2NYVA

X-ray crystal structure of a phosphoglycolate phosphatase from aquifex aeolicus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
b'MSLRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDNHIVEFEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycolate phosphatase
publication title X-ray crystal structure of a phosphoglycolate phosphatase from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 74
structure length 217
sequence length 217
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2nyvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2nyvA01
4ZEVA 1AQ6A 5AK4A 2NO5A 4Y2QA 4NABA 3OTQA 1ZRNA 4EZEA 1Z4QA 5IS2A 3QNMA 3NANA 1U02A 5ALJA 4C4RA 3OCXA 5AI8A 3L7YA 4KYTA 3N8GA 3RFUA 5IT4A 1YJ5A 2GHTA 4HGPA 1VJRA 1ZJJA 5AKYA 3L1UA 2RBKA 1ZD5A 4F72A 2RARA 5AESA 5AW4A 3QUTA 3ZW7A 1O08A 2JGAA 3ED5A 3VAYA 2C8KA 2FPRA 4KX3A 3KDPA 3I28A 3QUCA 5AKHA 5ALKA 5AVQA 4BNDB 4BYGA 5ALYA 3ZI4A 3FGOA 2WF7A 1KYTA 4GXTA 3L8HA 2O9JA 1ZD3A 5AM3A 4AS2A 3QLEA 3DNPA 5ALRA 2IOHA 3PGVA 2HI0A 2DQSA 3TLMA 5AM5A 3J7TA 2GMWA 1YNSA 4I9GA 3DV9A 3ZVNA 3BA6A 3SHQA 2O2XA 2MU1A 4BEVA 2I34A 5AW8A 1QQ5A 4UM5A 3A3YA 4EX6A 1YS9A 3QU5A 2EARA 2FUEA 2GFHA 1CR6A 2GO7A 4Y2YA 5AVSA 4I9FA 1SWWA 3SMVA 3A1EA 3KD3A 4Y2PA 2B8EA 1TJ5A 2Q5EA 4UMFA 4E88A 2WF5A 2R8YA 5ALTA 3UM9A 3OCYA 1LVHA 3AR8A 2G08A 3DAOA 4RESA 1K1EA 2EAUA 3L8FA 1YMQA 3ZVMA 1T5SA 1LTQA 3WGUA 3WKDA 3MMZA 5AVXA 2NO4A 3QUQA 2G09A 3B9BA 5AHXA 4HGOA 1Q91A 2AUTA 1RRCA 4DFDA 5AI9A 4RETA 2W43A 4BX3A 3L0CA 5AVRA 1RLTA 1L7NA 5AW1A 2P27A 4Y3UA 2I55A 1EK2A 4IFTA 4FFDA 3NALA 2I7DA 2ZBGA 2VKQA 1RDFA 4JB3A 2JAWA 5AKLA 4Y2JA 2YJ4A 4L57A 3SKXA 2OM6A 3WKCA 2MSNA 2JAUA 3L5KA 3KOOA 2HEGA 3AR9A 5ALPA 3ET4A 1J97A 4UU1A 3U7GA 4Y2UA 5ALVA 1XVIA 3ZTWA 3ZWKA 4CNQA 3PDWA 3QXGA 4XE5A 4OD0A 4J2TA 4O8CA 3FM9A 1ZD2P 2Q4RA 5ALQA 3QU2A 3CNHA 2FPWA 4DCCA 5AW3A 4KNWA 1Z88A 3A1DA 4UMVA 5ALUA 2PR7A 3L0YA 1TJ3A 2WFAA 5AW6A 4L6AA 2IA5A 3R9KA 3U7HB 5AVVA 5ALXA 4HGNA 4L6CA 5AKGA 5ALSA 3OCWA 3L0BA 4G9BA 3WK4A 4J03A 1Y8AA 4Y2RA 3SKYA 3WKBA 5AKXA 3ET5A 3QGMA 2HX1A 5A3SA 5ALZA 2YMLA 1L6RA 4KX5A 1SWVA 1Q92A 3L8GA 4Y2SA 5A3QA 2BDEA 3FZQA 2YMQA 4HGQA 2WHEA 3CZ4A 4BKMA 1WVIA 3FPSA 3U19A 5AM1A 1YV9A 2FI1A 1U2SA 5ALNA 5AI0A 1Z5UA 2YBDA 1RKVA 3AR4A 2G06A 1Z4JA 5AW7A 2HF2A 1ZOLA 2I33A 3W5BA 4UARA 1U7PA 5AVZA 1Z5GA 3A1CA 3PGLA 2C4NA 2AMYA 5AICA 4NWIA 3W5AA 1Z4MA 1FEZA 2WF6A 3ESRA 2B0CA 1VJ5A 4JDPA 5AK3A 3HLTA 2R8EA 3I6BA 2IOFA 1Z4PX 1NNLA 2NYVA 3M9LA 5AI5A 1QYIA 1IWOA 2G07A 5AKZA 1F5SA 3HYCA 3L1VA 4YCLA 4CF5A 1QH9A 1PW5A 3AR2A 3R4CA 4EX7A 3OCVA 2ZBEA 1O03A 1RLOA 3WK8A 3QU9A 1T5TA 2P11A 4MWOA 5AIAA 3MC1A 3WK6A 5ALLA 3GYGA 2YMPA 5AM4A 5ALFA 2MU2A 5AKEA 4IG4A 4HAIA 2G0AA 3EF0A 3B8EA 5IT0A 4OFZA 3NIWA 2D2VA 3PCTA 3AR6A 3D6JA 1U2TA 1EK1A 1WPGA 3ZWDA 2ODAA 5AW5A 4UAUA 3B9RA 2HSZA 1QQ6A 3UMBA 1N9KA 4MUMA 5AVUA 4YCMA 1L7OA 3SLRA 2FPXA 4QQFA 5ALWA 3WKAA 5AK5A 3QYPA 3AR3A 1TE2A 4NV0A 4OCZA 3R09A 3AR7A 3ZTYA 5ALHA 4QJBA 4ZEXA 2B30A 2RAVA 1RC8A 2IYEA 5AK6A 4F71A 1RQLA 2I6XA 4KNVA 2I54A 2B82A 2G80A 4BBJA 2B1QA 4HGRA 5AKKA 2FPSA 1ZS9A 2HF7A 5ALGA 5ALIA 3IB6A 3MPOA 3ESQA 2OYCA 3FVVA 4Y2XA 1NF2A 2EATA 2P9JA 1RQNA 1RMTA 3UMCA 3WK9A 2ZBDA 4XPZA 4BNDA 4C4SA 4YIHA 4Y2TA 2P69A 1QQ7A 5ALDA 3WK7A 2CFSA 3ZX4A 3DDHA 1X42A 2YJ3A 2YY6A 5AI4A 3UMGA 1YDFA 3U26A 2YFYA 3KC2A 3ZUPA 1T9ZA 4H1WA 4EELA 2AGVA 5AW0A 3S6JA 1Z4KA 2BY4A 5AW2A 3FPBA 5AVTA 1L7MA 5ALEA 2QLTA 3EF1A 4UM7A 4PNHA 3RF6A 2ZXEA 3P96A 1TA0A 3ZX5A 2PKEA 3E8MA 2JARA 4OHFA 4UU0A 1Z4NA 1NRWA 2R8XA 3ZVLA 5A3RA 3EWIA 3U13A 2QYHA 1ZD4A 3N07A 1XPJA 4ZEWA 3F9RA 2W11A 4Y2VA 4UATA 3SF0A 4CE6A 4XOUA 4UAVA 3N1UA 3ZU6A 2RB5A 3SD7A 2G1AA 3I1YA 2IOFK 4B6JA 2C8LA 2C88A 2FUCA 4BX0A 1MH9A 4XQ0A 4C4TA 1Z4IA 2CFTA 1RPZA 2YJ6A 3QU4A 2WF8A 5AW9A 2OA0A 1XP5A 3KZXA 2YJ5A 1VFPA 3BWVA 4DW8A 5ALOA 3EPRA 3W5CA 2CFRA 1RMYA 4DWOA 1RMQA 2AH5A 3U7EB 2YMMA 3NUQA 4YIKA 3NASA 5E0OA 5AVWA 4YGYA 4AP9A 3QUBA 4EEKA 4AS3A 3WKEA 1S8OA 2OBBA 3MN1A 2FPUA 2R8ZA 4HYTA 4UMDA 5AKIA 5AM0A 3KBBA 1RLMA 3IJ5A 3M1YA 2HCFA 2ZG6A 3N28A 2HHLA 1CQZA 2W4MA 1U7OA 3E84A 4UMEA 3NRJA 4EENA 2GHQA 2Q4TA 4CF3A 1SU4A 2FDRA 2PQ0A 2X4DA 1RKUA 5T41A 5FP0A 3K1ZA 3OCUA 3ONNA 3NAMA 3OCZA 3I76A 4CF4A 1L8LA 3OPXA 4G63A 4YCNA 3N5KA 3E58A 1L7PA 3QU7A 2HDOA 5JJBA 1N8NA 2B1RA 1L8OA 5AIBA 1WZCA 3E81A 4YH1A 2JAOA 4BEWA 3W5DA 1Z4LA 2BDUA 4FE3A 4UW9A 4UASA 3IRUA 2WM8A 1JUDA 4FYPA 2CN1A 4GIBA 3WGVA 5AVYA 5AKJA 4NFLA 1TJ4A 4BX2A 2C9MA 2HO4A 1S2OA 2ZOSA 4NAVA 5AM2A 1J8DA 3QX7A 1ZRMA 1RKQA 2ZBFA 2HOQA 2WF9A 5ALMA 3L8EA 5AI6A 3U7FB 2B8JA 2FEAA 4KN8A 1WR8A 3WK5A 3AR5A 1Z4OA 2YN4A
chains in the Genus database with same CATH superfamily
1JA9A 3IT3A 3STXA 1G8AA 1Z45A 4HTAA 4QRIA 3GR6A 3ZD8A 1HZZA 4C2BA 3CX6A 3SAFA 3QE2A 2HJWA 1NXQA 4B09A 3RIHA 3MRSA 3SJ7A 1ZMOA 3LDAA 2ZRKA 4L08A 1HDZA 1YUNA 2LD4A 5CB6A 1PF7E 2V1XA 2WJ4A 1TRHA 4FW8A 1OLSB 1P2DA 3P9CA 3LO5A 5G41A 4JASB 3B7GA 3QUAA 1I0ZA 3FHTA 2RGNA 2CXHA 4MP6A 2R6CA 3IMKA 2C00A 2QLFA 1G21B 4YT8A 2E4AA 4GZ5A 3H9JA 4RTOA 3M4YA 2GVDC 4YMSA 5D1HA 3LX6A 2XC9A 1B41A 1VSBA 1C5KA 2BKEA 3QUQA 2QMZA 4EJMA 1NW4A 2CLHB 1M2JA 3UAOA 2ECFA 4GSLA 4N47A 3FI9A 3UFXA 4OJ6A 4YMMA 3V8QA 1MA7A 4Z9FA 2WU8A 3H04A 2QB0A 4HQLA 3L4BC 5SICE 4XW2A 2EFYA 2J41A 4B3BA 1SK9A 2D74A 3DBHB 4K3UA 2YXLA 2WHYA 3PGA1 3UUGA 3QGMA 3HPOA 4GOND 2QUZA 1U0LA 1TUGA 4WT7A 1RBMA 1D7OA 5JSQA 3IKJA 3L7CA 2ZSDA 1N33B 2NO9A 5IAKA 3ZHOA 1T13A 1NBIA 1AK2A 4UUPA 1GL7A 2E6UX 1WF6A 3VJMA 4MGKR 2VF8A 2ZUBA 3JZFA 4DV1B 1K4KA 2P8JA 4BUJA 2N1RA 4ZIRB 4F5NA 2QJRA 3C3DA 3RS8A 3I8OA 1ZO8A 4UE3S 5DLEA 3Q6NA 4NDNE 1RPNA 3UJHA 2HT1A 3AQFA 4B3JA 1A9XA 2D1RA 2E21A 4N0DA 5DCUA 4L5IA 1V9PA 1T6YA 5IX8A 1FO4A 3ZHZA 4GR5A 4GYWA 1YZVA 5FXMA 1TF5A 4YCMA 4NLGA 2VAXA 2VN8A 2N42A 3O3NB 1YBMA 4XASA 2GBLC 2Q1WA 4TURA 4FLFA 4RA9A 5FB3A 3RWOA 3UOWA 2FLVA 2RGXA 4JBNA 3EZ6A 4LEIA 1PCXA 3D6AA 2R7KA 3RSFA 2F9LA 1EFPA 1FX1A 3V3KA 3BRWA 2LI6A 1WQ4A 3FROA 1PBNA 1J42A 1GPMA 1DRVA 3BD8A 1JFFB 2HA3A 2OKGA 3UC5A 1HORA 1OXXK 1J90A 3GQVA 4QL3A 4F1WA 2RI6A 4IMJB 4W1QA 3A7EA 2E8OA 5FWXA 2PCLA 1VLQA 2ZBQA 3A4YA 4J9NA 1RYFA 4IUCS 4RZQA 3O21A 4XFKA 4EBFA 4K88A 4LXHA 4KQJA 5KG0A 3I58A 4K05A 4HQOA 4JDUA 4R3WA 4X93A 4J6EA 3L7KA 3Q85A 1JEOA 4PM4A 3DDNA 2YV5A 3CGWA 1RHJA 3AESA 1HT2E 4L5YA 1X3LA 1F8XA 4XFJA 4BGVA 3ASUA 2OUIA 3M1YA 4DJFC 1MV5A 4YRGA 1F14A 3DC2A 2I03A 4MUFA 3R5JA 4CF3A 3B70A 4E13A 4Z4QA 2BPOA 4MYDA 1HSZA 3A4MA 5CAEB 2W03A 1RXCA 3K70C 5C1OA 2AQ8A 2H4YA 1QM5A 3CVXA 1MH1A 4BEWA 2YZ2A 4RFSB 3NM4A 3VO1A 1I6WA 3W2EA 1FRNA 1RJ9B 3KZMA 4YCDA 3JD0A 3RIYA 4LMAA 1Z6AA 3HWTA 1RJDA 5ITVA 1LBIA 3N3BC 3HACA 1X1RA 2HIGA 3TAUA 1AQNA 1TD1A 3GCXA 4IVQA 1O0BA 3WYCA 2G6BA 5FHRA 4QYTA 1VA4A 4B9LA 1EGQA 4I4CA 1OILA 1KOFA 2ZAGA 2GAIA 3M9XA 1M83A 1K68A 1FNNA 3JPPA 4BFZA 1L7QA 3C98A 1JKFA 3IM1A 1EFRA 4MP3A 3JD3A 3AI3A 4X00A 3PZRA 3HFRA 1R4MB 3V46A 1CNMA 4ZZ2A 2CLCX 1Q15A 4YCXA 5KB3A 3BK2A 1QE0A 3PENA 5J0WA 7ICOA 4YXWD 1JHZA 1DC7A 3M4NA 4IWNA 3K35A 3OPNA 1GRVA 4WY5A 2A1TS 3W9SA 1SHJA 1E96A 2Y2UA 5AVXA 3DZKA 5FIUA 2VLIA 3UJ7A 4Q4CA 3HZRA 4F5PA 2ZUWA 3V7WA 2VKQA 3K9HA 3EJ6A 1NBME 2RH8A 3LY7A 2JAHA 3TLGB 2K8BB 3HKZF 4F4XA 3DLIA 1NVWQ 1BKYA 1HUQA 1TW3A 2RGUA 3G0DA 2PXXA 2CYCA 5I9SA 1F7UA 2FN8A 3EXIB 3A10A 2DPXA 2YICA 4DY4A 2ET6A 1B2LA 4YP6A 3B1ZA 1HTBA 2B5VA 3GFKB 3IO3A 5HKOA 3EBLA 1HYGA 3SBOA 3HNPA 4CKWB 3LLVA 3VZQA 4QPNA 5HR5A 2LIPA 2F3QA 3GLHA 3MTJA 1VCNA 4DIMA 2HAEA 4XDGA 3C5GA 2YFHA 1TDJA 5AI0A 4EHNA 5T6BA 1B0UA 5BYKA 1XHLA 1UK8A 3A9VA 1Q0SA 1ORDA 3JQRA 3FUTA 4RL6A 3HS3A 2IOFA 3WJ1A 3MGKA 1PWEA 3KWFA 3L1VA 3EXFA 3PUXA 1Z5NA 1GD1O 3FTCA 2EG9A 1IUKA 1UFVA 4RPGA 4FZJA 4O1IA 3CYFA 4EMBA 4KBFA 2XF8A 4IOLA 4P31A 1RJGA 5LZ7A 4B9SA 1SB9A 2C4MA 1NKCA 5C8YB 3EGVA 1JV2B 1X8JA 3K8OE 4D92A 1PNTA 2LKYA 4Z4CA 3RTDA 5J9FA 1X19A 1LF0A 2AXNA 4PBRA 4R9NA 2BPGA 5DZSA 3W3AA 5B55A 1U99A 3PNKA 2BONA 1V85A 1KDRA 2RHTA 1E61A 5AFSA 4D74A 2P9JA 2GOLA 3UMCA 4Y2TA 3C41J 5HA5A 3D59A 5CT8A 3LX8A 3DTTA 1PR6A 3VTFA 2QD2A 4WZ6A 2YNMC 4LGMA 4EHKA 3CU5A 1S97A 5JFGA 3T5GA 4BO1A 5KFIA 1V3VA 3KAKA 3OM9A 1NFFA 1FP4A 4KWHA 3ICPA 5AP9A 1K2VN 3R3ZA 4ZVOA 5K0GA 2CDAA 1OFGA 4GBJA 4E5PA 9ICEA 3ICOA 1R9GA 3KPVA 4LOHA 3AB8A 1Y3FE 4OU4A 2F43B 1W4CA 4K3VA 5B4UA 3S4YA 1ID1A 4I2AA 1NM5A 1YS6A 1T8TA 4YG2A 3HJGA 2VHTA 5H70A 1N4DA 2KD1A 5CWRA 1CRZA 1U28C 2CXOA 3G0CA 2ZRMA 5EUCA 1DBSA 2AW3A 3VNBA 1XNRB 2R8ZA 1X14A 5TQVA 1E2HA 1WPQA 3LWMA 3NHKA 1FLDA 5H3LA 1Q57A 1TAHA 3SM9A 2XTZA 3E82A 4RLFA 4FMCB 3G6VA 3TRKA 3ELUA 3AK4A 1VIVA 5T4HA 3Q7SA 2H2DA 1JDTA 4A1OA 3RUPA 2QUJA 3EDRA 5ITWA 1J8DA 4KUGA 1RKQA 4MHSA 5AI6A 1M67A 1O87A 3B12A 1Z08A 3SZUA 3WV5A 1QLJA 4DNQA 4JYZA 2VDWB 3TRJA 3F96A 1VPWA 1EVEA 3CNEA 4Z51A 4DTIA 4ENPA 1T5OA 2QN2A 2J46A 4J16A 2IS4A 3O4JA 1NVVR 2J4CA 1XQYA 3LK6A 5F1KA 4IJWA 3EDQA 5CB8A 1UQVA 3K4HA 4PNZA 2F00A 3TZHA 1DLJA 2GF0A 2BTQB 5EI5A 2QN6A 3Q72A 1P1RA 4OX9B 4CM4B 1ISJA 5DRTA 4NBNA 4NG5A 2MSEB 1PUIA 5LXTB 5LB2A 5B5EU 1V3UA 4N48A 4RXMA 1JROA 4PAMA 3SR4A 2HO5A 3O8OB 4M88A 1QHEA 2AN1A 4QXPA 2WD8A 2G28A 3Q3HA 3QG5A 5DEIA 4MYRA 2I99A 3CVYA 3V1YA 2Y0CA 4FOTA 4MAFA 5EXSA 4YDRA 5ADUS 3UGKA 3K0BA 1CUAA 3E18A 4V2IA 4ARZB 4G09A 3JAWA 1ZJZA 3HUFA 5DYTA 4Z2YA 5KAIU 2AMLA 5C34B 4RV9A 1DKOA 5C2JB 4LWOA 3H6KA 4UUNA 2PUGA 4EB8A 2BMJA 1B6RA 1E1QA 3A6LA 5HZMA 2DKZA 3KJGA 2M9NA 3TADC 3LCRA 1E2NA 1JRLA 4XA5A 3AF5A 1UZMA 2QJOA 3W2FA 4KN4A 1VZ3A 4I2JA 3UBMA 5EJEA 2UVPB 1C9MA 4E0BA 1QO7A 2ZSAA 4OJLA 3OJOA 4QEKA 4XYMA 5IK2D 3UQ2A 5TJHA 3MCZA 2QM7A 3O90A 1R0XA 4BWMA 3V7KA 2H2GA 4J1QA 2GCOB 4F56A 3VAAA 3OQPA 3IEIA 3B1XA 3CEJA 1QZUA 4LRQA 1N0HA 1CYEA 2ZULA 3AU6A 3WFZA 5DXJA 3LVBA 3WI7A 2HJHA 4HO1X 2CV2A 2VKTA 4TMYA 1Y34E 4BQFA 3UXMA 5KNDH 5DLFA 5BWBA 5HMLA 1R74A 5DHSA 4HLQB 2W6JA 4DLYA 2HSEA 4DSLA 3HYCA 5IUJC 3G2LA 1P45A 3QVOA 4UHFA 3N0XA 3UKDA 4EX7A 1NYRA 3ZOZA 4EW1A 4UEQA 2EU8A 1E99A 2HA0A 3O1HB 3VHXA 5ARCA 1FPQA 3FTFA 3ORQA 3QPCA 3A1NA 1EXVA 2YKGA 1N9KA 3USCS 2AE2A 3HJFA 4LF7B 4QQFA 3TW8A 4N40A 5J5CA 1EXMA 1V11B 3GJ3A 4YO7A 3AP2A 2O3TA 2J85A 4Q4JB 4UVGA 4XTRA 3KHTA 3IUMA 4EUNA 3KYJB 3D8RA 3GMDA 1MABB 1NL3A 3A36A 4TLAA 5CBKA 2W2MA 2W42A 5T4FA 4OGGA 1QHHB 3GNQA 2D3WA 2V59A 2BFEA 2WD7A 2QTBA 2I9PA 4RM2A 3T52A 2R85A 1X7XA 4M8NE 2XA9A 5M29A 1JILA 3D54D 1TVEA 5AK0A 4ZYWA 2DKNA 2ZSHA 5L7WA 2FP3A 2X15A 1D2MA 3IDWA 3DD1A 3IIEA 3K94A 3N7RC 1OLXB 3NHAA 2DTEA 3ZVKA 1XVLA 2E87A 4LYFA 2P68A 4ERXA 5LJIA 4KLCA 4ECWA 4DRYA 5F4BA 3SOZA 3FPFA 5JAQA 5BPHA 5ECDA 3PHGA 1U0NA 1C8KA 1NLYA 3HL0A 1QKKA 4FR0A 4RHEA 2Q3CA 1QGYA 2JEZA 4ITRC 3FJ1A 3RB0A 2K8CB 2ATLA 2CXRA 4HT3B 1IN1A 3CY6A 3DEIA 1T0BA 5TIIA 1QK4A 2YBEA 4MR9A 4BLSA 2MAXA 4F3KA 2C58A 3AEZA 4FKMA 2D5CA 1O9GA 4DT1A 5SZKB 3W6UA 3KIPA 4PQYA 4P34A 2OYSA 1W75A 1KSFX 1B23P 1DEHA 3A27A 1T2CA 1IJKA 4QNLA 3ONDA 3ZE7A 5EE1A 1E9DA 2PUBA 3EPGA 4ATNA 5KFLA 2R7MA 5G1NA 1RHQA 1JBKA 1AKEA 1F8FA 3TQFA 4LJRA 2JLAA 1G1AA 1XPRA 2J6CA 3NJ8A 2EAOA 3DEZA 2NTNA 2X77A 4NV1A 2BT4A 5DM1A 821PA 1EFKA 2VXOA 4MRAA 2XB9A 2GEUA 2XNDD 3FKSD 5LBUA 3TIIA 2BFNA 5CG2A 2VJMA 3BQ9A 2OORC 3UK0A 3C14C 3JD4A 5EYPB 1PK1B 3DDCA 5AH0A 2LPMA 1L7RA 3M0EA 2OWEA 3KSZO 2BCQA 1Q3VA 5ALRA 2X7JA 4JA0A 5BQOA 3WGTA 5EIBD 4RELA 4R65A 1KO1A 2OFFA 5BPCA 4YY3B 3C8HA 1U0TA 1A9SA 1KE1A 4UHJA 4U3JB 1K1EA 3RC7A 4NIMA 2G9NA 4LSZA 2LBOA 1KJZA 1Z7WA 4MH0R 1MW8X 1BGWA 1WS6A 7REQA 1BRMA 1ATZA 2LDXA 4DLBA 1ZCAA 2WD9A 1CBUA 4CLRA 3ET4A 3HV0A 3K6JA 4C29A 4KFSA 1TZ2A 2RI1A 4B9MA 2I7CA 1YZKA 4L27A 5DIFA 3T5KA 4OI1A 3RU3A 3JCZA 3FOAA 1RQPA 1Y1LA 5FWYA 3NBYC 2WT4A 4DOBA 1V7CA 4JB8A 4JIGA 5HCUA 1N32B 5EIEA 1VFNA 1EE1A 2OGWA 4AP6A 3FN4A 4FZ3A 3RK1A 1NP3A 2C2MA 2A0WA 2W6ID 3H99A 1B73A 4RT2A 4J29A 1N0IA 1N3YA 4MMZB 2F1HA 1S2IA 2PO7A 1T6ZA 5DMHA 2QE6A 8ABPA 3SQWA 3R7SA 1V5WA 1KI3A 5AK3A 3B6MA 5CYFA 3GI1A 1NNLA 4LXTA 1F51E 5AKZA 1GFZA 1U9ZA 3B2EA 1W1IA 4RLSA 4DIDA 4Y67A 2BCSA 1DG3A 2MJLA 3Q4GA 4B0OA 2LDBA 4NR0A 4DC0A 3WK6A 3NT4A 1Z34A 3CLTC 3O8QA 3RB6A 3PFKA 4MULA 4TS9A 3THSA 1QG6A 2PRZA 2WUVA 2WAQF 2IBKA 3AWDA 2ACVA 1YVRA 3K4QA 3IEUA 1XNJA 5JU5A 4R84A 3AUKA 2FPOA 3DBHA 4UPDA 2JKVA 1MVOA 1Y6JA 2H3EA 1CW2B 1FFYA 1W5AA 5DDYA 1WWKA 4K9NA 3SJCA 3AVOA 4WY8A 1MEJA 3PFFA 4R8MA 5J58A 3A4IA 2R6AA 4UQPA 4R2JA 2QKYA 3NDIA 2O2SA 2EJCA 1H3NA 2FZCA 2GOYA 1UKEA 3O2JA 3UFXB 4JQOA 1J07A 2PKYX 1GNTA 4ZT7A 2X6RA 5HUHA 1CR0A 4KE6A 2QB0B 1CUHA 5JQGF 3MR6A 3AG6A 3AHGA 3TB4A 4U9IS 4ZJUA 3I42A 4P3KA 2GYVA 1XJQA 5KKNB 4G4GA 3GUUA 3UXHA 2W0SA 5F2EA 2I3BA 1FP2A 2JZNA 2HWWA 3RAQA 5KFWA 1A96A 2OXEA 4UHKA 4DF4A 1SUAA 4BX0A 4ND7A 1M2NA 4CMAA 3NQ41 2JF0A 3IT2A 3W5CA 3VH4A 3COWA 5IXJA 1A0OA 3S2ZA 2Y1OA 1TM3E 3SQXA 3HSSA 1E5XA 2EQAA 4AFNA 1U0JA 1W73A 3ZDFA 1IY9A 1KO5A 2IVZA 2GD2A 3SV3A 5KVSA 1V5IA 1MPTA 3IO5A 4Q0MA 4FT4A 1V9CA 2NYUA 5IC5A 2VSFA 4X3PA 4M22A 2GETA 3UKOA 1I8TA 2DQYA 4M1WA 1HRKA 3GUHA 3ZTTA 1A9XB 2X0KA 2IKSA 2GK7A 4DCSA 1D9XA 5K8CA 1JFFA 2HZBA 3G3EA 4EFKA 2K8AA 5HSGA 1HYBA 3G6YA 5EEGA 3FAKA 1R9MA 1JLSA 4YS6A 2W6QA 5G1OA 4UAYA 3KWLA 3ES9A 1LSOA 5F9MA 4F86A 1ZRNA 3AUJB 4RUCA 1BZYA 4RA9B 3TX2A 4WJLA 5IS2A 2GPTA 2JFUA 3R7FA 4DV5B 2A9RA 2J48A 4K0RA 3HBLA 5LKRA 4JL6A 4DWJA 5JVDA 3NEAA 4A0QA 1XRRA 1UFQA 2WSIA 3RJMA 2DKOA 3ORYA 4L50A 3PJDA 3K92A 3JTMA 2YJGA 3SJUA 1Z8FA 1BS1A 1CP2A 1WBBA 4GMKA 1DKNA 2WIFA 3CW8X 4YAWA 1K5HA 3PWTA 3GZJA 5CIQA 4ISCA 3ASVA 5CAEA 3U4QA 2LIVA 2FEWB 2C5EA 5JLAA 4TL9A 2E5WA 3RJGA 1VECA 3CCFA 4MI1A 1MFPA 2R65A 3GN2A 1ELOA 4MS4A 1QK5A 5CXSA 2ZI9A 3AI2A 4CIXA 1JE1A 3HCNA 1AB6A 1EWKA 4BCBA 4KJZA 3SKXA 5J2CA 4Q9IA 4YJ2A 2P7IA 2QX4A 1NFQA 4TXJA 1CV2A 1MA0A 3SFVA 4HSGA 3U1BA 3EUAA 3AIIA 2GERA 1EFDN 2GD6A 3H5OA 1ZISA 1EAYA 3KJIA 4DY6A 5B6IA 5GINE 2BFPA 4BTLA 3EZYA 2X7HA 2G1JA 2XQIA 1PS0A 2ZRLA 1M0EA 3IYLW 2RJOA 5F2OA 1QAOA 2H4FA 3B5EA 1IEXA 3QPVA 2WHPA 5GY7A 5LU8A 2AZDA 5IIMA 1W5BA 1U8CB 4B6FA 3SR6A 2IYVA 3OC0A 1F3LA 2JEOA 3E1KA 5JMWA 1A7AA 5GGYA 3Q2IA 4J3FA 3HDHA 2C4NA 2FEMA 4OXQA 2BMEA 4JDPA 4G0WA 4JGBA 1PGOA 5U9CA 4G0NA 1USWA 1J9GA 4M9ZA 5DG8A 3WMWA 4D4JA 3LGSA 2OV8A 1MAWA 1UIMA 2D5LA 4O0IA 5FBZA 1CSEE 1UMDA 3HV2A 1Z73A 5AJVB 3A0HU 1US8A 3D8TA 5CK4A 3VOAA 3ONFA 1NWHA 4U0KA 1FSFA 3T5BA 2BFWA 5BV0A 4BNKA 5FV4A 3UMYA 5JCJA 4M1KA 1O4VA 3VC2A 1VG0B 1E1LA 2BW0A 2C0QA 4CKWA 4RPIA 3CEMA 3G17A 2DKXA 1U8EA 3Q3GE 2EWVA 4CMKA 2HU8A 3AEVA 2GM4A 1A77A 3JRNA 4R0VA 2Q4DA 2DY0A 1Q17A 3ZX4A 4NLKA 4ZCSA 1XDZA 3Q15C 3UNXA 3SMQA 3EFBA 4WK2B 1X0XA 4C5CA 2VA3A 2RKWA 4ECVA 2XNKA 4FI3C 1LLDA 4EY6A 4E5MA 3KLNA 5K3EA 4PGHA 1EBBA 3L79A 5AD1A 1H0RA 3INYA 1SUFA 2OA0A 4UB4A 2JGIA 3GLHB 1Z5WA 4F21A 5CB1A 4F5EA 1H05A 4BB0A 2PT6A 1XT6A 4AAYA 3OC6A 4TTTS 4DUGA 4K6HA 1KXZA 3SEFA 3UJ6A 4HXEB 1XRQA 2HBMA 1C4OA 1XE3A 1LJLA 3PQ2A 3KNZA 5EHIA 3NJ4A 3LQ4A 3EXFB 2GK6A 3NAMA 5KAPA 4Y6QA 1Z5VA 4TT3D 3N05A 2B36A 4PFKA 2EKLA 2P40A 5CLFA 2G9RA 3LYUA 3EAFA 1C7JA 4DSAA 3E22A 2BGNA 4UB1A 1WO8A 4Z4GA 2ZRJA 1E59A 4Z1OA 3IKMB 3ZU5A 5DTJA 5GJVC 4BVLA 3BQ1A 4JU8A 2V8BA 4KQIA 4G1UC 2ZUSA 2PS0A 1TYDE 4TTSA 2A9VA 5F3XB 2YJTD 4CL0A 2I2BA 2D8MA 3EARA 3W8NA 1CR2A 2PPVA 1VSQA 1UC8A 2IOQA 3G23A 1R8SA 4FGWA 4BWVA 4K6CA 4RS4A 1U9YA 3V9PA 4GC6A 1DTEA 2PYIA 2H3ZA 1NDQA 8ICTA 2G88A 3Q8XB 3DCJA 2IIPA 2A33A 2DQZA 4GXRA 3GLUA 1I0LA 1BS9A 3TLMA 2IXEA 1Y6ZA 1N56A 3DZ8A 3PC2A 3NC4A 2WYUA 1HJPA 1OXKB 1M2WA 4BPBA 1FP4B 4PSAA 5HHIA 1STOA 2XMZA 3PNVA 1M75A 1D07A 1LDGA 3OCYA 1FYVA 1P61B 2HMAA 3AILA 1EQUA 2GB4A 2QYTA 5BN3B 3IV9A 4J1TC 3VOTA 3JY6A 1SC3A 4GKJB 1YZ7A 1ZSNA 1VHWA 3O4VA 1XZFA 2YCLA 5EY5B 3OPQA 2ACEA 3K20A 3WLLA 1UOOA 1X15A 5AMXA 3DFMA 1VCIA 3KQVA 2GAJA 2VJAA 3H4TA 4OGKA 5ECGC 3CUVA 3GQBA 3H87A 4BZWA 1SKWA 4QZCA 2WU0A 1QAQA 4IUDS 5KFZA 2OD9A 3TMAA 1NT4A 3KK0A 1KYYA 3V8RA 3NXKA 5GV8A 4P0TA 1NK9A 1IY1A 4HNVA 1V97A 4GPZA 3L01A 4FHZA 2QX7A 4TYNA 4AW9A 1P19A 4CM4A 5C31A 1A1SA 1YS1X 3DFIA 3TI7A 1WPXA 1ZCFA 4JB0A 4BWGA 3HT3A 4JU9A 5DHTA 4H7PA 3FYCA 1NVVQ 3VDQA 4POAA 3WB9A 1JIJA 3NBZC 5CVUA 4UARA 1ZR2A 2KK0A 2NGRA 1JSXA 5IDWA 1XHEA 3NKVA 3W2TA 3LC2O 4IQVA 5EJGA 3IP7A 3S2YA 1Y4UA 3ZY6A 5IF9A 3VJKA 2W2TA 2BFBB 2PZEA 5LYYA 2R25B 2AEFA 5C46F 5J2IA 2QZZA 5BMVF 3COJA 1OFUA 2ID8A 3CRNA 2D00A 1B16A 1YJBA 3JQ7A 4ZYXA 3T41A 4UC0A 5HWSA 4AIIA 3MMNA 2A2ZA 2PD4A 4MUMA 5EIAA 1GILA 4Z1MA 2V1UA 1BE0A 2PZMA 2UVPA 4S24A 4EA8A 4OCZA 3VXKA 3N2GA 1UPUA 1VIYA 1AZTA 2JI7A 3EXHC 3UN1A 1DT5A 3AOGA 1Y8CA 4H3HB 1RI3A 2C7OA 3JAWB 2BFCA 2YW2A 1ISIA 2ZS9A 1R8QA 1RYMA 2VG8A 1OB5A 1K06A 1HDYA 4EG4A 3OJWA 4UBLA 9ICVA 4IVNA 3P0JA 2PIAA 2WKWA 1G63A 1G9SA 4N5MA 4K9KA 3KD2A 3PX7A 4CCHA 1LNQA 3QOWA 2HHCA 1SY7A 2VPYA 4OVKA 3UQ0A 1ONNA 3Q2KA 1ZJ5A 2BHNA 3QKRA 3EGXA 5BOVA 2H16A 4U7TB 1KY3A 2AK3A 2AL7A 4RQTA 3UKJA 2VPIA 5LM3A 3AZQA 3PMLA 1F1BA 3WQBA 4IPTA 5JG7A 3V6HA 1NBOA 4RTMA 4HH1A 4QDZA 1GR1A 4Q4JA 4O0LA 2V9ZA 3IJ5A 4IV8A 3D7SA 5DSXA 1PNVA 2OP0A 4A4DA 1O95D 4NK5A 1Q14A 4XOIA 1LK7A 4GMFA 1AXGA 1OGJA 3OQBA 2P8SA 5AIBA 2F76X 5H1YA 5K99A 3VHXB 2BZFA 4JOSA 3ZHYA 5DN9A 1IN4A 5AVYA 2KZ3A 3GFQA 1ZNXA 2ZUFA 4MW6A 2PH7A 1BMTA 1H38A 2QL7A 4MWSA 4YAEA 3VHQA 4XR4A 1YZ6A 4F2DA 5B36A 1Z68A 2XUGA 3H97A 3TW8B 4Z6EA 2ZI5A 1BMFA 4MVJA 3A6HA 3HJRA 5IF3A 1EB8A 3DYIA 2RE8A 1L3IA 2A7QA 4QXAA 3ZWVA 3F6BX 1JEEA 1H23A 5LA6A 3GJ4A 3WGKA 2PUTA 4L7VA 1OTYA 4F1KA 5KNBD 3BC1A 5IRCD 2BFEB 3V6JA 2WD7B 5TRTA 2K2QB 4TS3A 3M6WA 1SVUA 4PNPA 4G25A 3G0OA 4GSKA 1WB9A 1X7XB 4RQ0A 5JRDS 5KMGB 3W6PA 4JMPA 2VS1A 4PONA 1E2BA 2AJTA 4O3SA 3R3VA 3WV4A 3GOHA 3RSQA 3UM9A 2WA2A 4BRZA 9ICUA 3TS1A 1D04A 2KSOA 1SURA 4AJ2A 2RONA 5AVRA 3FOZA 3K31A 3RFTA 3EWSA 3LQYA 1HE1C 2A1JA 3D4NA 3VFDA 4Q5IA 1Q5PA 1Q3UA 3FFBA 3AO0B 2RKOA 3VDRA 2PD6A 5CB0A 3CNQS 4UZSA 2G72A 4MR9B 3IHKA 4Y30A 3WNCA 3RJJA 2OWDA 4FBGA 4RF5A 5TPWA 4LG1A 1N5LA 5ESWA 4QXOA 4DT1B 2YJNA 3W7AA 3KOWA 2CDBA 2AQIA 4X3CA 3C8DA 1IEWA 3ASZA 3L8GA 2RG7A 3T5MA 2R4TA 1WTCA 3BGIA 3IERA 1XZDA 3FHJA 1MA3A 2BCUA 2AHRA 2ZE6A 5F76A 4UQOA 3NS1A 4KAXA 2PFSA 3WR5A 4U3JA 3LPNA 3PY8A 2DL0A 1ZA2A 5EJ5A 1RE1A 3A37A 1HE4A 3H2GA 4AYTA 3PHHA 3D2LA 2C20A 3A1FA 2KJ5A 1FE8A 4DSOA 4I2BA 1K8RA 5L53A 1LDBA 1NV8A 5BSHA 2GXSA 2KHQA 4YDHB 5DLDA 3WWDA 5MF6A 3VR0A 1IN6A 2VT6A 4EJSC 4PFSA 3I0NA 3PNBA 4GP9A 3DLPX 1OWLA 5FQNA 1WRBA 2I8CA 4AWBA 1L2TA 1CG6A 4PX3A 2H2WA 2OE2A 5HE9A 4GFDA 3ZJ4A 2H5IA 2P2YA 3CG4A 4ND1A 1HEUA 1H6AA 5C8ZA 6REQB 7REQB 4E5KA 2YJZA 4RANA 1KDZA 1HE2A 3JALA 4X7RA 1CRPA 4Z49A 5KFSA 2W55A 1PK7A 3BPSA 1EHCA 4LY6A 2LVBA 3LPAA 2IP2A 3TQCA 5ALEA 2NAFA 2HMWA 3PPYA 3WGJA 3P96A 4KV7A 5FWYB 4OMFG 4R1MA 4Q3CA 5B1EA 4ZGBA 4AY4A 1Q2XA 3HN6A 3WQRA 2PN1A 4WV3A 5C8VA 5CMLA 3ZW9A 2IGTA 1Y9JA 2V58A 3CTMA 2WWIA 2Z6UA 1WLYA 4EHAA 5B4VA 2D7DA 3ZUGA 2P3OA 4F4YA 1PDOA 2B20A 2GN0A 4CHGA 1RM6C 3DMNA 5BNWA 3KZOA 2QI9C 4JKYA 2PWZA 5ADWA 4L0DA 2OBLA 3EMBA 5AJTA 4JJ7A 4HHEA 5F33A 5H81A 1RKUA 1X7YB 4QWMA 4G5GA 2LR0A 3E58A 2HEIA 2ZT7A 3JVEA 1OUQA 3HKDA 2ZRGA 4C22A 2OXFA 4XIGS 5DEOA 4R9SA 2FJUA 3O8QB 3P9PA 5BSEA 2DQNB 4E4TA 5L6MB 4GH5A 3DBIA 3RU7A 4NFLA 1PT9A 2JIRA 1EBUA 2Y0BA 1FDRA 4M38A 2ZBFA 2DETA 2D6FC 2OHFA 2AJLI 3K8QA 2JFZA 1QYRA 4YAJA 1PRYA 4Q4AA 3B9QA 1ZW1A 3O4RA 4ZQBA 3E4CA 2F1JA 5INTA 1D6NA 2LNDA 2YWRA 4I81A 1AGXA 2D13A 1NULA 3H7IA 3I3SR 2O3UA 5I4KA 4O4IF 3S0JA 4FGKA 1NUAA 1CJSA 3N8DA 2YDXA 2AX4A 1U7XA 5B30A 1C41A 2WYWA 1ZUWA 3HZZA 3ENQA 3DWEX 1YZGA 2O7RA 4YQEA 1D2HA 5IXYA 3ZDEA 2HD4A 3E9NA 2R96A 4GXNA 1OU0A 2ODQA 5JO9A 3ALRA 3DL7A 3FZGA 1XALA 4L76A 5GJWC 1XWIA 2JL1A 1E92A 3IUYA 4OJ5A 5CYOA 2Z98A 3CB4A 4R1SA 2HSDA 3IVMA 3KEMA 4O4JF 5ICSA 1P7DA 4ZOQI 2HNAA 1IFXA 1YE3A 1Y1KE 2R6GA 3IN5A 4Y9DA 1GPJA 5HOQA 4Q48A 4S2EA 4ZMBA 2AUNA 2OTCA 4LHVA 3D8BA 3ZIAA 4K9DA 4NG4A 5L3QA 2G04A 5KVCA 4HJRA 5DHFA 2IYRA 1NVAA 1I3LA 1WTAA 4O2AF 4P7BA 1ULSA 4NL9A 4DNPA 3LVFO 4QUJA 1JPUA 1LRJA 5JAHA 3O0TA 4IHAA 3QEKA 1N5XA 4HP8A 5E1MA 4LVUA 4ACOA 2Q4EA 4AJJA 2PL9A 1U7PA 4MLDA 3V8PA 2FMPA 1NU6A 4AG3A 1E2MA 5E6SB 3D4IA 4DQKA 3R9IA 4NEGA 4RF2A 1JL3A 1JR3D 2YWGA 3KFXA 3ZHCA 5JVDB 1WDWB 4LJSA 3GPDG 3HZOA 1E2KA 2CXXA 2BJWA 2WYIA 1UEJA 2HHXA 4LDNA 4PQEA 3C5HA 5SY4A 4KQMA 2CLOB 3L1KA 3FMFA 5KS2A 1Y7HA 3LQ2A 2HXYA 4N12A 2HXSA 2CK3D 3V2UA 3I39X 2EP5A 1ICIA 1Y6GA 4IDCA 4NK4A 3U4QB 5JYDA 4FILA 2HMXA 4DBVO 3QMVA 2BFDA 1JIIA 4MS4B 5TMEA 2O52A 4DLWA 5ALIA 1SCUB 4R7ZA 3DDSA 5ALDA 1JECA 1CQIA 3BH6A 4YJ2B 1WY7A 3B6EA 1RKXA 2DRIA 2FEOA 3UPDA 3R3SA 1BVUA 2A59A 1QG2A 1QIHA 1T8UA 1H9AA 5DNVA 5ELMA 3GLGE 1MTOA 1SBHA 2BUAA 4DABA 4YCSA 1V45E 3WLAA 1N1GA 2H52A 3OSPA 2WHPB 2YY5A 5EPEA 4C4TA 1ZMBA 1OXTA 3VDNB 2ZJ5A 3C8MA 5GTIU 1CZRA 2A9QA 5FTJA 4NS1A 5F9HA 2B5OA 1V4NA 1U1FA 1V8ZA 3QYJA 4W6QA 3TIFA 4CLDA 1HDGO 5CX4A 2FPKA 3BUSA 1WZUA 5DISB 2CXYA 1H2BA 4BMPB 1Y33E 4IGEA 2CZQA 1OI4A 3HBMA 4IQFA 1S2GA 4RPXA 4XVCA 2BBWA 4UVHA 4F4WA 1VCMA 5T3YA 3FFTA 4ZARA 1UMDB 1M76A 3PEFA 1ZVKA 2YXNA 2P6MA 1US8B 5CJ2A 3BXHA 2IOYA 2VSNA 4AICA 4L8YA 2ZB4A 1G98A 2W6PA 3DV2A 1CS4C 3A9UA 1KS2A 1PV1A 2G7MC 5KYWA 1W0JA 2CXSA 1C7EA 1ZMTA 1DAEA 3IMGA 3PIIA 1BE1A 2BIFA 4W9MC 5FL7D 4NCHA 1PD0A 2QW0X 5DT2A 2I4NA 5K0JA 4W6ZA 1FTNA 3HB1A 4GUAA 1U2GC 4FQ5A 2GA9A 1IXSB 2WTEA 1LC0A 5AM3A 3BMNA 1W6UA 2OCLA 4LV5B 3JWIA 4URWR 2F44A 2XAUA 5EQJB 3VR4H 4U7GA 3W9YA 4AB1A 1SHZA 5CH8A 2PBRA 1CJCA 2YUIA 4DRZA 4WZAE 1BNOA 4JBGA 4EZ6A 1ZAKA 3TPZA 4BP3A 5K6RA 1PWYE 4USAA 2PWBA 2RK3A 4IDGA 1VOTA 2JI9A 3OWHA 5IAOA 4LSMA 2H9AA 5LN1A 2H1CA 1DEXA 3PDJA 9ICKA 1AU9A 2C5FA 4KI0A 4IDOA 3L5KA 2XHEA 2XYQA 1ZH6A 3VA7A 3VU8A 1QNFA 4AJHA 1C9NA 1XTJA 3VZCA 3UAVA 1UKBA 3LKDA 1LV7A 3G2OA 1FK8A 1NIPA 1NP7A 2WSSD 4LX8A 3JSXA 3RANA 5ALXA 3L7BA 4QPCA 2Y05A 1PSWA 3BQ7A 2O5VA 1UPXA 1L7EA 2IPAB 3QNWA 4DXAA 9MHTA 9LDBA 2NMVA 3MJTA 3DAFA 5A3QA 3VR3A 1YQDA 3BZWA 3K2QA 4PC2A 1NT2A 2ZYDA 3E22B 3L9XA 4E15A 1MO4A 3N6XA 1FW8A 1IBRA 1SC4A 4M9SA 3PXXA 1IN5A 1J39A 5F9LA 2P2SA 4G24A 2B9EA 5K0NA 5I7WA 5G02A 4OKSA 3T7JA 4JL8A 4ZQFA 1FDTA 3AY0A 1FL9A 3S44A 3PTAA 2UXDB 4CLOA 5GZ1A 4OLAA 5BN3A 2BRUC 4HQKA 3FJOA 1PZHA 4BBPA 3LYHA 3GAAA 1U3GA 4TTPA 3A32A 3FNFA 1Z5OA 3NONA 2R00A 2WM9B 4RV4A 3LXMA 2F3RA 3PD7A 5CCDA 1Z39A 1DBVO 3QKWA 2C2YA 4BTEA 1B0PA 4K6GA 5LP6A 1BWQA 1THMA 5E4JA 4NSNA 1X70A 2G8NA 4EHJA 3MGHA 5A5FA 1ZHFA 4JJZA 2IU3A 4JZKA 2B30A 1VSUA 1T94A 4F71A 4B3MB 1XTVA 2DPYA 3V8VA 4KLJA 1JIQA 3YASA 1IIBA 5E9WA 5FWDA 4GMDA 2VJDA 4KPGA 3FLAA 2BCVA 3DLAA 1G4UR 2WIKA 1U65A 1S7CA 3QEJA 3OQNA 3DKVA 3GQBB 5BO5A 1ADBA 2BFBA 5GJCA 3RF6A 1E5LA 3L7NA 2KWIA 3ISCA 1K7EB 3PQEA 2C84A 2ZWVA 1J0XO 8ICXA 3A7DA 4YDQA 3P9RA 5KSPA 2UKDA 1IWBB 4V0MA 3IQEA 4HUJA 4DQSA 1T0PA 3EYZA 1ZQOA 2YYSA 1Z4IA 1ZK1A 3DXYA 2DERA 3OH8A 3FTEA 3W5JA 4C2TA 2AI3A 1I9GA 4NEHB 4ZXPA 1Y88A 1U8UA 3T7KA 3FPGA 2H6EA 5A7HA 1LKZA 1GYQA 1EXNA 2YWXA 5J2TF 3A70A 4MKXA 2FHPA 2KBFA 3HDJA 3RJEA 4URUR 1GSAA 3T1YB 2ZJBA 1BXGA 3IEKA 5K7SA 3TH5A 5EXEA 2JLBA 5K51A 2C8JA 4KQ9A 4MV7A 2NP7A 2YW9A 3EZLA 4LJYA 2H3FA 3OOYA 3JQ7B 3ZW8A 1ECPA 4UM9D 5JMPA 2X1MA 3AYXB 4MKRA 4NAVA 1I7SB 2QVYX 1ZDMA 1IEQA 4DCNA 3ZNPA 5J4VA 1JAZA 3H4MA 1DC3A 2A84A 2EL7A 3QE9Y 3Q8LA 2HHSA 1GGJA 5ALJA 3N2GB 4JLAA 4KYTA 3H3XA 3BJMA 4JWMA 1MX3A 2X13A 2XYHA 1X2IA 2FMQA 1UBGA 3ZDYB 5JDCC 4JVMA 4FZLA 1NZFA 1QHNA 3ZS9A 4AG5A 1THZA 4NRDA 1LZLA 5JS6A 2BFCB 4YFKA 4U5XA 5H4GA 4B82A 2G8LA 1P74A 1Y7TA 4RF3A 2JGKA 2IOHA 4H4DA 4B3TB 5LQUA 4UPVA 3JZAA 5FBWB 1EMDA 1B3RA 1AZSC 1DRGA 3WIDA 2MYTA 4AX4A 4EITA 1TAUA 3CJQA 3DKIA 2R8YA 3FTQA 2ZJAA 1M3SA 1LQ2A 4GPTA 3QVUA 5A0FA 2ZT6A 4XRGA 2AU0A 4AJNA 3QKRB 3EGXB 3TK1A 2HDHA 9ICJA 3GLTA 1EUZA 1SPBS 2H0QA 2VTEA 3VOSA 2WPNA 1KPIA 4BKOA 2C5AA 2D1QA 4ZAXA 1KAHA 4IFBA 2DMRA 3GPIA 2GJKA 2IHVA 4LSWA 2HGSA 2NRTA 3D0RA 3DNFA 2KB0A 3L0YA 1JQJC 2O8EB 1Q46A 1DJNA 3R5XA 4MW2A 4KN6A 4GXKA 1K7CA 4MVJM 4I19A 5EN4A 4WXEA 2PAFA 3WAKA 2CVPA 3MWEA 2IZ5A 1D03A 3FNBA 1KQNA 5JZMA 3QQPA 5KMGA 1X9MA 1Y81A 3MTAA 1ZGHA 2WJPA 3R0XA 1DRKA 3V9AA 3AU8A 1FS6A 3Q8SB 4TN5A 4CW7A 2KW5A 2WVAA 3WYGA 4PRLA 1R0LA 4LZOA 2OYYA 3IP4B 5LLSA 4LJXA 4LF9B 1FRZA 2O2CA 4E7OA 4YWHA 5LA6B 2IV7A 4LZNA 1SU8A 2XF2A 2ZYHA 4PN7A 2LTAA 4ZFNA 5F2KA 2RH5A 2LGJA 3AEKB 4YPOA 4TQSA 3FUXA 3HCDA 3SZLA 2O6HA 2H3VA 4YJDA 4CPDA 3HMQA 3UMBA 3WLFA 3PVCA 3HFSA 2EYQA 2BGJA 5CRXA 2H51A 3NBXX 3RVPA 5D87A 1WDTA 1S3IA 4H7JA 2KSOB 2DPLA 1QIIA 1HNZB 4JROA 2Z04A 2AZMA 4PC3A 3V4RA 1K5PA 3BOSA 4DCPA 5JARA 4J7XA 3EY4A 4LVOA 4BO9A 1UBCA 3VC8A 4HLNA 1JG3A 2A1JB 2XMBA 2ZM5A 4YVZA 4UE6A 4P86A 4HYKA 3F49S 1NUSA 2Y66A 3AHEA 2ODBA 3HYNA 3H13A 4HNAB 5HGJA 5HKLA 2ZTHA 5TPWB 2G76A 1G19A 5HG0A 5IT9A 4KXFB 2NVBA 3B78A 1TU0A 2WJZB 2NO7A 5A7GA 3U80A 3IUPA 3MFQA 1GWNA 4YRLA 1XEAA 4EWLA 2WF8A 1SD2A 3ITNA 1QV9A 3IOMA 4JOBA 4MWTA 5L1LA 2C42A 1GZSA 3EZXA 3PFHA 3VPBA 2JI4A 2QZSA 2V7WA 1W96A 4HEJA 2OHJA 4FQ7A 2AWOA 3L43A 1Z16A 5C1PA 4UTNA 4JR1A 6REQA 2FDRA 3NOQA 3DTVA 3MZ0A 3IKLA 1KEKA 1WZCA 2ERCA 5JJCA 4M8IA 1UZLA 3RVSA 4CKXA 2OCKA 2N46A 1CJVC 4KDCA 2Q9BA 4PPNA 2CB9A 1YMUA 2VUSA 1I2BA 1DUVG 4EPVA 5DI3A 3L4BA 3EIQA 5AK4A 4LRTB 3EJWA 2QM3A 1VRVA 1C2YA 4P4MA 2FEKA 2QRZA 3F74A 4EHFA 1U5BA 1KMMA 2ZWAA 1N7HA 3JZIA 1G4AE 3M1AA 3I28A 1Z0AA 4R1QA 1HQDA 3JALB 4RADA 6Q21A 4V0RA 3CONA 2FFBA 1ZYUA 4DLXA 3HY6A 1JDVA 4WNAA 2FZWA 4DQQA 2DH6A 2QG4A 3PSAA 3KG2A 3BXGA 1QIGA 4E07A 3Q7QA 3ZWXA 1X7YA 1XMIA 4G07A 1IK4A 1W2WB 1W9HA 1ZHOA 1CETA 2J3EA 3NXSA 2QG6A 4MINA 2FV8A 2PH1A 1E64A 2BKAA 2MYNA 1NK4A 4YRCA 5A5VA 3A4NA 4KNYA 2PXAA 1KQOA 2Y93A 4XGNA 1YGPA 4ZVRA 1NJ8A 5CM2Z 3PU6A 4EO9A 2OQIA 4EYEA 1HQCA 3MTQA 1P39A 3WOHA 2B21A 2GBLA 3G5UA 3B82A 1AN9A 4DWIA 1OQAA 2UDPA 121PA 3PGXA 1Z1BA 4CT4B 4KMUA 5K6AC 2V65A 2XY7A 1QRSA 3HLYA 5KT2A 1CPYA 4FONA 2CXPA 3FXAA 4AJKA 3VVMA 1CQXA 3HKDB 3ESCA 1KRHA 1XYGA 2HK6A 2GTPA 1ESEA 1S3SA 2PWAA 1G8PA 2P9YA 1Y4AE 3P9XA 4Z3OA 1CJKC 7ICJA 4BNHA 1DO2A 3U09A 4RBNA 5MFPA 3DZIA 5KFNA 4B2LA 3DZGA 2HBLA 1VKZA 3SQOA 4BFVA 3IPXA 4I27A 3SC6A 2PI4A 4Q4AB 5JWRA 1W5TA 5HPYB 3T3FA 1ZQVA 1E6EA 3SAGA 1HMYA 2GZDA 3NVVA 4FDUA 3MJ4A 4R69A 2ZANA 4IIVA 4YCJA 2ZBEA 4UOZA 3EQ9A 3EYWA 3OEYA 5D7BA 1UMCB 4F3CA 3QPDA 5DBCA 1YJQA 3SENA 1LFAA 1MZPA 2G4CA 1Z74A 3IG8A 2OV3A 1Q50A 8ICRA 4XPIA 4PRZA 2NN3C 5JFOA 3WIEA 4F5WA 5ADHA 5DB7A 2YIVX 4ZO4A 4W63A 4YQWA 3K9BA 5M04A 3RBZA 3QY0A 4MIKA 3VNRA 4DJDC 2B98A 1KL7A 4O08A 2FFJA 5FO0A 5EZYA 2AVNA 4P36A 1ZBQA 4B9EA 2AKAB 5IWAB 3L4JA 2H9YA 1BIFA 4ZVMA 4FFBA 4H1TA 2NQTA 9ATCA 1ADFA 4CTNA 4PYJA 2BGRA 1JYEA 1E2DA 4NMHA 1IWPB 1SJ9A 5KQGA 5F77A 1VE6A 4M0DA 2ZB3A 2DFTA 1X42A 1W29A 3U26A 2X14A 1HMPA 4Y6LA 1VM6A 2A0KA 3V4LA 3S6JA 1E20A 3FLBA 5E6SA 4KWCA 3SEQA 3WL6A 5F5XA 2AOTA 1CJBA 3H9GA 2BD0A 1U4OA 3BZBA 4ECQA 2G7ZA 3L6CA 1K4MA 1U3VA 3TTSA 3KAJA 1A6SA 4IO1A 1S76D 3UH1A 3PQFA 3ZZ1A 4RQ6A 5L3QB 5GJBA 1JXMA 4GYYA 1DAHA 4WKCA 1ZJWA 2VH5R 3FDSA 4KFCA 3VUFA 3I52A 4MUIA 1XP5A 4CQLA 4Q24A 3GL9A 1HT0A 2BISA 3L1JA 1JXQA 1ZQMA 1UK6A 3GJZA 3PO5A 4NVRA 1O94D 2RGGA 2GO1A 1N1MA 4AS3A 5LQRA 4J9LA 3WRXC 3H8JA 2HK7A 1SKBA 2IZ7A 4AYBF 2HM7A 5KBYA 3U2QA 4QYIA 3ZV7A 1SCUA 2O5CA 4GKAA 2VTVA 4B74A 4P7KA 3NGXA 3V7FA 2XYVA 4E1BA 3CC8A 4JP1A 3OIYA 2HOIA 4QAQA 4UXIA 1JKXA 2VTBA 4MEYA 2GCIA 2KFNA 3MPUA 4AUEA 2HOQA 2WF9A 2AXPA 4TTIA 2VP5A 3OICA 1G5FA 5K8IA 2P2LA 3UMVA 2ZB7A 2KBEA 4JLOA 3Q10A 4RO0A 1UPFA 4YXFA 4PN3A 3BDVA 1JHYA 3OJXA 3OI7A 2A5JA 4AJEA 4RJJA 2BFDB 4ZWNA 2OLJA 2QP3A 4R6WA 2GBGA 2P2CA 3B6JA 3ZW7A 1M6WA 1WBJB 4DSNA 5L6LB 5J2EA 1V7ZA 7ICFA 1XKLA 5ALYA 1E98A 1EJBA 3DT9A 1CQIB 1J22A 3NDJA 5LQJA 1QB8A 4OQZA 3PR2B 1TYBE 2HSWA 4R83A 3NAZA 3ACBA 3BH7A 4NECA 4JJ6A 5KYYA 4ZOLF 4QO8A 1UOPA 4B3XA 2ZIVA 6YASA 2QDKA 1O6FA 1W35A 6ABPA 4URYR 3RB8A 2DLNA 2QF7A 2JHPA 3QSGA 3KZCA 2EQ5A 3TRIA 2Z57A 3BT7A 3ZVMA 1U04A 3H2BA 2W54A 4FBUA 1K8XB 3VU1A 2CVHA 1A5SB 1N0WA 3D9QX 3EK2A 1NA5A 3NDBB 1LW7A 2QW1A 1U0BB 1YQ9A 1M10A 4YP0A 5A5DA 1S01A 4G1BA 4NU5A 4W7HA 2QD1A 4CUJA 1GGHA 4Q37A 1I14A 2EJBA 3LUPA 3U3RA 3KXPA 2Y0SF 4EF6A 1DIHA 2B1JA 5E1OA 2F4NA 3PXGA 5AT1A 2ZROA 5KUTA 3KLPX 3ZR4B 4OBWA 3SDSA 1W19A 2HZ7A 2CV1A 2D5AA 3GDHA 2IU6A 2JGMA 3LHDA 3IE2A 4WJZA 3GLVA 2P6OA 2DBZA 3AFNA 3QWBA 3OIWA 2J30A 2WMNB 4HGQA 1YZNA 2CBXA 3LWLA 4CM8A 1PGNA 1E6CA 2AXTU 4PLFA 3TRDA 1ZJ4A 1P1BA 2UYQA 3I64A 4B45A 1AGYA 4NULA 1AY0A 1QCCA 2YNMA 2Z1NA 1CY0A 2H48A 3EXG2 3IESA 4X6YA 5I9MA 3IT1A 3FHCB 2E8MA 3JD1A 2ZAIA 1UM9A 5KYWB 3O9VA 3M3DA 4BFCA 2FJPA 1YKFA 4M9QA 4URHA 5A04A 3KU1A 3AMZA 5ER6A 1AC5A 1A27A 5L1MA 3RJZA 2I67A 2QR3A 4TVSA 4MDFA 3BMNB 1U28A 3JQQA 2B3TA 1DJQA 3VR5D 3WB2A 1AGNA 3NYQA 2J31A 1E60A 3I9MA 1GN9A 2H08A 2WYOA 4I1IA 5JWHA 4F4FA 3BE8A 3HN2A 2D5IA 3QJGA 4HGRA 1YBVA 3GGPA 4ZCLA 3A2KA 5C53B 2BPFA 3WBFA 2KX7A 4DSIA 3D5QA 3BIJA 3FSEA 5JIBA 2A3RA 1KZHA 4OJNA 1T0IA 1Q77A 2WI8A 1EGHA 1U3TA 2GYWA 2NZJA 1BX0A 2QLTA 4GDFA 2W8BA 2FMUA 2PD3A 4IIJA 3DEHA 5I5GA 2D1TA 1CX9B 2DHRA 3ZVLA 2L2QA 4DPMA 2CNOA 4JT2A 1MUUA 4AZVA 3QA3E 2RB5A 1UOEA 5CFMA 2PKCA 3A9WA 3T5AA 4PXYA 2J87A 3HE3A 4JAVC 4JP3A 5ALOA 3EPRA 2UZ3A 4I4LA 5CW2A 3I12A 3TZ6A 2NUPA 2MR6A 3NC1C 1IOWA 3D7NA 3AM5A 4K9LA 4R64A 5IASA 1OKKD 4CLOB 3OOEA 4PZLA 2G9VA 5AHRA 1U9LA 2VPPA 5EMHA 5JU6A 1TCCA 1SU4A 3IVCA 3NYIA 1Z38A 2AV6A 3ERCA 4JVOA 4M98A 2BCGY 3ONNA 5BN1A 3OPXA 3WRWA 4YUXA 2AKYA 1OH5A 4UNSA 2BCEA 3PUWA 1W6RA 2FFQA 1NBEA 5LP6B 3TADA 4NLLA 1MAHA 2WQZA 2Y4OA 3TLKA 2E85A 4EP1A 1JHOA 4NHOA 4NZMA 4IDAA 4JT4A 1Z0ZA 1SD1A 1G64A 2GHTA 2XGOA 3Q3CA 5JISA 4RTSA 3TTUA 1UFRA 4QUHA 4AUNA 3R77A 1ZAYA 3UK7A 4QJ4A 2XITA 4WIAA 2XB2A 5ECYA 1F2TA 3G6XA 3P2KA 4DM3A 1XCGB 5DM4A 3S2GA 3ZY2A 1TAMA 2GMWA 1QUEA 1JRPA 4N01A 4Q43A 2MU1A 4PYRA 3WJ7A 3O26A 2ASLA 1P72A 5LD2B 1TTHA 2Q5EA 1P2TA 1GNPA 3G0BA 4HNRA 3UAYA 3O95A 3QEMA 3HBJA 4GUDA 5ICEA 4RGBA 3EQ6A 3T7DA 1L5FA 2I55A 4XM2A 3Q3IA 4F8EA 4C0WA 1KI4A 2V7UA 2PKRA 4EG8A 3Q8MA 2JAUA 1C80A 3ISTA 1RBQA 2PJZA 2O2JA 1N5RA 2IP1A 4DCVA 3EVBA 4MW9A 2Z2IA 3DMGA 3OETA 3STVA 1C0IA 5E4YA 4ZCRA 3LT2A 4ZT3A 5BWLA 4HBZA 4W5HA 4ESEA 4G65A 4D8VA 3CF4G 3ZH2A 5AVVA 3HUDA 4EATA 1K89A 4PS0A 3F4LA 1BXGB 4MAMA 3UT5B 5KCZA 1XJWA 1T3QA 4GX0A 3W34A 2ASJA 3F5FA 1N75A 2R4UA 5JHGB 2ZUTA 3RB4A 1KC1A 4ALNA 2ZUUA 4K9MA 3HNOA 4JNKA 2XBUA 5LNK1 4YHBA 2PFPA 1XLTC 5GM2A 1KGDA 2AMYA 2ANCA 1YFKA 4QOEA 5LQCA 2NV0A 1J0BA 3R0QA 1IY2A 1NOMA 4D45A 4WBNA 2VP3A 1N1EA 2GZRA 2XKBA 2IE8A 4LOIA 3PGJA 2NP6A 2JFOA 3G1WA 4MUJA 3PEVA 4FEYA 4KQ2A 1KYWA 2HW8A 1M9NA 1PW7A 5BNZA 1FYEA 2QR2A 3EF0A 1UKYA 5AXAA 2B25A 3TINA 1L4LA 2ZWOA 4EW2A 1OT5A 2QZ4A 1T43A 3UTCA 4MCIA 3VQTA 2FWRA 5G4KA 1XG5A 4FFLA 4EGQA 2O8EA 1GVNB 5AK5A 1XMPA 1PR0A 1ZLXA 5JBNA 4DS5A 1M8KA 2X41A 2HA4A 3L06A 1U8FO 1JQ5A 1AQJA 2KNJA 4WZZA 1C3VA 2EZTA 4RPJA 3ICQB 3GZ4A 4MUGA 3CUYA 5MN6A 2V7VA 2IYPA 3S5JA 1RWQA 3R6GA 1VPVA 3SHWA 3CF4A 3BMOB 4U2EA 2HF8A 5GZ6A 3SNHA 1K6XA 4K7JA 5EQDA 3EC1A 2ODNA 3JQFA 3EVGA 3T7TA 4CFSA 3G2IA 2XB6A 4D96A 1IY0A 3RAFC 2IQ5A 1WXGA 3MWEB 3AEKA 3RAJA 4KWEA 1OPRA 3FZEA 3QEOA 3ZKAA 1TQ2A 3JQ9C 4M7RA 4OA5A 3CRQA 3LC0A 3RQIA 2Q41A 4EEKA 2ISQA 3GP3A 3BMXA 1UCFA 2NSYA 1RZRD 3KYCA 4YP1A 3WNQA 1U98A 2BM0A 1AUQA 1L5MA 4PW0A 2QMEA 1BH2A 4F4DA 3P32A 5CA1F 3ZEIA 2HLDD 3IVGA 4MQBA 2Y6VA 5DQHA 2WDPA 4K40A 2O57A 2Z30A 3UJ9A 1OI3A 2QENA 4OK6A 3FKQA 4AP5A 2GVZC 4EW3A 4IIGA 1H9CA 1P3JA 3FB1A 5DLQC 4HNAA 1DARA 2GPJA 1GTSA 5ALMA 2FPPA 2F59A 3DEAA 5EJAA 4HFMA 4KFRA 1H22A 2XZOA 1BFKA 4GRDA 4OBEA 2R7LA 4PLWA 1B6TA 3K7EA 3KEQA 2PL5A 5L45A 4BN5A 1B0XA 2VP0A 4XJSA 3VSBA 5IUNC 1RYZA 3FWYA 1I1QB 1OF1A 2XD9A 2BP7A 3ND8A 2HOFA 1W5EA 4LI0A 3GP5A 5CNMA 2I80A 1USVA 3OEHD 1S96A 2CBZA 1EGVB 1JIHA 4J9UE 4P3PA 3VV3A 2PMFA 3AP1A 4HAWA 3KHRA 2WF5A 2G9ZA 3EPPA 1OUMA 5BRAA 2ECQA 3A1TA 2OZKA 3VPCA 3LUHA 3LRPA 4CR6A 5B66U 3U4HA 2EKZA 2V7TA 1Q0RA 3FIJA 4IRKA 1FW6A 1LNZA 1DINA 4KXYA 4F2RA 4J7AA 2XRMA 3PSFA 5FUVA 4D6PA 4U7WA 3FDFA 3MUEA 3STHA 1HKUA 1JU4A 1MHPA 1ZSVA 1QRRA 2HL6A 4LMRA 2PRIA 2WFAA 3RSHA 2FR8A 3ROMA 3V55A 3BTOA 3HCBA 2ONYA 4G9BA 3DTVB 3PX3A 3BXZA 1QSSA 3IHWA 4D8TA 3PEWA 4F5YA 1Y4DE 3PXEA 8LDHA 3VPFA 3OFSA 4BV9A 2IWRA 4NM1A 3L41A 5KFMA 1TO1E 3NGMA 3EWAA 3GHYA 1Z5UA 3RSOA 4R2LA 3ZYZA 4LJ7A 1BA3A 1DZIA 5DI3B 1Y89A 4HPWA 3G2JA 5DH9A 1CY6A 3BWYA 3EIXA 3ESRA 1EGMB 4HDSA 4BMSA 2J0SA 4TKVA 3K1YA 2V9PA 4PSCA 3VKHA 4I2VA 3IPYA 1U5BB 1D1QA 1HFEL 4Q66C 2P2ZA 1WP9A 5A9RA 3NUZA 3MRVA 4IZ6A 2XADA 2CLIB 3VDXA 1IHOA 1PO7A 1TVKA 2P6PA 2X6QA 3QBEA 2RDIA 2VZ9A 5KG1A 4WNAB 1JMKC 3NTQA 2J3LA 4OUKX 1A8SA 3ND5A 4L8LA 3LVRE 2CNWA 1O97D 4AZ0A 1M72A 1Q84A 1MW9X 3SXPA 3KQNA 1T9GS 3PDHA 5CXXA 1GDDA 1RZTA 4NESA 3IODA 3CNLA 3LP8A 1BC5A 5P8WA 4PC1A 4LY0A 2C2XA 2Y8EA 3OZCA 3V34A 2F55A 1TXGA 4OH1A 1LBTA 5AVTA 1FMLA 4H4CA 4Q1BA 3BXOA 1FMJA 4JUBA 3TQHA 2HH9A 2J9YB 1UMCA 4ER7A 2Q4BA 1ST3A 2F2TA 2XVAA 3TFOA 4Y2GA 1FJ2A 3E7FA 4EGAA 3ZXIA 3UJCA 4ZMRA 4QFDA 3DXZA 2PGLA 3LUGA 3N2IA 3BGSA 4R1NA 1NN5A 1XLVA 2EWWA 4E4YA 1S9DA 1NI4A 3H7AA 1KFTA 3DBVO 1SQ5A 4XYLA 4GXIA 3K5WA 2H7CA 1GUFA 2DQKA 4ZZ0A 2Q0HA 2NZVG 1BNCA 1P81A 4S2UA 3D7KA 2BF4A 1GPKA 1PYDA 1ECBA 4DOMA 3CVJA 4YV2A 3FI0A 1V2GA 4O8ZA 3KHLA 4LFAB 3DONA 3ZY3A 1L5NA 1N8NA 1QYDA 3BRQA 4NBSA 3TTTA 3PA6A 2ADOA 3JZMA 3SV4A 3EPIA 3ANXA 4UASA 4YMUA 3HGQA 3SYMA 2B7CA 3AI7A 1WVGA 4XPIB 2QX8A 3NV7A 2C9MA 3NB0A 4JLBA 4KQWA 2QAGC 1W36D 1ENPA 5I7SA 4CLXA 3VPSA 4IJKA 2Q9AA 1HL3A 4CWAA 1PJ8A 3PFGA 1ZOOA 4UDNA 3VR6D 1U6IA 3OTQA 3TMYA 3PEEA 5A0VA 3QH4A 3WMRA 1EK5A 3NORA 5IN4A 5EZYB 5IIJA 1C50A 3K70B 4GYJA 3EVFA 1SVLA 1ONSA 3E05A 4FFBB 3IURA 2PM8A 2QUHA 2HIMA 4X0EA 2FW1A 1FQKA 3BBLA 2K6GA 5C7LO 4A0GA 2VHEA 1IZ7A 1D2NA 1JBEA 3EFEA 3QLEA 4BQEA 5AM5A 5G40A 2IXAA 2YXEA 2TMYA 2OPBA 4BEVA 1RI4A 4GVPA 2OGZA 3DF7A 1VHLA 2AOTB 3F5AA 1I3OA 2GXQA 1E18A 2JCXA 4EKGA 1SU6A 3CZRA 3QBJA 1MO2A 4DA6A 3KKPA 3ZWQA 1ZVMA 5DYGA 4HQNA 3Q1LA 3TZKA 3HG7A 5IC6A 1Y1RA 4Z0NA 1DVRA 3C29A 4CQLB 1ABFA 3ESZA 1QCYA 4GNRA 3ZU3A 2R8JA 1QDLB 3E1GA 2WBLC 3PDWA 4XE5A 7ICSA 2NADA 1UMKA 1SZCA 4LBYA 1HUZA 2FWBA 3SSNA 4EEZA 2VJPA 5ALUA 3RS5A 5CLQA 3J81A 1OYVA 4QYIB 1I7PA 4FEAA 4C07A 2XCAA 4FHDA 4IQ8A 4XWGA 3HXMA 4KW7A 4O25A 1UPBA 4CIWA 4YXMA 3FPEA 1XCOA 3AHJA 3QIAA 2VTBB 2GS9A 2XKJE 2F62A 2DG2A 3OJ0A 2YQZA 2YTZA 5JEDA 4UJ3A 3PWKA 4FHFA 4R8KA 3WX0A 4UBCA 1GZDA 4F8RA 3GFSA 4ED3A 4J0HA 2ATEA 1DEAA 3UK1A 2ZCJA 3A0RB 4G3IA 1NVUQ 5HFJA 3RVKA 4KO8A 3TXXA 2JKYA 4CEHA 3TDMA 3O0FA 1HE8B 3SHTA 3KCQA 3IHTA 4JUDX 3VPAA 1W4LA 1JE0A 2PWPA 1Z37A 3L5OA 3HGMA 3O84A 3OBBA 2PKWA 3I9V1 4ALJA 3KLMX 5KYYB 3HA2A 3U60B 3I2IA 1RIFA 2ZIVB 4Y9RA 5HZHA 1Y3CE 3IDZA 3GCDA 3QFSA 5F2NA 4C0XA 1OR8A 4LBWA 3IEPA 4OA8A 2R66A 4WWHA 2FLNA 3NCHA 4MV5A 3VISA 2PMEA 5K0CA 3LVVA 3IKVA 1WXQA 1XFDA 3MOGA 1D4OA 1QLWA 2GEFA 2HJSA 1EJ2A 4ONEA 4OB7A 1T6NA 2BY4A 3SKVA 2C2RA 3JTEA 1PVVA 5EE9A 2IX9A 3HO1A 3HEBA 4F85A 3GJ5A 4C2UA 1XQXA 2IYXA 4K5QA 5C8YF 1GKIA 4CE6A 3EZFA 2OGUA 1I7NA 3ZY5A 4HPXB 3HRIA 16PKA 4HLDA 4CR8A 4D9EA 1S1CA 1HT3A 1FZQA 4B81A 4CM8B 2XH8A 4B9VA 1ADGA 1H6BA 1WXXA 2P1RA 4NP6A 3TVDA 4C08A 4BNLA 3WKEA 1BWSA 5FORA 3NO4A 2O48X 2BOVA 2J3HA 1CHNA 3CLUC 1RM0A 1UM9B 1T9CA 3MVEA 5CFPA 4B3IA 1Q0HA 4HMQA 4J1TA 3UAXA 2Q5QA 4DXDA 2X4GA 1DB3A 1Z36A 1G9XA 2FQWA 3HLKA 1ANKA 3BF8A 3ZG6A 2EANA 4EYOA 3ZZMA 3A0BU 3LBIA 4Z4IA 4PHGA 4MUAA 3OZUA 1TYAE 2FSUA 4LW8A 1SIUA 2BBOA 3U7FB 5L1KA 3TQQA 4CV1A 1GQYA 4DJAA 4LVSA 4GEKA 1W46A 1T3GA 4DIKA 1PLJA 4L78A 5KIAA 3KV1A 3C6MA 1L3BA 4HADA 1VL2A 2CJWA 4MB6A 5AW4A 1RHMA 1M1XB 2VP4A 2Y1EA 1UDBA 4IGIA 4ED0A 4B75A 3MRTA 1ZGAA 7GPBA 5DQIA 1J5XA 3U7QA 4H60A 4RIEA 4FSHA 4D46A 2X23A 3L0ZA 4FMCF 1FDIA 4HD8A 2O2XA 3O47A 2NVUA 2PYZA 1NXSA 4O4HA 1E9EA 3INNA 2VRCA 2W8BB 4PYMA 4IIJB 3EGOA 3P71T 2I4OA 4H3KB 3A1EA 1VA5A 1D3AA 3PC3A 3BL6A 2P79A 1YZQA 1RQGA 5CVTA 3B9BA 1PUZA 1ZKDA 4IAOA 4BUCA 5FADA 1TLLA 1PEKE 1XZHA 5D6OA 4FFDA 3UEOA 5BSTA 4BVFA 3A1WA 4PEVA 1PJZA 3UICA 4RDXA 2EEZA 4OQEA 1R3UA 1HNXB 2DR2A 2NUPB 1FQOA 4HWRA 3ISDA 1XVVA 2OO3A 5JH7F 3SIPA 4KNWA 4BNNA 5LXTF 4C4XA 3EXHA 5ALSA 2ESRA 2ZTDA 3PNSA 4A27A 2OV1A 5HBGA 4NDZA 3ZQKA 1UDWA 3MW8A 1VI6A 1ECCA 1VYVA 3U3ZA 3TGPA 3P2EA 3CH5A 3RJHA 1IBMB 1O57A 1PZFA 3IP1A 3RKRA 4ZDJA 2OC4A 4GOXA 3L46A 2JGFA 2FHSA 3E5NA 2V03A 5C52B 1Z4MA 3L77A 3BXFA 3OIVA 5DGAA 3P2IA 2OK7A 1R8JA 1DAMA 4RDHA 1ZJYA 4GS5A 2H5JA 4MITA 2FJ0A 1XZLA 1VGQA 3I23A 3MFIA 1SVWA 3M5PA 1DRUA 2GDZA 3PC4A 3ZCRA 1F2TB 5IM4F 2D06A 3WA6A 1ZN7A 4G86A 5A62A 4GX1A 3MMXA 4D25A 1H2WA 5ESXA 4F97A 4U6SA 2WTXA 2JFBA 1KF0A 3BJRA 2HXGA 5JRTA 1ED1A 4WADA 3R5HA 1T2AA 3DDWA 4QZVA 2IHBA 1RRGA 1CRLA 3W7VA 3UT5A 1LPSA 1QYXA 3K0SA 1ZONA 3PE3A 3T5JA 3QEMB 2ESEA 2XE4A 5G0UA 2FPMA 4JV2A 2I62A 3AEQB 1NVFA 5EMKA 1P9NA 4CG1A 4BIMA 3LY8A 1YK0A 4HDMB 4YRDA 2W9AA 3QOFA 3PSTA 1KFEB 5K0ZA 4NBUA 4F4IA 2O05A 1T15A 4XLZA 1KJYA 1Q12A 3FBTA 4ABYA 5KT3A 2X22A 3WZMA 2P3SA 4KL8S 3TIXB 1N36B 4Z8XA 4YT4A 1OT3A 4BBZA 1GAEO 3RYIB 1KAQA 2O0JA 1QRAA 1U1IA 4PYNA 3AVXA 3HB4X 4TSFA 2C88A 5DCYA 2ONJA 4K2AA 1Z7YA 3AUFA 2P9HA 3NRBA 1TU3A 4ZT2A 3Q5EA 4KGXA 3ZJTA 3EZNA 3MUFA 4GVLA 1KZGB 2WHRA 2H1VA 4B3GA 4L5JA 1NXVA 4JXJA 4WXYB 4B2PA 5A5GA 1YNOA 4JXZA 4MA4A 2WUGA 3V2IA 4WBNB 1D2RA 2F4VB 5DBAA 4G5RA 4D4IA 1FDVA 3GLQA 1KMNA 1TKRA 1WUDA 4UB6U 1FPMA 3T5DA 2J9RA 1L8LA 2W70A 2IFTA 2HVHA 4UAJA 3BMOA 1PJBA 1ZM7A 2PWYA 5J1SB 3J81j 4HN4B 4XCXA 2XIQA 3R3YA 2XDAA 2Y1LA 3CGGA 4ZTUB 1OAKA 2XVMA 1FFVA 5FTNA 5G4KB 3WYNA 1SHUX 8GPBA 4OJMX 1GIAA 3AR5A 2IU4A 3FC4A 3TZQA 3NANA 3I09A 5KNBH 1AK9A 4UUAA 3N53A 3ODPA 3QQ5A 2OOSA 2DTDA 2VAWA 4B3HA 1FVXA 3LZ6A 2J3QA 3T9FA 3H0MB 5F5NA 4CZ2A 2OUKA 4HATA 1VZ2A 5KTPA 5FPHA 3Q1KA 1YACA 1XKXA 1ZXXA 1SQSA 2XWBF 1YMVA 1E3SA 3UMJA 2Q8PA 4B4DA 1Y7LA 3GV8B 2N75A 3A05A 1CUXA 4J07A 5B7GA 4Q44A 3GMSA 4WBSA 1CLEA 1A7UA 4M9HA 5BQPA 4LZJA 5F98A 1HOTA 3ADCA 4QNRA 4PR3A 2AUTA 2Z5FA 3GBVA 1RRCA 5CHEA 5MGNA 1E5TA 5A5EA 2WTUA 4HQFA 2EX4A 3CXRA 1ZINA 5CK5A 1A2BA 5B2EA 1FFXA 4TYQA 5CD1A 2WM3A 4EJSA 2HHWA 2R7NA 3QVXA 5C4GB 3P0HA 4PGFA 4KVZA 5A1TA 1UK7A 3B6IA 3KYCB 1B0ZA 4X92A 3PPIA 2QGZA 2DF4B 4ED8A 3B1YA 4AF6A 3KOYA 4LISA 4AKSA 5CB4A 4HDCA 1HLFA 1XZQA 5BV8A 1QHIA 3UFBA 4JQYA 4KR9A 4PO8A 2FVYA 1X6JA 2CSXA 4R7GA 4OJPA 3S40A 1M0WA 3NHPA 4J3NA 2HF2A 1BHSA 2FPPB 2C4TA 1G6HA 2C5GA 3M4JA 4AL4A 3FNIA 2O1XA 4A5SA 2NX2A 3R40A 1IWOA 1KI2A 4M55A 5DLYA 2PA0A 4CTMA 3AR2A 3IOCA 3S5UA 1IM2A 2ZI3A 3SR3A 3U4IA 4E6EA 3DKRA 4F4UA 5IKOA 3NAQA 1DTSA 2FCAA 1VRCA 3ESXA 2PUAA 2EZ4A 2XVZA 2BP7B 3SQLA 4H7IA 4LRWA 4WESB 2Y67A 5KG4A 5FFNA 1CY2A 3RVOA 4B4KA 4I9UA 2FCRA 3LWNA 5K4LA 5AVUA 2VAMA 4QWBA 4R8UB 3I1FA 3THYA 2BTEA 1EWQA 4KJXA 1JEYB 1GZ7A 5IW8A 4QT0A 3G1UA 3T7SA 3C39A 3QF7A 3I1JA 5T14A 3N6VA 4G5HA 4IEFB 3C3CA 1M34E 1LI5A 4G5FA 1J49A 1LV8A 3M1LA 1WZIA 4GRAA 4N82A 3DYBA 1KE2A 1JF8A 5EP3A 3LVWA 5CFLA 1C8BA 1KXJA 3VSEA 1JXEA 2D6FA 1OJLA 2VWHA 7MDHA 3RAEC 3ICWA 2VYVD 3ETJA 4RU1A 2WM2A 4ARCA 2O8BA 3EIEA 4NYIR 2VO1A 1UP4A 4TZTA 4FLEA 5K03A 5E8RA 4MLPA 4OKIA 3I1YA 3NWPA 5B5SA 4YD1A 2ZRIA 4NJMA 1KYVA 1O0SA 3WYEA 5M5BA 4QPZA 3IKTA 1VFPA 4HR7A 1U90A 3TUZC 1JR6A 1LLFA 3AW8A 4CCSA 4FFOA 3U4CA 1GOTA 2B61A 1SGWA 2R2AA 2AWNA 1G38A 1GQQA 4NXZA 2I2WA 3AIOA 4FO6A 1SAYA 2PGAA 4HK4A 4HDSB 4RHUA 4TKVB 1A97A 3GZNB 1QIFA 1YL6A 1NBMA 2QMYA 5LP1A 3QKTA 1L5WA 3IALA 4MV4A 1F4LA 3T0FA 2Q2QA 1KKUA 3BCRA 1ZQJA 5IT5A 1ENOA 5FL3A 1TVKB 4HDOB 3TTWA 2Z2JA 4YR7A 3WLTA 2A9OA 5JXGA 4WQMA 1AHHA 4TV8A 2JJYA 2JFNA 1U2PA 2AB0A 5K09A 4KN8A 3NEJA 5ENVA 3SDBA 2XTAA 4AZ0B 3BILA 1AQ6A 1MG5A 2REQA 1EG2A 4XD7D 4DJTA 1Z63A 1NXPA 1SG6A 3H2KA 3OLQA 5LNK6 1RHRA 5B3AA 3ROFA 1KERA 1W0CA 1ZXIA 3DOEA 3ZE8A 3CQ9A 5TX7A 4M9JA 5F52A 1DUSA 7YASA 5A71A 1JDUA 1Y8ZA 2I65A 1LWNA 2JANA 2YZ7A 2P6UA 1ULBA 5KYUB 2O5EA 1GAXA 2ZUCA 4BYMA 2EFHB 3BD6A 5JS2A 3H9UA 3HJUA 2CPRA 1JXLA 3K53A 1R0CA 1U7DA 2Y3IA 4UM5A 1C9DB 2H1WA 3HP4A 4LDQA 1QF9A 5ARDA 2QVLA 4QOHA 2AZTA 3CX4A 1YVUA 4PCVA 4Z0HO 3KOXA 2EAUA 2Q0XA 3EGDA 2YH2A 1TECE 1F0NA 2EDUA 1CD5A 1LBSA 1ZGZA 3FLEA 4ME6A 1DQNA 4N6NA 3D6FA 2YINC 1PJTA 3VR2A 2AOXA 1NI4B 2TMKA 1COWA 3UZUA 1TZBA 2QZ9A 5EHQA 1KA9H 2OAEA 2CL0X 3BHIA 1P5HA 4X45A 3B38A 2YZGA 2Q6KA 3TLYA 4HGNA 3UAZA 4C0BA 4HKTA 1BDHA 1UM8A 3HKCA 4BX8A 4IX1A 3NWJA 5C3MA 2OWOA 4AY6A 1KFDA 7ICQA 3OZWA 2CJYA 4ZZ3A 1L9KA 4CLHA 2BLLA 4KV9A 4OGFA 2BJVA 1KEUA 3OIFA 3BGWA 3IUJA 2XB8A 1YZ3A 3GGGA 1EA7A 5LSAA 1OAOC 1JXAA 1QMGA 4Z9BA 5JAIA 2KMDA 1KMCA 4IC9A 1Z4PX 4UTXA 2G17A 3BWBA 4QXQA 1KJIA 4UUOA 3QPAA 5BVGB 3E70C 4BXOA 2CJXA 1QGED 3IDAA 4WH0A 1JTEA 1Z19A 4LC0A 3G79A 3MERA 3PXDA 1GLNA 3IP5A 3L8YA 3ACCA 3TF5A 5TT0A 9ICQA 4MQEA 3B8EA 3M6ZA 5ILQA 4LOAA 1UF9A 2I76A 1NE7A 1MDFA 4QPDA 4QO7A 4EPXA 2ZZKA 5JJ5A 4EKDA 5B2ZA 3FDIA 1YCFA 1U47A 3B51X 1BJRE 4A5OA 3E9CA 4V39A 2HHHB 3HNRA 2MMGA 5LBIA 2Q5IA 4Z4EA 1FBTA 4B7CA 3LKVA 1J99A 1Y1PA 1EDBA 2P69A 4QU5A 4G2TA 1W49A 1NOIA 1ESNA 4MWBA 1J2RA 2YZNA 2HV8A 5JNTA 4ZK6A 4BAUA 5E6RA 2CUNA 4LCEA 3LH5A 3N7AA 5BW5A 5D5HA 1ZQZA 3K0HA 2VH2A 5AHOA 2B7BA 1O8CA 3AONB 3E9ZA 3EMKA 1RWWA 4BUGA 3FYUC 4QOIA 1D4AA 3HB5X 3Q9UA 1U2GA 1I33A 3ENVA 4CFYA 1P4RA 4RK6A 1K1QA 4PZDA 2W6CX 1QWSA 4ZGWA 1R88A 4P0QB 4G26A 5KNCA 4R54A 4KIFA 3F67A 1GA1A 3LC1O 4E70A 5DM2A 9ICBA 2XCOA 2AQ4A 1JQKA 4XB2A 4GZ3A 1L8XA 1F20A 3AOEC 1NMXA 2GBIA 1T4DA 4BC1A 3EEQA 4L95C 1WJGA 1N2GA 1XF1A