKA 1F8GA 2LRHA 2OHHA 1VA4A 5EIAA 1ZRSA 5A5VA 5A9RA 1OW5A 4Z6CA 1CUBA 1EVLA 2ZSJA 1IY0A 1CJCA 1I1HA 3BRSA 4M0DA 4KVAA 3T4PA 3P0FA 1E4EB 1K8ZB 1Z0KA 2AWNA 3IE2A 4BN4A 1G38A 4N8EA 3DXZA 2BEUA 1N92A 1SURA 4ALIA 4QEZA 4QJ5A 4D56A 2V7QD 3P0RA 2ECQA 5DN6A 5BOVA 2N42A 3K1AB 1RAEA 1D0SA 2DPMA 2BMWA 4Q1BA 2ST1A 3PE4A 4Q12A 4F4JA 3N9IA 5FTLA 2GAOA 2C0CA 1TK8A 2ZYTX 3BD8A 4TZKA 4MR8B 1C9EA 1KS9A 3K5IA 2VPQA 5KTYA 2G63A 2F7SA 4JJ7A 4PBRA 3M6MD 2E8OA 3D2BA 1QIDA 3RKUA 1VJ5A 3AQFA 1ZQPA 4KMSA 1XLTC 1A1VA 3O6VA 1C3LA 3R3UA 4FNMA 3DWIA 1NJGA 4G41A 5HFAA 4JIGA 3WL8A 4DY4A 3ZK9A 1OVMA 1G1MA 3DC2A 5D86A 3N53A 4YO7A 4KQMA 4I3HA 5FWNA 3DE0X 3LCRA 2LDBA 3LLCA 4HFRA 5DMHA 2FU5C 4L02A 1QB7A 1X9IA 2Z9CA 1ZGZA 1TU0A 3KQHA 1GCGA 1RJGA 3I1IA 4YUYA 1QGOA 2H1HA 4DL3A 3SSNA 1RXYA 2DGDA 1X1RA 4OREX 2BMFA 2Y92A 3OEWA 3P9ZA 1OX4A 4NCIA 5K0GA 4TYMA 3R5JA 2XUAA 4IDAA 1K5HA 5E4JA 2DLNA 4ZOQI 5IJ9B 3KR1A 1ZQYA 2HJWA 8ICRA 1Y1LA 1CRPA 2QM8A 3FVRA 4PZ0A 1ZOSA 2FGJA 2EG9A 2W6CX 2EX0A 3PDWA 1QSLA 1OZ0A 1JZQA 3AUJB 4PHTA 1GTZA 3ROEA 3II6X 1ZYQA 4YJ2A 3IDFA 2I7DA 4R2IA 1OROA 2B8EA 2R96A 5CVUA 5JSYA 3TR0A 3LX6A 3EDQA 3H9EO 4TTPA 4DSZA 4AI6A 2GZMA 1W1WA 4L95C 3UB2A 5FO0A 1G6OA 2DVMA 4YAJA 3TNFA 1N0IA 2VP5A 1WW3A 5EOVA 5F1OA 1OGIA 3IO3A 2DQZA 4B3JA 4XB1A 5JCOC 1NW9B 4PGXA 4YRQA 3ZD6A 2O8DB 4C0WA 2ZW9A 3DEHA 4BBZA 3OIDA 3KKQA 4J9SA 1LK5A 3PV0A 2IWRA 1SUIA 1JR3A 4L6IA 3R41A 4MYUA 1R9GA 4P8RA 4ZAVA 5I9MA 4CU2A 3D9QX 4N76A 3L01A 3R5KA 4GD3Q 4H7JA 3RG2A 3VX4A 1EIZA 4BJ5A 3T5PA 1WXGA 2HBZA 2JKVA 1QO0D 4TUQA 2FG6C 1MJNA 1PK1A 1XVTA 3M8SA 2CVHA 4JLJA 1ZQGA 5TGZA 4EHDA 4X66B 4V3BA 1RAFA 1RLUA 2FFRA 3QLVA 2Y9MB 4R8LA 5DX1A 4FGZA 5C0OE 4HUQA 2FV8A 1JKXA 5ESRA 4DREA 4H1HA 3V9PA 3SAFA 3QKRB 2MTBA 2OFXA 3QPDA 4YROA 2DFTA 4XGNA 3WXBA 7REQA 3A3NA 3RODA 3MAAC 1I30A 2O0MA 1RYRA 1SCUB 1JHQA 2BEWA 3JVEA 1GPUA 2EYQA 3LRPA 2OCBA 2C77A 4W7IA 4ZEVA 5FUQA 3C15C 4Y2SA 3INNA 5TNXA 3VYUB 2BDEA 2I3ZA 3BREA 5IU6A 3TTSA 1PGNA 2F8LA 3K09C 4M1QA 3WSVA 5AUNB 4IRXA 4F8EA 3FWKA 3GDGA 4Y30A 1R50A 3I6BA 3RHZA 2BHRA 4EY8A 4I1PA 2ATXA 1EZ4A 3B12A 4OQPA 3L3BA 4UCFA 1I01A 4PW0A 1Z7WA 3DHEA 3WE7A 2WB2A 2H4YA 5JNLA 3IRVA 5IT0A 5F98A 2TS1A 3RC9A 3TFOA 3WKEA 4H18A 2DEUA 4KRFA 3QE3A 3N7PD 1XT6A 2DHCA 2PUBA 4ED0A 1NY6A 2AQKA 2CHQA 2DRIA 2K87A 2XVAA 4IHJF 4KTTE 4WJLA 2ZCJA 4P81A 3THWA 2BVNA 3DHWC 2WLTA 1T2NA 3JPPA 4JK1A 1UMCA 1XROA 1Z12A 2Z2XA 3BH6A 3TTVA 5IS2A 1D9ZA 3ICWA 2WJWA 3RFUA 2CSXA 3KXPA 1UP6A 4G56A 1F2TA 3PCRB 3FRHA 4I50B 4D0LB 5B1EA 1CUFA 3I1YA 3PTZA 4CFYA 1XCBA 3C3MA 1IIRA 3LCCA 1VJRA 1VLVA 3AETA 5H68A 3W8FA 4BQNA 4DILA 2OV2A 3MGCA 7REQB 3WYAA 2JZNA 2H3QA 3OBBA 2W6PA 3OUTA 5B1YA 5DBOA 1LY1A 1WRBA 3PHBE 3I5UA 3JYOA 3E5RA 1A9XA 1HLGA 2RGDA 2EATA 4RC9A 3VM6A 1RQRA 4I9GA 5FA6A 4KPFC 5JS2A 4QW9A 3ZHZA 4XOIA 4YASA 1U1GA 5FJJA 3WRYC 1XK7A 5IVKA 4OA8A 3EA5A 3MWEA 3N7AA 4LOLA 4XUDA 5AO9A 1XTJA 2E18A 2Z3ZA 4Q7LA 4XUEA 1MORA 4G9EA 3VGJA 5JCOA 4EY6A 4EKEA 1CETA 2Q5HA 4Q05A 1IY1A 3MJHA 1VLHA 3RVKA 4KFRA 1T36A 4P4OA 4CMGA 1WV1A 2OXIA 4D9KA 2DLCX 4MAMA 3JAKB 1BPDA 3JY6A 1IN5A 2L42A 1WCIB 1R8QA 1U31A 3G6WA 2OVBA 1AS2A 1R16A 2IJGX 4RVNA 3BL6A 1RKQA 4RKYA 3FE2A 4BKQA 3CO0S 1AF7A 4LW8A 4OJMX 4ZREA 2PI5A 2I8AA 3V7KA 1YBMA 5D6NA 1T5BA 1Y37A 2F00A 1B0UA 3IIEA 3KPUA 4JP8A 3T4EA 2V5VA 4V0NA 3WHPA 4I50A 2TMGA 5I9IA 1Z2OX 1VPVA 1NKBA 4RPCA 3QKTA 1QZTA 1QHNA 3T5CA 5JXJA 1AJEA 3L6OO 1C4OA 1NQWA 1LNZA 2BGTA 3C3EA 1K9SA 3QVSA 5BVHA 3JPQA 1DVRA 3O4FA 1VZ2A 2D1TA 5BUSA 3UXHA 1SIWA 4FEYA 3ZDBA 4PZNA 2BEUB 4R1LA 4PL1A 1UKCA 3T9CA 4QULA 1XCLA 1C3OA 3DZJA 3QZUA 1AB5A 2VRBA 4LYYA 5KTRA 4QBIA 4RTJA 4E07A 3BA1A 5JC8A 5JSHA 2WHPA 3OQBA 4MMZB 2XRMA 2ZRQA 3C7CB 1IHOA 4G1EB 1K5OA 2IA6A 1CUIA 4JUIA 4B2YA 2X1HA 2DHQA 1M7GA 1R9MA 4IOJA 2RHLA 1X8XA 4LF4B 4HYKA 1HBJA 3U7RA 4E5VA 9ICSA 2I33A 3PGMA 3PF8A 4H0CA 5AVZA 3VPHA 4KGDA 1VKRA 1EWQA 1XAIA 1TZCA 3CSDA 1N5OX 3R5TA 2WJ4A 4I2NA 1LPBB 13PKA 1MAHA 5DYIA 2Z2ZA 3OWXA 5HM6A 1C3EA 1KI9A 3M34A 4LDJA 4OG2A 9ICGA 1V43A 1T6NA 2SNIE 3LCJA 3LL4A 5FKJA 5A5GA 5H02A 4O4IB 2ACEA 3Q3CA 1OPRA 3QLJA 1QWSA 3Q7PA 4PAGA 5FTJA 2L18A 4G5YA 5K8UA 3EK2A 4UREA 2BR0A 1I1QB 4QYIB 5CWRA 2XTNA 4LRQA 3BE8A 4DYDA 2KFZA 2IPMA 1G8JA 4GG1A 1IATA 5G53C 3H0EA 4BNMA 1U7DA 4DQXA 1Y8ZA 3L7IA 2Y0DA 2FSVA 3IAM1 2I55A 1D7AA 4KBYA 3VZDA 4HOYA 3BQ0A 1NVGA 2FLWA 2OZPA 3A28A 4I55A 4MITA 2IEZA 3E3MA 3CX7A 3L4BC 2NU9B 5HJ2A 2Z08A 1E77A 5JU6A 4YVZA 4Q37A 2QN8A 2KJ5A 3GLIB 4LZAA 2C83A 1AV6A 3KXDA 2D7CA 5JRZA 2C2HA 1SBTA 2AU0A 1RJ9A 4X6UA 1PVRA 3N05A 3ZEAA 4RIEA 2OOSA 3AINA 4P4LA 1XQWA 3GT4A 1D8TA 2I7VA 4EWLA 1DOQA 3ZI0A 2GJSA 1Z4JA 2JEFA 3PX4A 2KLBA 1D4FA 4MPRA 3ZVRA 1KIAA 1V5IA 3CLHA 1KFSA 5DK6A 1J00A 4HMOA 1HJPA 1V4BA 2XGSA 2CK3D 4INPA 3E9QA 3H11A 2YN2A 3B6JA 5JECA 3EPRA 1J5EB 2EJBA 1U94A 1I14A 4P58A 3LT2A 2JLRA 1XVVA 1W1UA 2IZZA 3CPEA 5DB4A 2O7VA 3BQNB 1BMDA 3G23A 5BR4A 3N58A 3KUXA 3H4BA 1H4TA 1YFZA 1TC2A 1D6JA 2C3MA 4OIFA 1OF1A 2UVPA 4HQOA 5IBQA 5C1OA 3STVA 5KOYA 4BDPA 3KHKA 2P4SA 3QEOA 4IGEA 1HT3A 5T8KC 5CB4A 1ORHA 1VJTA 2QUJA 3ZCRA 2ZDQA 3HKBB 3EEQA 3PC2A 1C7EA 1LWOA 1XCGB 3ISTA 3UUGA 1PT9A 1CRXA 3VCBA 5KDLA 1SV4A 4RULA 1W47A 2R9VA 3ZJUA 3RB8A 3IT1A 3NNNA 3FCSB 3TD9A 4C4SA 5KG5A 3TGWA 3HCDA 1WUKS 5LLSA 1OLUA 1JFFA 4D7AA 4YMTA 4ZDJA 1TYBE 8ICMA 4RTQA 2Q0QA 3ITEA 4QFMA 5C31A 3TGLA 3AUAA 1ADCA 3TL3A 2HCTA 2ZUVA 5BRAA 1JLMA 5CRIA 3VR6D 4I9FA 4LSZA 2YWDA 3QZ8A 4I2FA 1P0QA 2OHOA 3KHTA 4LOJA 3ZU2A 1DK3A 4TS1A 3WQBA 2BMAA 2EX4A 1HLDA 2EZYA 1NK0A 2LW7A 2X2EA 1MO3A 3A36A 2SECE 3PSAA 1AS0A 3I12A 1PWYE 4QTXA 4W6ZA 1QC5A 4Z6DA 2Z0MA 3RO7A 1AK2A 3UHOA 3VRHA 3WFJA 2EL7A 3ROZA 3C98A 1U49A 1AS3A 4Z0TA 2BGUA 3LY5A 1MFPA 3FNRA 3MFHA 3VTAA 1WJGA 4YMNA 4O4HB 5E1MA 3VBCA 1Z3IX 3KOUA 1BOFA 4O4IF 3IBCA 3IQFA 2FWRA 3RWBA 1Y6JA 3ZE8A 4BNXA 4XRGA 2OHFA 2C4HA 1PJBA 3ED1A 3HNRA 3PQFA 2J8ZA 3KHSA 3L1VA 4YP0A 5EZQA 2HNBA 3UG7A 1PR4A 3EQ8A 4NONA 5EXXA 4U0KA 3WV5A 3QI7A 4NBKA 4OQDA 3CZCA 4D3FA 5CP2A 1CK4A 1B8OA 5ADVA 4RM3A 1QYXA 1FA9A 3EZ2A 3NU1A 4QXMA 3AHGA 2II6A 4MA0A 2CV0A 1NJXA 2DU8A 3U16A 1H5UA 1UQRA 5THQA 2YW2A 2I22A 4HAIA 2XCPA 3ADKA 3WWOA 3JZFA 5DNUA 1RVDA 3HU2A 3GARA 4AF7A 3CCBA 2YN4A 3H8MA 3KCNA 2JGEA 4JLWA 4OAPA 1R8JA 4YDRA 4EFMA 3GA5A 1Z6TA 3GGOA 1PQWA 3KYDB 5CVEA 4BNJA 3RS5A 3ZDXB 4S12A 1G6Q1 5CG2A 3C3PA 3L6DA 3BGIA 4NBLA 4KREA 2JFFA 3R0IA 1GOTA 3JZAA 4DUZB 4YJGA 1A71A 1HE1C 3RSGA 4UHKA 1J8VA 1JE1A 5EKTA 1ZETA 4G0PA 2OY0A 4G3IA 2XUIA 4KW7A 2VHVA 1PUZA 4DBZA 4AX4A 4TXMA 3CQ9A 2YXDA 3LXMA 4A15A 2IHYA 2IZOA 2WILA 2ARKA 3A6ZA 3SXUB 1CUKA 1QQ6A 1VM6A 4MF8A 1OY1A 2W2LA 2RCNA 3V80A 3GMDA 4F8YA 4R63A 2D1RA 4LCEA 3NALA 1YJXA 4DWIA 2BGKA 4R1SA 4NK4A 4ND6A 5A3RA 1U3VA 3GLRA 3HH8A 3KJXA 1QJCA 1ODIA 1USKA 2J6IA 3MXTA 3VA7A 4RD3A 4ZVQA 4EH1A 4JYZA 1F20A 3OKPA 4BO5A 1JIIA 2YW9A 4YPOA 5DGDA 3OIGA 3VUEA 3B36A 3L8YA 5KG4A 1DRJA 3E70C 2EZ9A 1GA6A 1IHXA 2C9MA 1OKKD 1Q6YA 2ODQA 3GOHA 4RACA 1GAXA 1JJIA 1EH5A 3UXEA 3WRVA 3GRFA 3ICOA 4NS4A 1RYNA 3RV3A 3STHA 2XCRB 1C7FA 1S7GA 4PH5A 5BSMA 3KL2A 4G5SA 5THXA 5CFNA 1ODJA 2XKJE 4D26A 1X42A 2HLDA 1X92A 1RWBA 3QE9Y 2E6UX 1XEXA 2RGGA 4XI9A 2QTWB 2QZ4A 3SC6A 2C7RA 3E48A 3M6AA 2YJ4A 4L07A 1KMIY 3RADC 1BXRB 2XUPA 1LI4A 1FUEA 2HU2A 3SQOA 4GPD1 3EIXA 2B6HA 1J2RA 1KNQA 2GPBA 2LXNA 1F14A 6PFKA 2FXVA 3ISVA 2R5FA 5E6UB 3W9SA 3LS2A 1OB2A 2LV8A 2JHFA 4U6SA 2ETXA 1VMAA 1KTQA 4JC0A 2YJ3A 2FP3A 4BX3A 1R6VA 4Y1FA 1AQJA 1FSGA 5DQGA 1KMCA 4JX9A 4EA7A 1ADYA 2RK3A 3GLUA 8MHTA 3I32A 2JIZD 5J23A 1QZXA 1ZK0A 2DR0A 4OATA 4QZGA 1TX4B 1KPIA 2ZSUA 4UC0A 3JWIA 3RYIB 3H3JA 1ZN2A 1DOHA 1H1LB 1WXXA 3AI2A 4HLNA 1Q7EA 3MINA 4S1NA 1ST2A 1DXYA 1J49A 4H3HB 3GLIA 1EQUA 2LGJA 3JQ9C 1SH7A 3AVYA 4MHTA 3AEYA 3K2BA 4RA6A 5CW2A 3RNLA 4BP3A 4B9SA 2Y0CA 4EHLA 4ESHA 1F0NA 3WMEA 4TRNA 5CVJA 5J2IA 4KLZA 4B6JA 2JHPA 2X7HA 4WY5A 1WV0A 1L8OA 2Z5VA 3KELA 4A8TA 5ES3A 1RM6C 5GADl 4M2YA 1P5ZB 1FFDA 4CQJA 4EUFA 1VHQA 1UBHS 3GJZA 2WIDA 3TPZA 5A05A 4PGFA 3TTWA 5DH9A 1PJ4A 4RY2A 4UTPA 5DHRA 3HKZC 2IGBA 3AI1A 5AJZA 5EUMA 4BL5A 3BDPA 1LZKA 2G71A 3MN1A 2V7QA 1X0VA 5DP1A 3SLGA 4J16C 1C9YA 5MF6A 1Z0ZA 5DK4A 2HCBA 2QROA 4DDTA 4FT2A 4HH1A 1TKDA 3S29A 3AYXB 5FI3A 1UK7A 1J0XO 1PVVA 4LNHA 5GTDA 1XDSA 1M6NA 3D7NA 3RBXA 5FFMA 7AT1A 1R4ZA 3H5NA 8ICWA 4OJQA 3RNOA 3ELYA 1YOVA 3RKSA 4BO6A 3U49A 4BDSA 1HE8B 4DJDC 3FC4A 1WTCA 4IDPA 1H85A 4JR2A 1SIOA 4FDLA 4BP9A 4XH9B 4Z1OA 4NE7A 1S01A 2RGRA 2OEHA 2GPWA 3LPDA 4CEHA 3TSCA 1YTLA 2H11A 2GLUA 5IAAA 5DBCA 1XTSA 2P75A 3H2IA 4TX1A 2OZLB 3STYA 1MAAA 3TH5A 5IT4A 2VRWA 3OZVA 1XNJA 1VE9A 2XQGA 1IQPA 1L4EA 2NO6A 2YWHA 1H9CA 6ADHA 1GSOA 4BCCA 1ESNA 4EJMA 4OB6A 2NXWA 5TMEA 5LWHA 1YJ5A 2MCFA 4M46A 5AVKA 2QE6A 1YRYE 4UVIA 5JS6A 4YMMA 5JZ9A 5JT1A 3BTVA 1L5MA 2ZANA 1O97C 2FTKE 3FZYA 1CYDA 3RBEA 2WE8A 3BIWA 3L0BA 3QJGA 4JYPA 4R16A 3UCFA 4AJJA 2K7ZA 3RK0A 2OXFA 3JTEA 2ZTVA 3K9GA 4GE0A 5LOVB 3VPDA 2H2HA 3MD0A 4RIIA 4ZCMA 1VL5A 4YPVA 5KFDA 2VQDA 1JTEA 2WMYA 3R09A 2Z95A 2HCFA 2FW1A 4IJKA 4O9MA 1NW6A 3NW9A 4KO4S 3AMVA 4QJIA 5G1OA 3S2EA 1UWCA 4YJ3F 4I1YA 5AHRA 5DGBA 3AJRA 1NMEA 1P5HA 4GNKA 4XAQA 2A35A 7ICRA 1XQVA 4DBLC 4BP1A 5H80A 1RFLA 4CETA 5K8LA 4H1WA 2J9XB 2QYSA 1V39A 2UYHA 3K70B 5CEEA 4E1AA 4CW7A 3OMLA 4GRIA 4I9HA 3B7WA 2ZU6A 5EIWA 3N0VA 4LK2A 2H1SA 2NZVG 2EP5A 1MEJA 4FX5A 4UM8B 3FDSA 1FDSA 3ASZA 3KKAC 5I9BA 1N3BA 2A1UA 1I0IA 5FCDA 2H1OA 1Z8HA 1R64A 4HADA 1KKLA 4IJVA 5CM9C 4YRKA 3MBIA 4ROTA 1KIMA 4QODA 5ALXA 4UASA 1T6BY 4MP6A 3RVSA 5KOJB 2ADFA 1PK8A 3AY6A 4RMNA 2QE7D 3H16A 3OQOA 2BFNA 3RC8A 4PPFA 5M2QA 3LVVA 1RVV1 1XRJA 1UCVA 3GOQA 4ZOEA 1DRKA 2P7IA 5HNKA 3MMZA 3MHPA 2LDXA 1XSPA 4PSVA 1DWOA 1E5DA 2WWIA 3I83A 3EVFA 5AUPB 2FMIA 2AIRA 2OORC 2G7MC 4PG6A 4DMGA 4XSGA 4BJ3A 2ZUBA 5CNIA 4OI0A 1NOJA 2JAOA 2VK2A 2C1EA 3G2HA 4DC9A 1R12A 4OO3A 4PV7A 2WLSA 3WGYA 2AOTB 2RP5A 4PPNA 5D6OA 1C80A 1O9HA 1PJ8A 3SV4A 4M1WA 4RF3A 4YXWA 4ERXA 2BCUA 2Z1MA 5JVDA 1JYEA 2Y9PB 4UPDA 4DDKA 3GBSA 1ZGBA 2VJYA 4K2AA 4WACA 1XVAA 5KIAA 1U8ZA 4L72A 3THSA 4M8NE 3IAUA 2IOFK 2OHXA 2IQ5A 5CA1B 2HPVA 3ZDFA 1LRJA 2MYPA 1TPYA 3WIDA 3KQUA 4EDFA 2IPLA 3G6VA 2QR5A 1X1AA 1H8HD 2XWJI 3EG9A 3R6WA 4MUIA 4XTRA 4DQPA 4RPHA 3A31A 2RGNA 1KQQA 1F9EA 4KPEC 1O0SA 1SG9A 1KYTA 4TXJA 1N78A 3PVCA 4N5IX 3GLGA 2FE4A 5TARA 1UJMA 3DR3A 2XRYA 3RIMA 2PBFA 3X3HA 2H18A 3RCBA 2SKEA 4DV4B 1PWHA 1T10A 1UQVA 2XJ4A 1XDDA 1GA1A 1CR1A 1XXHE 2K2WA 3EVTA 4E30A 5BYKA 4EBFA 1QH9A 1MIOB 2E21A 4ZEOA 5CR0A 5GP1A 4GL2A 3I52A 5D3KA 5AM5A 1OUMA 4QDJA 3HCAA 2ZYVX 1L8XA 3ZXYA 3M6WA 3T5TA 3A2LA 1U9CA 2VCEA 3OZFA 3VPGA 2ASEA 1H6AA 1HMPA 2YIDA 3ZGLA 3LM8A 5C35A 1NTOA 1P3Y1 2HA5A 1U80A 2JARA 3AW9A 3EUWA 1ZIXA 4KXMA 1LK0A 3BMQA 3W6PA 4UDOA 5IBPA 1C1XB 3EZ5A 1DOAA 2JW5A 1T3ZA 4K1XA 3TZBA 1BN6A 2JEOA 1O54A 1SNYA 1YRHA 3GEDA 2B2XA 2PZLA 1D6NA 2C2KA 2H0AA 4FMCB 3HVUA 4OKSA 2FPRA 4JB0A 1BD4A 2KBFA 2QI9F 5LZ8A 3UFXB 1N2CB 2BE7A 2YJNA 4D9HA 4YV2A 4LYHA 2QYOA 1R1DA 2GQ0A 1Z15A 4JGBA 3CLRD 4TT3D 3RSSA 1JILA 2VYND 4U7HA 2GCGA 3UJ7A 1ABBA 5EE1A 5LMZA 1A7KA 4B3RB 1PJAA 4DQIA 3HJFA 4FS3A 4EI2A 4CRXA 1RYFA 2HWXA 5TGDA 3M4YA 4DIBA 4B44A 2P9EA 3LPLA 4YDHB 1KYYA 1YDMA 4R2JA 1Q0SA 2YQZA 3NQ41 2G82A 1E1QD 1EVKA 4LZGA 3R2JA 4A2PA 3V2GA 2NN3C 2ZRDA 3NZEA 4RH3A 3SSMA 1JKFA 5T14A 1C1DA 1EVJA 3B3QA 3L1UA 1KQNA 3SYLA 5FTKA 1BX1A 5LVAA 3DO6A 3E7FA 1UZMA 1U47A 1HMYA 4K26A 4U6NA 5DWDA 4BZQA 4DV0B 1LSJA 5J2BA 3BXFA 3W6ZA 3MMXA 2KSQA 4E32A 4J9QA 4FFMA 1YGYA 4GXNA 4Z7NB 1SGGA 4M9HA 4MIEA 2AC2A 2VPYA 1PZGA