2NYVA

X-ray crystal structure of a phosphoglycolate phosphatase from aquifex aeolicus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
b'MSLRVILFDLDGTLIDSAKDIALALEKTLKELGLEEYYPDNVTKYIGGGVRALLEKVLKDKFREEYVEVFRKHYLENPVVYTKPYPEIPYTLEALKSKGFKLAVVSNKLEELSKKILDILNLSGYFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDFTLSRPSDLVKLMDNHIVEFEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycolate phosphatase
publication title X-ray crystal structure of a phosphoglycolate phosphatase from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 74
structure length 217
sequence length 217
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2nyvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2nyvA01
2YMQA 2O9JA 4G63A 5ALGA 2FPUA 3PGLA 5ALOA 3ONNA 2HSZA 2P11A 4AS3A 4UMFA 3ESRA 3SLRA 2QLTA 3WKEA 1U2SA 3NAMA 4IFTA 2RB5A 4NV0A 1U7PA 1YJ5A 2R8YA 3SF0A 4O8CA 3QLEA 2B30A 2CFTA 4UARA 2NO4A 1Z4QA 1Z5UA 4ZEVA 3L0CA 4UAVA 2ZG6A 3R4CA 5ALPA 3DDHA 3KZXA 2BDEA 1VJ5A 3I1YA 4JB3A 4F71A 2DQSA 1ZD4A 3KD3A 1MH9A 4BYGA 3SHQA 4HGOA 3UM9A 2YBDA 2ZBFA 2YMPA 3I28A 3L8GA 3WGVA 2C9MA 2WF9A 4FE3A 2I54A 1U7OA 2QYHA 2ZBDA 1NF2A 3N07A 4XOUA 5AVTA 4EX6A 2JAWA 3F9RA 2ZOSA 3K1ZA 2G0AA 2I34A 2OA0A 3WK6A 4C4SA 2B82A 3AR4A 1WR8A 3U7GA 3FZQA 3WK8A 2RARA 1Z4JA 2NYVA 2FUEA 3EF1A 1L8OA 4XQ0A 4YH1A 2I33A 4YCLA 1K1EA 1T9ZA 1YV9A 4KNWA 1N8NA 3GYGA 3MMZA 5AVZA 1YNSA 2W4MA 1YDFA 5ALZA 5AKXA 2IOFA 5ALWA 3L0YA 2FPSA 5AHXA 4HGQA 4OCZA 4Y2VA 5T41A 1EK2A 1Q92A 5ALSA 1QQ5A 2ODAA 1WPGA 3ET5A 4DCCA 3S6JA 2I6XA 3R09A 1J97A 2I7DA 1ZD3A 3SKXA 3E81A 3B9RA 4NFLA 3ZX4A 3L8FA 3KDPA 3BWVA 4UW9A 2PKEA 3AR6A 5A3QA 4Y2JA 4KX3A 3CNHA 4DWOA 3WK9A 2C4NA 4FYPA 3OCYA 4CE6A 1S2OA 1Z4PX 3OCVA 5ALXA 3IJ5A 1L7PA 4B6JA 1Z88A 2HHLA 5AW9A 4BNDA 1ZRMA 3L1VA 4KX5A 3DNPA 2P69A 4UMDA 4J03A 3J7TA 2WM8A 1U2TA 2HEGA 5ALUA 3QNMA 2FPXA 1ZS9A 2WHEA 2HO4A 4EEKA 2CFSA 4UMEA 3AR8A 2AGVA 3OTQA 4YIHA 1LVHA 3E84A 1FEZA 5A3RA 2EATA 3U13A 4XE5A 1TE2A 4E88A 1ZRNA 2GMWA 2YFYA 5ALDA 2OYCA 5AM2A 4KNVA 4HGNA 3QYPA 1N9KA 1J8DA 5AI0A 2FDRA 5AI4A 4UM5A 5ALLA 4HGPA 3QX7A 5ALQA 1L7MA 2GHQA 3FGOA 3ZVMA 4QQFA 3N8GA 2G09A 1QQ6A 1Z4OA 2GFHA 2HF7A 5AVWA 2JGAA 3OPXA 4C4TA 1NNLA 3QU5A 3AR5A 3I6BA 1L7NA 2HDOA 1F5SA 3L1UA 5AVSA 4I9GA 5AVUA 3ZTWA 1KYTA 2OM6A 2G80A 3L8HA 4RETA 5AM3A 3BA6A 3PDWA 4HGRA 5AVVA 4G9BA 5AI8A 4Y2RA 5AM1A 3IB6A 3NALA 1Z4KA 4KYTA 4FFDA 3ED5A 3U19A 2B1RA 5IS2A 2ZXEA 1SWWA 1ZJJA 2RAVA 1RKQA 1IWOA 4HAIA 1LTQA 1RQLA 5AI5A 3D6JA 4Y2QA 5ALRA 3E8MA 1XP5A 3NIWA 4AS2A 3OCXA 3MC1A 4CF5A 1L8LA 2WF6A 5ALHA 3QU4A 4BX2A 1AQ6A 3FPBA 2IOFK 4ZEXA 2OBBA 4KN8A 2W43A 4L57A 4NAVA 2C88A 4HYTA 4Y2TA 1RMYA 3NANA 3OCUA 1WZCA 3MPOA 3N5KA 3WGUA 4BKMA 3QGMA 3WK7A 5ALVA 5AI9A 5AW2A 3AR9A 3ZWKA 2WF5A 3L0BA 1Z5GA 3DAOA 1EK1A 4IG4A 2YJ5A 3NRJA 1QH9A 3QU9A 1Q91A 3WK4A 3NASA 5AKIA 4JDPA 1Z4NA 1VFPA 4L6CA 3SMVA 2AMYA 2EARA 3P96A 3ZI4A 5JJBA 3B9BA 5ALNA 3PCTA 5AKGA 5AM4A 4OFZA 4BNDB 5ALEA 1L6RA 3EPRA 2MSNA 3WKDA 2O2XA 5ALMA 1TA0A 5AKYA 1RPZA 4DW8A 5AVXA 1U02A 1S8OA 3SKYA 2I55A 2PQ0A 3OCWA 4BX0A 2D2VA 1Z4LA 3I76A 5ALKA 5AI6A 1RKVA 3N1UA 3U7HB 5E0OA 5AM5A 2WF7A 5AW7A 4EX7A 5AIBA 2G06A 3A1EA 4UM7A 2HCFA 3M1YA 2YJ6A 5AKHA 2FEAA 2R8XA 1RKUA 4GIBA 2EAUA 2B0CA 4OHFA 3N28A 2ZBEA 4RESA 2BDUA 4YCMA 4CNQA 1CR6A 3HYCA 5AW4A 1ZD2P 5AIAA 1L7OA 1RMTA 5AVQA 3QUCA 5AKEA 4AP9A 4PNHA 3FM9A 2AH5A 2Q4TA 4QJBA 4Y2UA 3R9KA 1PW5A 2JARA 3WK5A 3TLMA 3VAYA 5AICA 3RFUA 5AVYA 2C8KA 2WFAA 1TJ5A 3ET4A 3EWIA 4YCNA 5AW5A 3QUTA 3U26A 3FPSA 2JAOA 4XPZA 2CN1A 5AESA 1T5TA 2YMMA 3QUQA 1TJ3A 4MUMA 3NUQA 4I9FA 4UATA 3FVVA 4NABA 2NO5A 2P27A 3AR7A 3L8EA 1O08A 3M9LA 3W5DA 3QU2A 4UASA 2RBKA 2YY6A 2VKQA 3ZVNA 1TJ4A 5AKZA 3PGVA 2PR7A 2HOQA 2Q5EA 4EELA 1Z4MA 2AUTA 1YS9A 3A1DA 4H1WA 4UU1A 2B8EA 1O03A 2YJ3A 3ZU6A 3CZ4A 5AM0A 1Y8AA 3AR3A 5AK6A 2R8ZA 1JUDA 4GXTA 1WVIA 1ZOLA 2HI0A 5AW3A 3U7FB 2B1QA 2YJ4A 4Y2PA 2IOHA 2MU1A 3E58A 3UMBA 5AVRA 2W11A 1RC8A 3L7YA 4EZEA 1RMQA 3ZWDA 3W5BA 2R8EA 1RLMA 4UAUA 5IT4A 3ZVLA 5AW6A 5AK5A 4MWOA 2GO7A 2C8LA 3DV9A 3ZX5A 4Y2XA 1SWVA 3ESQA 3HLTA 3UMCA 1RDFA 3OCZA 4YIKA 1RLTA 3W5CA 4CF3A 1XPJA 4BBJA 2WF8A 2FI1A 5IT0A 4EENA 1NRWA 1RLOA 5A3SA 1QYIA 3A1CA 3AR2A 2IA5A 3UMGA 3EF0A 1RQNA 1X42A 3B8EA 2G08A 3RF6A 3U7EB 5AKKA 3W5AA 4L6AA 4OD0A 4Y3UA 3ZTYA 4BX3A 5ALJA 3KC2A 5ALTA 5ALYA 5AKJA 1CQZA 4CF4A 2Q4RA 5AK4A 4J2TA 3KOOA 3WKCA 2MU2A 4NWIA 3MN1A 4BEWA 4C4RA 2ZBGA 3WKBA 2HX1A 5ALFA 4UMVA 1Z4IA 1QQ7A 2FPRA 3QXGA 4Y2YA 4ZEWA 3A3YA 2FUCA 1YMQA 1XVIA 4UU0A 2BY4A 4Y2SA 3SD7A 3QU7A 2P9JA 3L5KA 2X4DA 2YMLA 2B8JA 3ZW7A 4BEVA 5FP0A 2JAUA 4YGYA 3IRUA 5AK3A 1ZD5A 2CFRA 2IYEA 1VJRA 1RRCA 4F72A 2GHTA 4DFDA 3WKAA 5AW8A 2G07A 3KBBA 1T5SA 2G1AA 2YN4A 2FPWA 5ALIA 1SU4A 3ZUPA 5AW1A 2HF2A 5AW0A 5AKLA 3QUBA
chains in the Genus database with same CATH superfamily
2CUZA 3OMWA 3BS5B 4V24A 4BTLA 1GPAA 1FLDA 4Z6CA 4D3XA 2AEEA 2GBGA 5DG7A 1ZH0A 1AHHA 1FUIA 1KBQA 4KLOA 2F59A 1AU9A 3SHFA 4MRPA 3ZGZA 1KVTA 1T0BA 1R9NA 3SGLA 1ZD4A 3NCHA 5AJXA 2LZ0A 2A30A 1JIKA 2GN1A 4KTTE 1KFJB 4BVGA 1V26A 1YR9A 2H3HA 4YMVA 4RGQA 3RW9A 2Q49A 5BUZA 2XUQA 3M1LA 3N39C 4BLSA 4R8VA 2ZI7A 5ERXA 7GPBA 2I6QA 4MDHA 1E60A 1F8GA 2IBSA 1T1GA 2EJWA 2AC2A 2WWRA 3ER6A 1NBMA 3GAFA 4BLPA 3W3AA 4WTOA 2F9LA 2WYHA 3KFVA 5D3MA 4ZZIA 1ZCAA 1GTVA 4I5EA 4YDHB 2O3QA 3DMRA 3G0IA 4R0NA 3IIKA 1NF9A 3LGXA 5EWMA 2ZSAA 5DQHA 2W8LA 1XTJA 1C1DA 2BSXA 2DPMA 3LCJA 3I61A 4LZWA 4QG7A 4EG1A 4W99A 1ONBA 4IOJA 4U6SA 4JI2B 4OP1A 4I4TF 3SDZA 1QU2A 1QHFA 4X20B 4CCAA 1N2XA 1N9KA 4F8EA 4PLGA 4JYBA 3DTNA 4XAQA 3C4QA 1VSVA 5H8WA 2Q5CA 4DR2B 4LYYA 3F5EA 2W2MA 1E7SA 3SZ2A 1NUAA 3NR2A 1YZ3A 3RJIA 9ICLA 4NCJA 2DJ5A 3U19A 4WBSA 4S0ZA 5K4AA 1PR5A 2VXOA 1G55A 5BT8A 5FNVF 3N6VA 4LXQA 5J47A 5CA0F 1DC5A 3AX6A 3MGCA 5BSMA 5EMMA 4MW4A 1L4MA 3K1JA 3K1YA 5AI9A 4WKGA 1O0BA 4GXNA 1RJ9B 3OKAA 4J43A 2PN1A 4BV9A 4YX9A 1MO2A 3ZWCA 3IE0A 4OQYA 4Z8XA 5SZIA 2F90A 3B85A 4EHKA 2PMZF 3CF4A 1DOAA 1ULSA 1UPUA 2AFHA 1FJXA 4X97A 1CCWA 3I05A 1CF4A 3GLVA 2JJ2D 2NU9A 4M3NA 2CJYA 5MGBA 4W5HA 3TE6A 4REOA 4C0XA 4TS1A 3IIMA 3ZE0B 3FFAA 2J5QA 4TXHA 2A9JA 4QZBA 3JSXA 1HYGA 5TQVA 5JS2A 3K4QA 3FF4A 3E8XA 4ECEA 4MQFA 5LL6P 2Q3CA 221PA 3IQEA 2W9XA 2ZZNA 2XB8A 5CM8B 1NBEA 1T9BA 2JFYA 4C3OB 7ICTA 1F7VA 3HWX1 4MFAA 5J2FA 2GZDA 1N2CB 2O2DA 4V1CA 3Q6IA 3DO5A 2M6LA 2FR8C 2PS3A 4IHJB 4W1SA 3BWXA 2BEVA 4X1IA 1BYUA 1GLVA 5L3QB 4US8A 2WU3A 4I6JA 1GQYA 2H57A 3PG5A 4Y1FA 4BMDA 4DVGA 2P2ZA 1SN7A 1KR2A 4DLAA 5JARA 1KFSA 5JLJA 3TLJA 2ZANA 1NXSA 4R5MA 3CZ4A 2ORVA 5AM0A 5DGCA 3HCPA 3ZHCA 1NJ8A 4DRXA 4ZV7A 4F91B 3H86A 2FLWA 4AJHA 3M3HA 1C4WA 5LM3A 3C6QA 2II6A 4CM9A 1M1UA 1SULA 1YL6A 3MSXA 3EDMA 2W6ID 4ZYXA 5SZKB 1XZKA 4X41A 2UU9B 4W1RA 3HB1A 1YCGA 1YR3A 3JVEA 1NLUA 3VSAA 4FILA 5J0TA 1UQRA 2HWYA 5AK4A 3HXQA 2AMJA 2GK4A 5E4YA 1YUMA 4OJKA 4ZI7A 1R5OA 5HBGA 3U5ZB 1ZNWA 2ORED 3FF1A 4HXGA 2QF7A 1CI4A 1EB8A 2D1RA 1ZQSA 1CDEA 3CH6A 2DTEA 1COWA 1DOZA 2OVBA 2MJLA 4R8RA 5T4FA 3MMNA 3QUBA 1T34A 4IGFA 5BWLA 2IXBA 2H0AA 4A26A 2H2DA 4ZYYA 4EZBA 2V96A 3Q9NA 2KIWA 4BN0A 1Y3IA 2GRAA 3L1JA 2W00A 5ES4B 4HDMA 3Q12A 4CR6A 2WW8A 3H83A 1GKUB 2QB5A 2RJOA 4Z1MD 3ZLUA 3KB8A 4G2NA 4FJ0A 1DL5A 2GH1A 1N2IA 4AUNA 3F9RA 4KYIB 4XGQA 2QROA 4JQZA 1CZNA 1W4BA 2AVNA 2GAIA 1H3FA 5IWAB 1SCAA 4M8NE 1KPGA 1YJ8A 1DUVG 4TZ6A 4B9VA 3ICQB 3ZGOA 2YXNA 3QP9A 2AJQA 2JK1A 3USZA 4F2DA 4FMBB 4IINA 1E1MA 2B7LA 3FDSA 3H97A 1TNDA 2DPHA 2Y66A 1G6Q1 3GUZA 1P1CA 4IJUA 3U9SA 2CBZA 2R48A 1SV0A 1A77A 3I72A 1O57A 2A9QA 5KWSA 3EEBA 4JKIA 5EUQB 3MCUA 2DT8A 4A4DA 1E18A 2QUKA 4HDKB 2C7GA 4BJ6A 1LWNA 3DFMA 2PO5A 1UAGA 5KJ1A 3HL0A 3KYCA 1MJGM 1Z1BA 1JJVA 4BAZA 4NY1A 3N2LA 5JAIA 3N8GA 3VR6D 1R6AA 5FADA 3IQXA 4NS1A 3T9CA 2CLIB 3KLOA 2PLWA 2ISOA 4RY0A 2PLAA 1YR2A 2NQ2C 1D1QA 1M83A 4ZT6A 4IF4A 3LUAA 2HQ1A 3MCWA 1G17A 5CUQA 5J0OA 4CRXA 3M83A 4RPCA 4HYTA 3B12A 2GM9A 1UL1X 1YVPA 3ICCA 1QYCA 1UMCA 1NC3A 4YUXA 3EAGA 4B45A 3U1TA 2WWYA 2WICA 2C9ZA 3E27A 5LP6A 1U8EA 3PI6A 2WSLA 1GUAA 1DOHA 2GD6A 4BGIA 2GPTA 4CLOB 1ZUWA 3LG2A 5JCOA 2ZYDA 1AS3A 4NCIA 3OX3A 1KJQA 2YWFA 5DK4A 4QL3A 3OZWA 3J81j 3EXEB 5BPHA 4EY3A 5IWCA 5K03A 4O4HF 3QZ8A 2JJYA 4XGNA 1EBBA 4NJOA 5JPDA 2RGYA 1ZH8A 4JCOA 3THYA 2P6MA 1Y6FA 2QGNA 1DP4A 5AWFC 4P4GA 4JEIA 2FEPA 2KTQA 6NULA 4K6OA 3VZDA 2EZXA 1FVHA 1KKUA 1Z9BA 3V8PA 1JHQA 1UFRA 1V8DA 1P17A 1YZ7A 4HXFB 4GU5A 1WDKA 2JHFA 4A5OA 4LA4A 3CJQA 3MGIA 3OZCA 3AJEA 3LM8A 3FUWA 3OUZA 2JFOA 5T3UA 2NX2A 1FQOA 1VJDA 2CNDA 2CF6A 3F3KA 3D59A 2FMIA 3S2SA 4D4LA 3L6CA 4GYWA 2BBSA 2YJ4A 3FKSD 3AVPA 4AYWA 4KRGA 3MF4A 1VHWA 2QP9X 4M9XA 2XD9A 5AJWA 1E1QA 1DFHA 2BE7A 3INGA 5AW6A 3L6DA 2AOWA 4Y2XA 3BGDA 3TQQA 1B14A 2GBCA 2P3QA 1ZBQA 1YDMA 1QYIA 3NVMB 3JQGB 1FA9A 4IR7A 3VYRB 4PZ0A 2WHYA 5GZ3A 2P0EA 4L5IA 2FPRA 1GZ6A 1Q0UA 2C2MA 2V8BA 1DBIA 1FTQA 1RQRA 2YMLA 3QEMA 3JY6A 2RK3A 1N3YA 4RCVA 4M0FA 3PE4A 3PI7A 2PA3A 3RNOA 1QV9A 4G0YA 3G9ZA 4FOPA 1YGYA 4WJLA 1X7ZB 2YMQA 3BH6A 4YP5A 3GRYA 9ICAA 4W8HA 4P4SB 3C8MA 1I0ZA 4FFSA 1PVOA 1JA1A 4DA4A 4KRFA 4JI5B 4PSVA 3P9CA 3LAWA 1WU7A 4OQDA 3AJ9A 3PPWA 4I3FA 5EL0A 2I2FA 4F2SA 5C52B 2OAP1 2VP9A 1JHAA 2AKEA 5K9ZA 3NJ8A 1MX1A 2PNJA 4IR1A 3VISA 3DOHA 4Q3AA 5I7WA 3HTXA 4JJEA 3GT0A 3FGPA 2IUYA 5EWFA 4LSWA 4EQ6B 4HNRA 5TY0A 3BKXA 4MS3A 1GNSA 1L8OA 1ENYA 1FSFA 4CR8A 2DHEA 3QV2A 2J8ZA 3KHLA 3E7DA 4LF8B 4F4KA 1JG1A 4EHAA 2VDRB 4MRSA 2FPSA 4WKBA 4B3CA 3UT0A 3EULA 1TM1E 3OCJA 2WFLA 3LYSA 1NT4A 5IKXA 5F78A 2Q4OA 1QIMA 2CHFA 1LY1A 1ZM9A 4MF8A 2A4MA 1C50A 1JU3A 5FTJA 1QP0A 2AOTA 1QVRA 4ECYA 4QWWA 2D00A 4HWGA 4LMRA 4X7RA 4JJ4A 3PX2A 1D9FA 3AJAA 3UTDA 3L0DA 2W71A 1KEJA 2PGLA 4RQTA 3GRFA 3EPKA 1G3MA 2N1RA 4E88A 3WLOA 1NY5A 4AJOA 3UMRA 3TVYA 5C9ZA 4J4HA 2Y1OA 4JODA 1P9LA 3QLUA 4IMJB 2H85A 2CCKA 4DV7B 4DQKA 3NGMA 1KQFA 3PEUA 4FYXA 4MRNA 3X3HA 3BQTA 2GM4A 3RSHA 4UFPA 1WXIA 4E4YA 1T1JA 5BQFA 3LHSA 1W76A 4YP0A 1S0VA 1ATIA 1T36B 2ZI5A 1BIFA 1ZQHA 3UJBA 4CIXA 4QYMA 1G8SA 3GP8A 1QS0B 5CG2A 1BCSB 4JD5A 5AJUA 2QP3A 3MR3A 1ZP6A 1TDJA 5GTIU 4BKMA 3I8SA 6ADHA 4N40A 3N7RC 3H2GA 3L7LA 1QH9A 2AMYA 2GZ2A 4F5ZA 5ILGA 5IN5A 4WBNB 3QOWA 3AEUA 9ICGA 1SZDA 2PZAA 3N1UA 4W6QA 1HR0B 3BL8A 2WNHA 1FFXA 4EUSA 3JQ8B 3U3XA 2IH4A 3LT5A 3EVBA 3ECAA 2ODBA 5CA7A 1P4SA 2ZBUA 4YAWA 3G5MA 1G8GA 2CV0A 3HUEA 5ITZB 2IL1A 4S3MA 2R1VB 3GT3A 5LFAA 4E08A 3WLHA 4MLZA 2VJMB 3HSYA 4P0QB 4YJ3A 2WKWA 4P32A 1CSEE 3V4RA 5C80A 3AC0A 1U2GA 3WGIA 4F04A 3H11B 3RK0A 3AUAA 3JAKA 5F5NA 1NJ6A 4B4OA 2Q5EA 4YG2A 3NT5A 4UB3A 2BR4A 4A6EA 4PSKA 5JUMA 3EIHA 5DTJA 4KDFA 3OY2A 5G1PA 2C4MA 3K0EA 4I27A 3IXLA 2XUFA 5KT4A 2WKSA 3V1YA 3RIHA 4GBED 3PICA 4B6PA 3RTEA 4KUGA 2YRXA 1XVAA 5A71A 2Q0SA 3RWBA 4QQ8A 4IWYA 3B8EA 2POQX 4ASUA 4D3YA 4OXRA 5FOWA 2VNAA 5KQGA 2CPRA 1ZK3A 5AJVB 3MXTA 2H3IA 2O5RA 2V7QA 3QRWA 3H13A 4TVBA 4BXOB 3O3MB 3K1AA 5E79U 1U3TA 4RPIA 4B9EA 4TSRA 3A3PA 4YLGA 5K8LA 5DP1A 1PLJA 3ZXSA 4L8LA 3R7WB 1J9GA 3SE7A 4P3YA 3LK9A 2ZJ6A 3C3XA 5A02A 4UU7A 5J2EA 3GO4A 3NAMA 4I3GA 4NH4A 3L84A 1E3JA 1G8AA 1FQWA 2XUOA 1MA0A 3RJHA 1DPFA 3AU2A 2IT1A 3NETA 5GPBA 3PD1A 4F71A 4R8KA 1D2RA 4B74A 1X1DA 1AM4D 1F8UA 1IJBA 2I1LA 1IM4A 2Z8YM 4LQ4A 4KBFA 5ECWA 3G0BA 3LUCA 2JJ1A 3D2LA 3W0LB 1VCIA 1R8XA 1ZQJA 4F3CA 3UMYA 4G5OA 2XT9A 4N5HX 2B1JA 3MMPA 3MMZA 1TIPA 2GLUA 1TUBB 3ZHYA 3GBVA 2PWZA 3C2LA 3G2JA 1PZGA 1E7RA 3DBIA 1CJCA 3PP8A 3T5AA 4RTOA 2XWBF 3R41A 1ZJNA 4BP3A 3OIUA 3KEOA 5L9AA 2H29A 4UAZA 1U0LA 2W2TA 3TAQA 5C35A 2JEZA 1H6AA 2Z2IA 3GPBA 5DKFA 5CB1A 1SC9A 4BLQA 5HMMA 4DM7A 4TL9A 4BS9A 1OHHA 5KNBH 1COWD 3ZU5A 3VHLB 3NPAA 1QIKA 5IM5A 2WTFA 4NK4A 5AJTA 4K87A 1EAMA 4CT4B 4XZ3A 2QTMA 1WB4A 4ZAWA 3O84A 1ZJ6A 2P9TA 4PN3A 3OLYA 2POCA 3HCOA 1XKLA 2OBNA 1DIHA 3UWKA 1Y9ZA 4GKKB 1DWQA 3U60B 3RSZA 3PVCA 1QFMA 5J3JA 4IV5A 1TVKB 1VIVA 4RQ5A 2O0JA 1TKBA 2Q3BA 5E1MA 4G0QA 1IVSA 8ICNA 1FUEA 2OV6A 1EXVA 1E2FA 3STYA 2RHFA 5IXYA 1N6HA 1GCIA 3O4JA 4J0FA 1GZUA 1AN0A 4C14A 3J80A 1RJFA 1F3OA 5IVIA 1U94A 4BUGA 4Z5XA 3RTGA 4JEUA 2HDHA 2LTAA 1MXFA 3QKRB 1LBSA 4ECWA 5CM2Z 3S1AA 2EIXA 4FFRA 4JMLA 4MTLA 1A9OA 1DCKA 4KLNA 1S3SA 1DFIA 1AQNA 2HN9A 4R2LA 3WKDA 1GCGA 2YZ2A 1L5VA 4ELTA 3P9QA 3HRIA 4BFCA 2PKYX 3C1YA 5CAEA 4KR2A 3HJHA 5KJFA 4LF5B 2PH1A 1LLUA 2VK2A 1OXVA 3TRDA 1IEQA 1AKUA 6CHYA 3IVMA 1RKUA 2UYOA 3ASVA 4CMGA 2X3UA 2BEWA 4FHCA 2R6R1 1G0OA 3TJRA 5B12A 4AY3A 3BQ2A 4R1MA 4M04A 1IQUA 2C9OA 2NV3A 1XMPA 4CDGA 4PFKA 4QOEA 3OSZA 1P4JA 1XOIA 1IRXA 2IU0A 1NLZA 3CU5A 2QUJA 2RGEA 4M1ZA 3H5TA 4N5DA 3C29A 4X54A 4PGYA 2M98A 1YZLA 5HIIA 5H3LA 2VDJA 2H17A 2PXIA 4HN2A 2H31A 3HCCA 3F6RA 4QRIA 2IS4A 2GPSA 5REQA 2H18A 4L02A 1NF8A 5AW3A 3DTVA 4Q15A 2H51A 3CXRA 3BGIA 3T99A 1GKYA 3C6MA 3S7TA 3ITDA 5C8YF 3W7VA 2GO7A 5TJHA 3UOAB 3QYFA 4QBFA 3WP0A 4O25A 2X4IA 1U0EA 5SYMA 3M6WA 2EERA 1YH3A 3IPLA 5FL7D 1I6LA 1N0HA 1K4YA 2IYLD 5FL3A 2NW6A 1VA5A 3F8TA 1NL3A 1QRRA 2HSEA 2ZBGA 1G21B 4EAAA 4YO8A 3EFHA 3BMCB 2X2OA 1J1IA 2FMPA 5FA8A 2KVCA 4E3WA 4S0XA 1JJFA 3RAQA 1XTQA 4UUAA 4L0CA 5CVUA 1MJ5A 3I62A 4B3TB 3O75A 2IH2A 3S27A 4DMMA 2E1RA 5HTKA 3WGZA 3OIDA 4HZGA 3E61A 1QKKA 3A9UA 1R00A 2NZ8A 1R64A 2FZCA 4NQRA 3QVVA 2GK7A 5CDHA 5KPDA 2L2QA 4DEXA 4LC0A 5BRAA 1YC2A 5BOLA 2R5WA 3OHBA 4G5FA 4M1TA 3TQFA 5EJIA 5E95A 1FB5A 2ENUA 4XJTA 3VR3D 2ZTEA 2A78A 2KJQA 2MSLA 3KUDA 2JIZA 2BUBA 2J45A 2JCVA 3N07A 3L0ZA 3M2PA 1MMFB 1OH7A 2PZBA 1E1QD 3AEXA 2FEWB 1V3VA 4X5VA 2NZ2A 1ONSA 1YASA 1QH0A 3UT5A 2QTNA 1JSLA 2HNAA 1A4XA 3NAGA 1OAKA 1NATA 4WPGA 2VC2B 4DWWA 2I8LA 5LZ4A 1UXIA 3ZE8A 3VPHA 2VOJA 1TUGA 2IPXA 3L18A 1JFVA 1X70A 3S6JA 1F4PA 4C30A 1QRTA 2HAEA 1J8QA 5A3QA 3C7AA 1KVUA 3LA6A 4ARAA 1JJIA 2CMGA 5AHOA 4RO0A 2FRDC 3ZG6A 4OJ6A 3FB1A 3AYXB 4CQMD 4FDTA 1CY1A 3BXPA 1JR6A 1W5TA 3FCYA 4ZO4A 3C3YA 2GN9A 4K26A 2P9QA 3D4OA 2ZS8A 4LC1A 4QUBA 3EIUA 4ED8A 5DZSA 3PHBE 4C21A 2AZMA 4EO9A 3NTOA 2G9RA 3MBOA 3O3NB 2QUHA 1KFTA 3PBKA 2CMKA 2HCRA 1KI3A 4LDNA 3SAFA 4GM1A 3WGGA 1D2HA 4KXQA 4E5KA 1MQ3A 1V4NA 3TSOA 3ILXA 5CK5A 2VRNA 5IVHA 2HPHA 1Y1PA 1Q3TA 5BWMA 3DEJA 3K09C 1IY0A 2H1LA 3RYIB 3QMMA 3D2BA 3KU1A 1G8JA 2WEKA 2Z4RA 3FTDA 1FVOA 4UHKA 2O5VA 5FUWA 4LBZA 2Q5QA 3S1SA 4WASA 3TPCA 1N36B 4LQDA 3WDSA 2OBMA 3SEFA 5H9VA 2JLBA 1H2FA 3W2TA 1E2IA 1EUDA 4AZSA 5FT9A 3USCS 5E7IA 3B9JA 2JEFA 1K1SA 4PQEA 3CURA 2QW8A 2OD9A 4Q34A 5AI6A 3U7HB 5LMCA 5E0OA 4MYCA 4Q44A 4O3QA 2K2WA 1ZC3A 1CUJA 3AUTA 2C4HA 4Z4QA 3FMOB 4DVJA 1I10A 1B3RA 1MOQA 1O6FA 5K8TA 1YBVA 5CVCA 3WYCA 5DSTA 3G2PA 1ULAA 4XWTA 1G2PA 2WIJA 4HZUA 1ZU4A 2JVKA 1Z6TA 3ISCA 1E2QA 3UEOA 2C2RA 1V8PA 4ES6A 4H7JA 4JYZA 3PD7A 3EYAA 4JVNA 3O8OA 2CKDA 1T8YA 3PGXA 2FMUA 3G2QA 3OOJA 2GPYA 3J81A 3AVTA 1YULA 4EA7A 4EJ6A 1MLDA 5TMPA 2PFQA 4RPGA 8LDHA 2BFOA 2G04A 1B41A 3H4DA 2XVZA 4RU1A 1A95A 2H0RA 1RYDA 5EERA 4ER3A 2ZDGA 3AY6A 1PKEA 3M9NB 1HFJA 4BDPA 4UCQA 2M1ZA 4EATA 9ICBA 1IRIA 1CS0A 4DSOA 2YZNA 4J29A 5KOHA 5AVRA 1J23A 2IY8A 1G9TA 1U7XA 2WAOA 4YXMA 2ASVA 2DQKA 3K09A 3STXA 1AB6A 2NXCA 1MN6A 3LBAA 1N9GA 3TIGA 1D2AA 4WXPA 2OO5A 1V48A 4LK2A 1H9BA 3E2PA 1WF3A 4KE6A 5ESXA 3S29A 4HT3B 5FOVA 1GCUA 3PC3A 3EXHC 1E62A 4TUSA 1RE1A 3BE6A 4G1UC 5DYNA 4MW9A 5M3BA 2VPPA 3HRDD 2RGRA 3G23A 1YB6A 4N65A 4V0RA 3NOVA 1VGVA 3FOZA 2FE1A 2B78A 5JJIA 2EEZA 1JDBB 2BKAA 2RI6A 4RKRA 1L5UA 2FZWA 1LU9A 3WB9A 1VE1A 2BP7A 3ONNA 2OHGA 1N2CE 1IOVA 1YJ5A 5B58T 4HX2A 1TJNA 4MHOA 1CE8B 2PMBA 5K2MA 1U6IA 1QFZA 3T5GA 1LWOA 2IV7A 5IC4A 4KO3S 3G6XA 1U5BA 3OWOA 1NVKA 2FPPB 2BFEB 3HVJA 4L8FA 4J1SA 2YJGA 4FDLA 4M1SA 4OP3A 1QO7A 1PVQA 1TYBE 2OBLA 1PL0A 3TD6A 4MVJA 4PRYA 4JLMA 1V47A 3CKLA 5SZJA 3VU8A 6REQA 5J1SB 1ZJWA 1E4VA 4M0AA 5BQOA 5L3SB 1K1EA 3AG6A 4NH0A 9ICSA 3WJ2A 2HWKA 1M6YA 4REQA 5KG0A 4ELUA 2TMGA 2ZIXA 4MVJF 1NSFA 2Q2OA 5ALSA 3OURA 3B82A 3TW6A 2RK6A 3LHDA 2EANA 1GOTA 5L3ZA 1U5CA 3TTUA 3JQ9A 4GRDA 3KU4A 1DKMA 3F78A 4I28A 3A0RB 3QOXA 2ZCJA 5C1IA 4MR7A 4OIMA 2QSUA 3BSFA 3L9XA 3KWLA 4UAWA 3SYRA 4C0ZA 1HOTA 4QGSA 4R1OA 1YS1X 4XFKA 3MA0A 4PZPA 4AN0A 1TE2A 4ETIA 1GZSA 4I2NA 4TKZA 1O95C 1M5RA 2XCUA 3MTIA 1A4RA 2ZB3A 4WL0A 4ARZA 4C4TA 2XOKA 1Z5WA 3E9YA 4I1VA 4P58A 1XVUA 1CVLA 1VL2A 2OGUA 4EPRA 1FJHA 4WXMA 1QG4A 4N47A 2JJ1D 2A1TS 2Q1TA 2FVYA 4FQ5A 3L8ZA 3ELWA 5D51S 3E7FA 4EARA 1OXSC 1L5QA 1WXGA 2ZZKA 5KG5A 4IIDA 4MW0A 1IVNA 2RDMA 5BMVF 3BFKA 4FCVA 4LOHA 3AUSA 3WL4A 5F51A 2XUAA 4DYHA 1O3YA 4YCXA 1G7CA 2I7XA 1YHYA 5JVDF 1G7RA 1U31A 2VEDA 1X86B 1PEYA 2DR2A 4WZBB 2ISPA 2YL2A 3ETCA 3D0OA 4ZQIA 3IOMA 2OGZA 1P9RA 1XXHB 2V4RA 3TF5A 3A6EA 3O1IC 4EJSB 1Y42X 4I2IA 4E03A 1S4MA 1YS4A 2WU0A 5HZHA 4J0HA 4QO7A 4H27A 3E82A 3TB4A 2BVNA 4U7CA 5K8VA 1S1CA 4I1RA 4H18A 3EMDA 3M7DA 3IHWA 1EVZA 3HJCA 4DL3A 3O4HA 4CF7A 3LTEA 3QVUA 1ISJA 1AT1A 2ZFUA 4RIIA 2DKZA 3EXFB 1Z5NA 3IMFA 1P2TA 1Z82A 3TW0A 5IIKA 4JI6B 4PPGA 4PC6A 2DCMA 3KPVA 2J3LA 1YK1A 5EJ2A 1T6NA 3BZUA 4WKNA 1E0SA 2YTZA 3DBHA 5C51B 3WQBA 4YJFB 1FNDA 1R74A 5FAKA 3QBTA 3UK6A 2ZDHA 3MW8A 2BFAA 5K45A 2DERA 4GXIA 3GDGA 1RWPA 1RKBA 1KY2A 4J75A 2Q45A 3BDVA 4C7KA 2H1VA 3RRGA 1AXRA 4HMQA 5JXJA 1YZHA 5KS2A 4ZU1X 2QR3A 4BNNA 5B3KA 4PYQA 3KKPA 3WLMA 5IIIA 2BH9A 2QMEA 4F4WA 3AHFA 2J9RA 4N0PA 1RJEA 4JROA 4YRRA 1KSJA 3RIEA 3UA4A 2VCEA 3MJ4A 4BMXA 1HDZA 2BFPA 5DF1A 1E5LA 4YRIA 3F97A 1GTL1 4AG3A 5K3FB 3W2EA 3GQCA 5FBHA 2QLNA 3UK0A 5JSFA 2W0MA 3BMNA 4X1YB 4J4TA 1W2GA 3C5EA 2HBJA 4LVNA 5E7MA 2IEZA 4PYKA 2PJRA 2REQA 1Q15A 1PZMA 2Z9BA 4AIRA 4FEEA 3ZQ4A 3DEHA 4NCNA 2XNDD 2FMXA 4NV0A 3AEYA 4BQPA 1C20A 1M0WA 3HKDA 1RQ2A 1YONA 1EA7A 4Y1RA 2C7PA 2NACA 3LQRA 3TJZA 4UAGA 2E4AA 3DTVD 1GLGA 1XZAA 2CKMA 3NT2A 4N54A 1H2AS 5J23A 1EX7A 1QO0D 3MBYA 3W2GA 1W8DA 4TX1A 2H1RA 4O2AA 4L5BA 4E5MA 2PVCA 1S5LU 1OLUA 1XJQA 4WERA 3MB5A 4BUJA 2XQKA 2KE5A 3I73A 3WJ1A 1J97A 2A92A 4ZYTA 4DLNA 3SMQA 2Y8EA 5KFIA 4JV1A 3FFXA 3KEMA 3UB2A 4UDOA 1D7AA 1HNXB 3NEAA 1OT3A 1TF7A 1SBHA 1OZFA 3QA3E 5CDFE 4DREA 2E89A 1XDSA 4REMA 2Y0BA 3IURA 4B48A 3UXPA 3WS7A 3WLLA 4GMFA 4WKCA 1NJZA 3L9WA 4YMOA 1I36A 3HG7A 4QYTA 2SHKA 1P18A 2IYXA 1V7PC 4MVCA 1M1XB 5F7XA 2IFTA 1K5DA 1IZ9A 5FUQA 1VLHA 4MAAA 3OOYA 4NENB 1IIBA 4ZMBA 3HGQA 4FE4A 3WGYA 1Y9AA 1VL5A 5BNWA 3DCNA 3EQZA 2J3IA 1JJAA 1RCFA 4HAIA 1IPFA 1GGMA 3WSTA 5D5HA 4C2UA 3ORRA 1HK7A 1IPHA 4OXIA 3GELA 2YWDA 3FSJX 1WCWA 1A2BA 4OL0A 2AD1A 1M34A 2WOOA 4I8DA 1OZHA 1ESZA 3WYEA 1VG9B 8ADHA 4Q18A 5AM4A 2PRYA 2PX2A 3FC4A 2BT4A 3G9XA 4U6NA 3AL3A 1VB5A 1DO8A 1I9GA 1LDBA 3WADA 3SS8A 5AM5A 1FFEA 1Z47A 4IZOA 7ICRA 1R0RE 4IMPA 1XZMA 2I6TA 4NYIQ 4OKSA 4RKQA 1EQAA 1ZKDA 1NQVA 5CXXA 2NZXA 1V1MB 4XVUA 3NDIA 2IEBA 3M3PA 1Y6ZA 1TOAA 1RZVA 3D81A 4YCAA 2XIDA 1O94A 4B73A 3MLAA 4OMCA 5CT5A 2OMEA 3RB3A 1UBCA 3IPRA 2D8MA 3FVVA 3QW4B 4GAEA 1QYRA 3L6UA 4M99A 2R4QA 4K9SA 1TADA 2XCTB 3G7UA 3L0IB 5CT8A 3CT6A 1QANA 5EESA 4YJGA 4MV9A 3JTEA 2MU1A 3IILA 4PC2A 2VJDA 3OD5A 5LU8A 5IT4A 5CA1F 4CV2A 1MZVA 4UFNA 2YZMA 4HRYA 3MOGA 4RORA 4GLOA 2YB4A 3R5JA 2OC9A 3E7PA 5IKEA 1PK9A 5F9FA 3O92A 4RK6A 1QC5B 3WLQA 4TS3A 3DL2A 2RDJA 5A1JA 4RDIA 1TW2A 2X14A 2HX1A 5B5SA 4JP1A 3GLQA 3DBRA 4BU1A 1OA0A 1I1HA 5B1YA 2ODWA 4L4RA 4I4TA 5K6AA 4KLQA 1X7YB 1WLYA 3T7AA 4X1OA 3K6JA 3WKAA 3GIIA 2KZ3A 4QTTB 4TN1A 3DXFA 2JKVA 3RH6A 4B4VA 2L18A 3TW8B 3BMXA 3HN2A 5ICGA 1G5FA 5KVQA 1KE2A 1KR5A 4GOJA 4PX5A 5CT9A 3HSKA 2QLBA 4LF7B 1PJ3A 3FNFA 3ZQUA 1NR1A 1JHMA 2B30A 3O4VA 3AF5A 2Y92A 5EQFA 1E8DA 3EMBA 4FK8A 4J9KA 4GR4A 2C00A 4BE9A 2NZJA 4ECUA 2H08A 5FNVA 1M1NB 1UWVA 5BR4A 5CA0A 2IDMA 4U63A 1Z00B 3P5SA 3EWAA 3I52A 3I34X 1EFHA 3U62A 2MDTA 1P6XA 5ECGC 3LQ2A 2HNKA 3C24A 5JU6A 2QAGB 4H6PA 4PLTA 2AMVA 1NGSA 2F3TA 1GSAA 2REXB 1XVLA 3I6ZA 2FWNA 4D9HA 1L3IA 1TKRA 5FYQA 4L4UA 3ZVKA 4OQ4A 4CHGA 1QLWA 2LKDA 5IXJA 3O82A 4X64B 2X15A 2OP0A 5TGTA 2VQ6A 3TB6A 1N5OX 1U81A 5A7GA 1XNRB 4IMRA 2AYXA 4QFDA 1XC7A 3Q8RB 3E6AA 4JT9A 3FLAA 3EXG1 3B36A 1O1YA 5CX1A 4N5LA 1M6WA 1XQXA 3U7QA 3ZDFA 1HT3A 4I81A 1DG3A 2EWMA 3I04A 4K03A 2W0SA 1XG5A 2DJIA 2SKEA 4P4UA 4BZQA 1R9MA 2BFCA 1ZOSA 4DA0A 3HBNA 3PDWA 4INAA 5FJIA 3NV7A 1RWVA 4LDJA 1IHDA 2DBVO 2YHSA 5JR3A 4R9VA 2VSNA 2GKGA 4XD7A 4XYBA 4F45A 1QGED 4JQOA 3SQOA 4C7XA 6GPBA 5BW4A 5IKOA 5BVHB 1XT6A 2WIAA 1XCJA 2FGKA 2Z5GA 1ISGA 2E5LB 4LHSA 1SV0C 3U3DA 2NOAA 1RPZA 3I9OA 1U02A 4DSTA 2AL7A 5EJ9A 2QY6A 3DV0A 4TTIA 3VDNB 3WLAA 3EX7C 4CV3A 3A25A 4IMIB 1T4CA 1J0XO 2YFHA 2QYOA 2DFVA 5BN5B 3LBYA 3RJJA 2ZYHA 2UYCA 4IIGA 4KSCA 2FAXA 1J2NA 4L9SA 4ZKEA 2XOKD 4QHSA 2OQRA 5CFPA 1JF8A 3HJGA 2PG3A 1E2PA 3L2OB 1WHTB 1L4YA 1CJKC 3S28A 3SQWA 4Y9RA 2RBKA 2H9YA 4NMHA 2XHEA 7ABPA 3S2ZA 3JASB 4NC9A 4Y9SA 3FBGA 2RP5A 1EFVA 2XVTA 2V7WA 3T5LA 5I3CA 2RAPA 4RMIA 4OGLA 4B6QA 2P8SA 5LP6C 1LV8A 5G53C 1SCJA 1KMHB 5JNVA 5JCOC 3PEEA 3HBFA 3NEYA 4ZV4A 2O8EB 2WUFA 4AJLA 4PAGA 2GN8A 1IUNA 3HVKA 2WF8A 3W34A 3PHIA 4H6XA 2JGJA 2Y71A 3HE3A 5TPWA 3DOUA 1N78A 2YRFA 1Y7HA 3V7WA 2D3WA 3DB2A 4TTTS 5KYVA 4RPZA 5CD9A 1IEWA 1RHUA 3IBGA 4BUZA 3WRWA 3ABRB 4BB0A 1T5OA 2HTEA 2R85A 3T61A 5KTOA 4X7BA 2RGCA 2ZJBA 3PDCA 4Q8FA 2IIBA 3LO5A 3PW0A 2E2WA 4KLMA 2FZLA 4YGYA 3M4XA 2Q0HA 4QULA 3I01A 1DZ3A 2DR0A 3ICOA 2JIMA 1FX0B 3C6XA 3CCCA 2W58A 1JVSA 5AW1A 1J5XA 1E9DA 2C20A 1E3IA 4B4DA 1AQIA 3SCZA 1VSBA 4KWHA 1AK1A 4FLFA 1A9TA 4XW2A 1NQAO 2JBWA 1BOFA 2UV8A 2BMWA 4G01B 8ICCA 3RRFA 1O95D 4MV7A 1W5AA 2R1ZA 3LRXA 3HWSA 3DDHA 5J4KA 4MB0A 1XKXA 1DBSA 4AM8A 1GKLA 1PV1A 1L7DA 4MIYA 2I1QA 1CG6A 3BD8A 3SOZA 4JN6B 4TYYA 1P77A 1PBTA 4CV0A 3D3WB 4F0JA 5FULA 4I6GA 4C05A 2A1AA 4OB7A 2X8LA 2PWAA 3R9IA 3RARA 9ABPA 2O8DA 3WRYC 1KXJA 5JH7B 1NBIA 3DEFA 5ADVA 4E5PA 5KDOA 2JLAA 1K7XB 4PAQA 4Z6FA 4O4HA 1DGQA 3OH8A 4DQRA 2VJLA 3R09A 4KQ9A 5FHQA 5F2KA 4D46A 1FRZA 1SVMA 4RC9A 4P93A 4B6JA 1CUAA 3EVCA 1G21E 4HWOA 3R40A 3FTFA 3A4TA 2HA6A 1CEEA 1J2MA 1SK9A 4R16A 4OAOA 4LJ5A 2R6CA 3D7SA 2N1BA 3AR8A 3K16A 5INTA 3WYDA 5IMBA 3RR7A 3AJDA 1KYXA 1WW3A 1Y8ZA 4TT3D 3Q5DA 2ZULA 2L19A 1K88A 4WNAB 5FPKA 3E7XA 3D8TA 5KNCA 2O8VA 3L6EA 1EXDA 1U3FA 3KTDA 3KHGA 5EXTA 1IIRA 1E6UA 4KGXA 3E70C 4B40A 5DEOA 1BVSA 1GILA 1JIJA 4DABA 1XRLA 4X8LA 4NAVA 1AHNA 1QGZA 1DC4A 5F21A 5KQPA 1KOLA 1DO2A 3V4LA 2ZIAA 5JBQA 4AP5A 4C7OB 1B6RA 2C5SA 4RVSA 1BWSA 1PWYE 3T38A 4FYYA 4C20A 2Y9MB 4G6ZA 3LVQE 5ILOA 3WRYA 2I55A 1NHGA 4TTAA 2VTBA 3VTKA 1WWKA 5DH9A 1II8A 2EL7A 1XZCA 2OFFA 4BNVA 5FBWB 1Q57A 2YS7A 1NE7A 3TBKA 4IRMA 3GZ4A 3M4NA 2V4MA 4KHPB 1TC2A 2BDUA 5J4VA 4KSBA 3DFUA 4ZTZB 1N6LA 3QLUC 3V8MA 1UMDA 4DQSA 3E35A 3GRRA 3FSGA 1QAMA 3LXRA 5IFLA 4ZDWA 1M67A 5LUBA 3Q1KA 4F4XA 2OK8A 2IA6A 4J0QA 4CL8A 5JZVA 2I4LA 4NZOA 1H69A 2AFIA 1Q3VA 3QEKA 1TLFA 5TT0A 9ICPA 3D2AA 5H4HA 4HY3A 3W5DA 2P5YA 1V0JA 4RSMA 5DYIA 3U2QA 2YWXA 2FMFA 2ZRIA 4KEAA 4J07A 4MKFA 4D74A 4EELA 1HNWB 2ECKA 3GJZA 2LV8A 5LD2B 3LC2O 5DLFA 1GITA 3BH7A 3LGAA 3ZR4B 3RUIA 3KYIB 3CF4G 3UG6A 3ZI7A 3NHSA 4CKCA 5D6NA 1IUKA 3FYHA 3TOVA 1Q44A 3D7KA 3RHFA 3ES9A 2OBFA 3I2KA 4GOOD 3AUYA 1XNSA 3EF0A 5KDLA 2FFQA 1RQNA 1L4NA 1ZN9A 5DCWA 3NBAA 3WNVA 3LFTA 5LBTA 1HI9A 5CFMA 4YD2A 1E98A 3V1LA 3P45A 4HATA 4M1YA 1UP6A 3X0DA 4RKWA 4I1YA 1XKTA 3G9TA 1ZUIA 3EGDB 4IF6A 3UJPA 2PCJA 5UKDA 4LDZA 3VCBA 1C81A 1U2GC 2MSEB 1M72A 3NEPX 4LNAA 1V35A 1C3EA 5D6OA 1Z5UA 2Y1GA 5AFSA 3G1WA 4QPNA 1L3SA 2VP4A 3TZKA 1ARZA 4OXXA 5F1YA 4UXHA 1Z0DA 1ZBDA 2H2WA 1LPAB 1MB2A 5KKNB 4HSEA 3FJOA 1T25A 1DO0A 4CKWB 1XHFA 4EB8A 1JIVA 3K8OE 3OLZA 1C2YA 4AC9A 4KAXA 2F9FA 1S2LA 4Q9IA 4FIZA 4DIKA 5LR6A 1JFFA 2VHWA 4J1QA 2JCSA 3D8NA 3CN7A 3TDKA 2RHBA 1NBMD 1N48A 4LTNA 2B21A 3W3AD 4KN9S 2NUPA 4PGXA 2DSTA 1RWKA 4NLCA 4EB6B 3GFRA 4HN4B 3ZLVA 2BDPA 4L6IA 4BLWA 1RI2A 3WLTA 4PO1A 3KKZA 4DWOA 4XVCA 2QXTA 2E0IA 4G23A 3SYKA 1L2TA 3SVTA 3LO8A 2WVGA 2GA8A 4O2BB 2IYPA 2WIDA 2EKZA 3H16A 2OCYC 4ZQBA 3ZDEA 4ZTBA 3F7OA 2BC9A 2Z7JA 4K6HA 5BR8B 3SVLA 1XEWX 3PXBA 2XVAA 1SUIA 4V03A 3VVBA 4NPCA 4ARUA 3DBOB 1R0XA 1N25A 2XLBA 3PWKA 5D87A 2IYNA 2IWHA 1YFKA 4DLLA 4RHEA 5AVWA 4BNLA 2ICAA 4ZOLB 5AVUA 4MK4A 4HCJA 4IIUA 4I99A 1VIYA 3NALA 1WCIA 1PR4A 1VJ1A 1JAHA 1UMKA 5J4HA 5J2AA 2YIJA 2MSWA 2FEMA 4KAJA 3R7AA 1M76A 2CV2A 3ZCPA 2I22A 2IU3A 2QRMA 1T2NA 2YKGA 1T9DA 3MPOA 2NAPA 4KO1S 1AGXA 3WK7A 2HGSA 4AL4A 1XTSA 3KKNA 2FN4A 3DZBA 1W88B 4RJJA 3AETB 3CJRA 4AXXA 3VR6H 3F8WA 2VG8A 1IZYA 3AB7A 4ZODA 1DKOA 3TOSA 1FOEB 4CM7A 2P1RA 3GGDA 4FLEA 4DDKA 2XODA 4K6FA 4ZO8A 1HETA 2F43B 2EU8A 5IDYA 2HNBA 3DE4X 1TK2A 2JGDA 2OILA 4NV1A 3TE7A 3BMQA 2I71A 4X44A 5IKPA 5F9NA 3ZK8A 2GK3A 2IPNA 3WOHA 4F5EA 621PA 5KTPA 2XD4A 5DB4A 1UT5A 2CVZA 1MAHA 2R84A 4IXWA 4B6GA 4I3HA 3ABIA 1PR9A 1YWGO 1NW9B 4YMWA 4EAQA 4GXKA 1SXQA 4Z9YA 5I48A 4QGAA 4S1PA 2WUWE 3VPDA 2EGUA 1WMEA 1MABA 4KL8S 1TL7C 3IIJA 3L8YA 1QX3A 4Q47A 1ZJMA 4YCSA 2WJIA 2ZT7A 2Q2NA 4H7IA 3JVIA 1LW6E 4FS2A 4EG4A 4M76B 1Y8AA 5AK6A 3SXUA 4CM9D 2UVPA 2YR0A 4QT4A 2PS1A 4JP2A 3JALB 4OOEA 5FPHA 4DV0B 2Q99A 5C0YA 3QITA 1UCFA 1YQTA 1ZRSA 2G17A 5B66U 3OTGA 3K4PA 3KFLA 4HLNA 3VO2A 1A5BB 2HMTA 3E2MA 5ARBA 5JSZB 4BMPB 4EW6A 3EMVA 1KI4A 2F9MA 1C4XA 2O3TA 2V4ZA 4WZBE 1LD3A 3SX2A 2VSYA 1ADYA 1VXOA 4ZCRA 1XXHE 4BEWA 3WKBA 4UB1A 1LC0A 4Q93A 3FYUB 4KQHA 3QMVA 3PC6A 3ONWA 3HJUA 1M8FA 3WLJA 5AK3A 4M8SA 1YQ9A 1QOZA 2DFDA 1U9LA 1BHJA 1WHSB 5T14A 3CRXA 1DRGA 3DL0A 2KJ9A 2IHKA 4BWFB 2V59A 1WWUA 2A9KA 3T3GA 4F96A 2EFJA 4UVGA 3MAAC 4EABA 3LDAA 2PT5A 3HCFA 3COPA 5E4TA 3GDWA 2Q5OA 1G6HA 1ZY2A 4OK6A 4G5RA 2BGGA 3PTZA 2W6QA 1BDHA 3EQ2A 4HL6A 3QELB 5DCYA 1BMTA 4MPJA 1GKKA 2R87A 4NJEB 4FMCF 5K3BA 1XK7A 3Q11A 5JZSA 1NZBA 2ZBFA 2WAQF 4DQVA 5ENDA 1HG1A 3QKSA 2NSJA 2X1VA 4PNZA 3HFJA 3M7IA 2WR8A 3GL9A 3PIIA 2LNDA 4DR7B 4TV9F 3FOCA 5I8PA 2OB1A 4X91A 1XU9A 2ZBPA 1NMSA 5KAPA 2KFNA 1GFIA 3V7FA 3A8TA 5D2CA 3EE6A 4M0EA 5ITSA 3JYQA 3NHAA 1NKVA 1F44A 1QIFA 1IDOA 1RI5A 3PL5A 3D64A 3BWVA 3OG9A 4RDCA 4CE6A 4X90A 1COOA 1TQ8A 4TN5A 2KOBA 3UN1A 3LDUA 2B1GA 1A3CA 2C3MA 4HLQB 4A8HA 1SOMA 2PX6A 3SIPA 4P22A 3DQPA 3BE5A 4YUYA 2XF8A 2Y99A 1G42A 4QA9A 2A6PA 4M0PA 4FNGA 2OFXA 4TWRA 1QOPB 2LHTA 1TUEA 2CL7X 4ZYUA 3W6NA 2Y93A 2Y1LA 4C01A 4U9IS 1E92A 3G02A 5HUQA 3HPRA 4D4HA 4QDKA 5DU2A 3R7SA 1QG6A 3ITNA 3AM9A 3DVLA 1NKSA 1B0UA 1SD1A 5IBPA 3OCXA 2FMHA 5C8YA 4LJSA 1WMSA 1KI1A 5KSWB 5D1NA 4D81A 2CC2A 1SUFA 2IHMA 3EODA 3NVAA 1ZWLA 3PVSA 3REQA 2DL0A 4FM9A 3H9EO 3DLPX 1O54A 3K92A 4LUCA 4OA5A 2HHQA 4DPKA 3DEIA 1F3LA 3BFXA 1S8OA 2I2WA 1FRNA 4Q66C 1KI7A 5AIBA 1GXSA 2YYSA 2O8CA 4KB5A 4IQ4A 3PTAA 3RODA 2IZ5A 5BOSA 1RMTA 2GXQA 1FXWA 2GZMA 1DKLA 5DDMA 2VPYA 4QO8A 3OQHA 3EGIA 4RSHA 2RCNA 3QE0A 2O48X 3GT4A 3HZOA 2C8KA 3W3AH 3OI7A 2JGFA 5DNVA 4USAA 2PTHA 1FXWF 4PPNA 1M6VB 2CYBA 2Z95A 2FVXA 3AVQA 2I62A 4F2WA 1XPRA 1E6MA 1RAIA 5BXQC 3EVFA 3VMFA 3G8BA 1N3BA 1QR2A 2BMVA 1DMSA 5CH3A 1X3SA 2J07A 1O6GA 3J7AC 2PMCA 1HSZA 2NUBA 3HKZF 1P74A 5KSZA 4KXXA 2VSXA 3FNHA 4A3SA 3AUJB 3T1QA 1YO6A 4OHBA 3E58A 2NVWA 1SU8A 5B3LA 1RVV1 2WZDA 3D4PA 2W9BA 2FG6C 3TI9A 1SIBE 4HC4A 1JQJC 3LZCA 3X1ZA 1V71A 1YFJA 3ROKA 1T9GS 3QTTA 1UJMA 1O5IA 1IJFA 1NRWA 3I8XA 4X5OA 1M7HA 1JNYA 1PDOA 2WJ3A 5LSAA 4E4RA 3I2GA 3SN6A 5HR5A 2JRLA 1EK0A 3ZCTA 2VUUA 3FPJA 1IY8A 2V3VA 1IN8A 2WNSA 1PGJA 1CJUC 2HWUA 2PPLA 1ESMA 3UJDA 5JECA 1XQWA 2Z2ZA 3AOEA 1U3VA 3EIXA 1GG5A 2GHTA 2Q3DA 2FWIA 3HYLA 4NFHA 1X9GA 2PKXA 4J0JA 4Z86A 3D1VA 5C53B 1JMSA 3DLAA 1VHJA 1W73A 5J2TF 2V55B 1E1KA 1NVDA 1VL1A 4QWDA 5HS4A 3Q6MA 3S1LA 1JSXA 1DIAA 4KXUA 4LV8B 2A0YA 2R1UA 4F4IA 4ETMA 3VVLA 4FINA 3T94A 3FUXA 2HHSA 1L3CA 1Y8RA 3LPMA 5CVJA 4MUEA 9LDTA 4AO8A 3R5KA 2W8BA 1Q0LA 3PFKA 3GD7A 4BO5A 3NBFA 5KU7A 1FXSA 3ANLA 4ME6A 3TRJA 5GTDA 3AIIA 1F6WA 2OO5C 4KZKA 2W2LA 1SA0B 5IDXA 3PQ5A 3O9MA 2JZCA 3B0YA 3BB4A 1OH8A 2VF5X 4YPVA 1Z6AA 3A58B 3R5SA 2E8NA 2C3PA 4IIBA 4E22A 3DSRA 1QZUA 2F00A 4L27A 1A0PA 3N6XA 2R1TB 4R8MA 5B53A 4L8VA 2V74B 3BILA 4UE3S 3SC3A 4P4TA 5THQA 1HL7A 3E48A 4ICIA 1IM2A 3TDNA 4B3XA 4XFJA 3GJ8A 3QY0A 2EDUA 1IMJA 2HPZA 2X8AA 4R3WA 1VMDA 1E5XA 2VNSA 3CQ9A 4OHCA 3HBLA 2CL5A 5JATA 1M8PA 1Y81A 1UXKA 1HYQA 1NYTA 4QQFA 1BXRA 4ZVUA 2YC2C 4RHFA 3T9EA 5LYJA 2IE0A 2H16A 1CKEA 4HDQB 1XEXB 3WTBA 1KKLA 1PNRA 4Q3OA 3SICE 1V8BA 4U7GA 3DE5X 3IUSA 3ZTTA 2F44A 1FIUA 5GADl 5LYJF 1LV7A 4QM7A 2G40A 3RAJA 4BO9A 2KV2A 4MKZA 1U47A 3UWMA 1FCJA 3E9QA 5D3ZA 3DMYA 1JHDA 3GCWA 4KLLA 1KXZA 3GJRA 1N1GA 2CJWA 4KQEA 2EX1A 4RVHA 3JQ9C 1U4BA 3P96A 3SLKA 5IAJA 3BGWA 4P2BA 1GTG1 1TA0A 2RQ5A 2C2KA 4NATA 1S0UA 3HC7A 3PJFA 4LJAA 1GU7A 2D6FA 3ITEA 1UIMA 4EH1A 3E22B 5TARA 4OK5A 3AP3A 2OV2A 1N63A 1BQEA 1QTMA 1NV8A 1RIFA 4D42A 3IMCA 3GFBA 3JPQA 5LB2A 2XMDA 4JJ6A 3KPUA 2QPLA 5K99A 3GZJA 2AVDA 5GOTA 4ZVVA 4JVSB 4X1KA 1V11B 4YV7A 4A5SA 4RHUA 4A92A 2VZLA 4QXAA 1CNFA 3WLNA 2OENG 5DNCA 5DJ5A 3ICWA 4LBYA 3AILA 3DZHA 3JQRA 2J87A 3V00A 3K9HA 1UBNA 1J9EA 4ZDJA 3AESA 5AHWA 2C9YA 3PYXA 5BV1A 3BWMA 3Q87B 5E6SA 1L5RA 3DB1A 4QTXA 4G07A 2J6SA 3ENVA 1JPUA 5ED0A 2B99A 4Z8YA 4MWOA 1JH8A 2E9SA 5JBIA 3B38A 1Z56C 5DN6A 4ER0A 3NYIA 4ASUD 1WABA 4RTSA 1A8PA 4KO2S 4BFUA 1PJAA 2XB9A 3N70A 2V7QD 5C8XA 2JC3A 3BWCA 4OLAA 2FMKA 5F2NA 3HKCB 5IJ0A 1R4NB 3OTWA 2VDWA 1PR0A 3VYTB 4DV4B 5I9IA 2QRHA 2AV6A 4KLZA 4NYJQ 2I3ZA 1WXEA 4O33A 1J21A 4B87A 4BQQA 2O1WA 5EJ5A 3EWNA 1HQDA 4KV9A 3BJMA 4BFZA 5BRJA 3U7RA 1ZW1A 5GONB 4OTZA 4M9NA 2X2EA 2PX5A 2WU8A 3AF0A 3UAOA 2GBLA 4B3HA 3DOOA 1JKMA 1VZ3A 3X44A 3OA2A 2QBYA 4M1WA 4AU1A 4KWCA 5IH7A 1E79A 5JCZA 4FZNA 3UXEA 1D5WA 1YHNA 4R1NA 4URWR 1YL5A 4LXXA 1SKBA 1Z16A 4DCPA 3EIWA 5BMVA 2KW5A 1PSZA 4K3UA 3F67A 3BEOA 1QH1A 1OXUA 1P2UA 2AFRA 2QX9A 5JVDA 3WYNA 3EH2A 1CYDA 2YYAA 2I33A 1IZ7A 1CQPA 5JQGB 1EFCA 1X6IA 5CPFA 1P7ZA 2A57A 4ROSA 4A0RA 1IY2A 1JAYA 1IBLB 2I6XA 2V5AA 5DX0A 3ZH9B 1QHGA 3TARA 3TIIA 4L51A 4B6FA 1YB2A 1OHHD 1Z4PX 1BEZA 3L8MA 1DKQA 5IJZA 3OZRA 2G6TA 2WV7A 2H3FA 2WHPA 3CCBA 4S35A 3AP1A 4OHPA 3EFOA 2QQFA 4MUKA 2HH9A 5HGJA 5CR9A 2YJTD 4D0GA 3UTCA 3RVPA 4CI9A 4NK5A 4O4IB 2BOVA 3AMZA 4W9NA 2W6OA 2XDQB 2XE6A 1WIWA 2V6IA 3SHOA 2GNAA 2FEXA 2C04A 4A8JB 1E5TA 4YQZA 2C96A 4F5WA 4M47A 3TBFA 3VZQA 3U09A 1P3DA 3F3SA 2VYCA 5FUMA 1BN6A 1KARA 4D79A 1X7WB 2ZW9A 1KAQA 4V0MA 1E5VA 4PINA 5EN4A 2JCYA 1K7SN 3LSYA 4NCXA 1Z0SA 1SMKA 3C16C 1S01A 4RIHA 1USIA 2HHXA 1E9BA 2GDZA 4ZGBA 2Q9CA 3OECA 4ZOEA 4ZOAA 1S7CA 2JR5A 5B2EA 1V16A 3RQIA 1EK1A 1N6OA 4IM7A 3MS7A 4K9MA 5A4MS 5K3SA 1A8UA 4ECRA 1AGRA 2I8CA 2W2KA 4IRXA 4B82A 2TS1A 1QCZA 4PCAA 3G2IA 1CZHA 1JSCA 2NU8A 4O3PA 1RKVA 2M32A 4LAFA 3M6KA 3FI0A 2WWTA 4JBXA 4CKEA 1N5WA 4TVSA 3KEFA 4M1MA 4PS1A 3K8ZA 5KVCA 3H0KA 4C7MA 1QZZA 4K6MA 3HYCA 1ZD2P 5CK4A 2QQ5A 1JRLA 3BQ0A 1MJFA 2ZJ1A 4RVFA 3KVNA 3DOFA 3KUCA 4WMLA 4MUXA 3E0QA 1P0CA 4WFQA 1DV1A 4X45A 5SZHB 3VU9B 3SHWA 2XVMA 3EWIA 1A88A 5LBUA 2BTQA 1Y89A 1I4WA 3D02A 4Z53A 4IIJB 5EHXA 2ZJ4A 3IOCA 2ZROA 1EINA 4DS5A 4L2IA 4RANA 2ZUFA 2IIQA 1ZN7A 3BMOA 1L7QA 4YMNA 4GLBA 4UULA 2Q5LA 3DUWA 5ANRB 3SZLA 4RD0A 1Z5VA 3NYQA 2ECFA 3DLTA 2HQSA 1W44A 1AQYA 2R6FA 1C7QA 3M5PA 3LWZA 4NOLA 3REGA 4X6YA 4KLSA 8ICKA 2PUJA 4JQYA 1D9XA 4MRMB 3R9XA 1GGVA 4KQXA 1I9CA 2JLSA 3VNSA 3CM0A 2DWPA 4B5KA 1C7RA 5HHHA 4BBPA 3ZXIA 2YHIB 2X5KO 4HI0E 2G08A 1E5DA 1GARA 4BNKA 2OKCA 4ZTUB 4QQKA 2GCNA 4NLZA 5GZ1A 4B9MA 2D0PB 5GVRA 1LNZA 3KQYA 1CQIA 4BO8A 1O94C 1I30A 4C7YA 4PONA 4L7QA 4Y30A 1DJOA 2W98A 4GC5A 2VSFA 1J2UA 4L0MA 3ZWXA 3SLRA 2G1UA 1Y8QA 3T5BA 2VTVA 3P2JA 1JDSA 3JD0A 3Q9SA 2JIZD 3PQ4A 9ICOA 1N61A 1M3SA 3IAXA 5BMOA 2XAAA 5DB9A 2CXQA 3QPBA 1XN1A 4B0OA 4FGLA 9ICMA 2EF0A 5TR9A 1PT8A 1FO4A 2CVOA 2RI1A 4DL5A 1CP2A 3H1EA 3CXUA 2C0CA 1EVKA 3TFOA 1UCVA 1B26A 4ND3A 2QN8A 3E9RA 1MQSA 2AQ4A 2NV0A 1XWIA 3L41A 5I7RA 4AWBA 4PSDA 5K6AC 1U3UA 2OE2A 4C6SA 5TF0A 1WO8A 4CMKA 3OCVA 1WV1A 2VJKA 1Q1QA 4RKYA 1CY4A 2P69A 3AQ4A 4KODA 3ZLBA 3P2EA 1PR6A 3PZRA 5BN4B 4MGKR 5EJFA 1I1QB 1ZS9A 2UVUA 2UYQA 3CRZA 1X2IA 1DGJA 2YFYA 2MOKA 5DMXA 3KUUA 1GUYA 1G9SA 2Z58A 1J8DA 1N0WA 4XQGA 1TI7A 2FP4B 3RV3A 2CXPA 5L95A 2VLBA 4P9NA 4CG1A 4YJ2B 4DWIA 5C7OO 3F73A 4KPUA 2HBYA 2XCOA 3I2JA 1NNI1 1EQUA 3C8HA 3EY9A 3K31A 3FH0A 1TPZA 1ST2A 1KC3A 2PMZC 2W2LD 3JVVA 4QQRA 4H59A 5CA1A 1UXGA 3MFYA 1M2VA 3UGJA 4HAYA 1WZCA 5CIWA 4IH1A 3TDMA 4U9HS 1R9GA 3USES 3RUAA 3CEMA 3H5OA 4JDPA 3FNGA 3QE9Y 1WUDA 3MR2A 4MYHA 4KYUA 2RE8A 2DHQA 1S2IA 2FX5A 3KQVA 4NBRA 3AIOA 3W5JA 5JXWA 7MHTA 1BW9B 2Z08A 2LMRA 2YV3A 2QRNA 2AR0A 3BCRA 1P4HA 2UZAA 1JE0A 2R60A 1ZW6A 1N6PA 1YBMA 1DXQA 4LJ6A 3NS1A 1H2RS 3DEAA 3RYHB 2P5UA 1QWSA 3HBAA 1I14A 4JJ8A 1SUEA 4JX8A 1JWAB 1HQYE 1HF3A 4LNUA 3Q2OA 3INYA 3PT5A 1GGKA 1F8XA 5G4KA 1L5SA 2GZ1A 4GC9A 1TTTA 2Z98A 4XARA 4YRMA 5FORA 1KOJA 3GLRA 1X1BA 3PW4A 4RD1A 4YHBA 3W77A 2P2NA 1O03A 5KI6A 4W9RA 3NVYA 4YDSA 5M5BA 4E30A 4H7HA 4ZI3A 4KG7A 3U7FB 1SIJA 4IP0A 1W6UA 2JH9A 3CFYA 4KGZA 4EVIA 3CH4B 3SYTA 3WICA 4N39A 4OH7A 1DAIA 3NV9A 2CDCA 4FDMA 3UGQA 5KFBA 3HFGA 5C5JA 1T2EA 4BBJA 1EUZA 5JHGB 3VQTA 3UCXA 1BRTA 5EE9A 4UUNA 4R9UC 2JI6A 3KC2A 3CYFA 4DNOA 5C37A 1BWPA 4WA8A 2DBQA 3MVEA 5ALFA 2NVBA 3B5JA 5TRTA 2PNFA 2MHCA 4DSAA 1EXWA 2PT6A 9ICXA 1QVVA 3M6ZA 2BY4A 1HNNA 2FMSA 1JG4A 4AFNA 3OJCA 1VE7A 4GT1A 3HRHA 2JCGA 3IAUA 2LXNA 3EVEA 1A9XA 4DJAA 2WD8A 4MUAA 2O6KA 3VFDA 2K4MA 2OB2A 1DC7A 3TRFA 4NOMA 1D2MA 3U3MA 1KGDA 4WLFA 2YWCA 2EZ8A 2EXXA 2VH1A 1E2EA 4FUQA 1DARA 3EYZA 1PLKA 3TYXA 2KQUA 4GFDA 3UUFA 2ZJYA 4P86A 4MVJD 3FPHA 5CLFA 1U8CB 4WINA 1CY8A 4JP5A 1X1RA 1KBOA 1U04A 1YQGA 1CV2A 2MUTA 5DT9A 2ALZA 1ACMA 1BD3A 2IY9A 8ICUA 3FZYA 5TDHA 5DN6D 2K6GA 3N2IA 4KNYA 2H9IA 4CIWA 4PCLA 4LSMA 4MV5A 3W6ZA 3IKLA 2IPOA 3HXTA 3PJEA 3SKXA 3IN5A 2O2IA 1EZ1A 3WK9A 2B34A 3A28A 4TURA 2OV4A 4HNSA 2C7BA 4EBDA 2IEAA 1VKZA 1SIOA 3BXXA 5H9WA 2X3YA 3IVXA 3SSNA 1I2CA 1NVUQ 5JNRA 5G3ZA 1JJBA 1V9CA 5GV8A 4NBUA 5KYWA 3A10A 4NTZA 2LDXA 2AWOA 2O1XA 1T2VA 5FLYA 5EY5B 2JJQA 3TZQA 1DXYA 1W29A 2FDRA 2D8CA 3MR5A 2XE8A 1E79D 3F2VA 3LW8A 3OOEA 4OHVA 3S0JA 3COZA 3CP8A 2HDOA 3L1UA 1EMDA 4WUVA 2ZWIA 1GU0A 3ESXA 2X6TA 1K6XA 1F0NA 1BH2A 1RZUA 3P9YA 3HB5X 2PYIA 1NBAA 4WECA 4NECA 2MYTA 5FOUA 4AS2A 3ZOZA 3JWPA 3VNRA 3B8HA 1ZCBA 4C4OA 4EW1A 5CB6A 3ROPA 2PMWB 4FFPA 2IYWA 3FWPA 1NG9A 1XE3A 1GFSA 2WF5A 3RGGA 4G0UA 3FE2A 4QUAA 4C8LA 3BWDD 1TCVA 4MLPA 2GEDA 4KGDA 1O97C 2DUNA 1C1HA 3E9MA 3LQ4A 3QXSA 2YWEA 5FPTA 3CLRC 3G1TA 4MKIA 2QX4A 4LWOA 1ZGGA 1R6VA 5D5QA 1KSHA 2A33A 5JSKA 3TXXA 3I6IA 3SIXA 5FBZA 1DFGA 3BIFA 1JFTA 4DT1B 1QG2A 5DOVA 4XR4A 2FFBA 2W2OA 2NP6A 2FK8A 2F8SA 1RBQA 3DCIA 1WKCA 1GKIA 1Z2OX 3KQQA 4EA8A 4YPOA 3EEIA 4RV4A 1Y9DA 1VG8A 5BSRA 5K6TA 3EK2A 1RLIA 2HA2A 1XZFA 2R8OA 1AC5A 2Z5LA 4NIMA 4V2IA 1SUDA 3MS4A 4QW9A 4LHEA 5DYGA 1GQRA 3LCVB 2P40A 3X1MA 3SF8B 1NMXA 2OP1A 5EKDA 2ZK7A 3S3TA 3JYPA 3MTAA 1XCGB 4RADA 1B1AA 2PLRA 4KE8A 3CNOA 3SEQA 1K75A 3AUUA 3PX6A 3O2NA 1UKCA 3GI1A 5I7HA 3A2KA 4PG6A 3G8AA 2ODTX 3N2KB 1NBOA 4GI2A 4MVXA 2PS0A 4NYMQ 3IYLW 5D3MB 3NX4A 1KRWA 1RWNA 1LI7A 3V97A 2PX8A 3GLHA 4ROTA 1C1DB 3FPGA 1LK0A 4LI0A 4BX3A 5DASA 3PNVA 1U1EA 1X38A 4H6VA 3U56A 3PL1A 1JECA 2I2BA 4M9ZA 1XALA 1J49A 1XROA 2J59A 3UATA 2D1SA 3ZWNA 2AA3A 4U3JA 2QN2A 3C7DB 3MRVA 1L5HA 3VSCA 3QU7A 3AEQA 2OOKA 3GIKA 3N0RA 3VH2A 1ZQMA 4MW1A 4HLCA 1KIMA 1LDEA 2RC5A 5J8YA 2BMFA 1AURA 4Y9UA 2EWWA 4MVWA 1R4AA 3V4VB 3MJDA 4DSJA 2DWUA 1NI4A 3N8DA 3TGPA 3EG9A 1WB9A 3FZEA 3L06A 3DTTA 3ZKWB 2B36A 3TCKA 2JEGA 4RK1A 4LVUA 1PHPA 3VPCA 3LP6A 1BOOA 2LWIA 1TZMA 3LLUA 1XI2A 1F38A 4U02A 1IU9A 3LF1A 3SYMA 2GCEA 4IO1A 1KTQA 2XOXA 2RC6A 2YIDA 5DSZA 4WXEA 3BN3A 1ZYQA 3SEZA 2H2IA 3LNCA 3HADA 3M34A 4A8TA 5DQGA 1BDMA 2IUTA 5DX8A 5C5IA 4P08A 3NHYA 1L5FA 4ZJZA 1OW3B 1KH2A 3NC1C 1W8IA 1K4KA 4OF4A 3OX4A 1XZQA 2PKEA 2FW6A 4KBGA 3IFSA 2J33A 5FFMA 4OAQA 4TL7A 1NW4A 2AB0A 4TMVA 3PQ3A 2Q4DA 4RFSB 5J40A 1P7CA 5A9SB 7ICSA 3L1VA 2IMWP 1P3Y1 1VIDA 2GWRA 2B3TA 4DOAA 1U2TA 4YALA 5AMXA 4F9EA 1K2WA 2HO4A 4XQCA 4X1IB 1BGXT 4YTEA 1RXIA 2C4UA 4ONEA 1URJA 4RVGA 5D84A 3P9RA 5HZKA 3GFVA 4RMHA 1X2EA 2RB4A 2C0QA 2I0FA 1KWKA 2LPMA 4GYYA 2JFXA 4IGIA 2JHGA 5EGNA 2X9GA 1NDUA 2IEGA 4DPMA 4Y67A 4DRXB 1UDXA 3VC1A 1FRFS 3PGMA 1FYVA 1PCXA 2VHQA 4IXMA 3GP5A 2VL7A 1NM5A 4KMOA 5KFVA 3WWPA 1YZUA 2K89A 3EOZA 4I2GA 5AOBA 3AU9A 5BUSA 1NQUA 2PH3A 4KLDA 1EFRA 3C5WP 2ZQZA 1A4IA 3NANA 5TQ0A 3L6BA 3DP9A 4WIAA 2VZ0A 3TVDA 3NRJA 1Z26A 2FJ0A 3AFIA 2C5AA 1X7HA 4CXMA 1GA4A 2MT9A 2FU5C 4CGYA 3ZPXA 3ISVA 3DLCA 2FZGA 3I9NA 4DTCA 3VKVA 1NW3A 3A05A 3UHPA 1KI9A 1CQJB 1DE0A 1M2OA 3DO8A 2J9GA 3CX4A 4D9JA 2X76A 3HQ4O 3HU2A 3H5NA 5DVZA 1WULS 3ETRA 3ZHOA 3E3MA 5FBKA 2XCRB 2FUG6 4QFCA 2AN1A 5AW4A 1HJPA 1CVRA 4P3OA 4P53A 2ARKA 4RL4A 3QSYA 3D5EA 1AOXA 1KKXA 5HF5A 3ADPA 3BSSA 2MMGA 1P1BA 2J0VA 3IEPA 1O94D 5A4DA 3BE4A 5ECDA 2CE7A 1XUOA 3OFKA 2BR0A 1GNTA 5F1PA 1OE0A 2HHAA 1APBA 4EF6A 4ZJYA 3H0RB 2ZB2A 5KVAA 3V9AA 3UPUA 4BE7B 1DKRA 3ER8A 1XVVA 2JLVA 1HGXA 1NRIA 4UU1A 3OKFA 3A4IA 2IHUA 4LKRA 4W4TA 1YCHA 4JC8A 2JW5A 3KOUA 2R65A 3W8EA 3TLYA 4BO7A 4ZVNA 4GWKA 3KBOA 4TYQA 4O3MA 3D3QA 3IIIA 4PO8A 1LKZA 1E4YA 2PKCA 2EFYA 1FP2A 3GIDA 2EZ4A 2QU8A 3RC2A 1AROP 4BGDA 5AKJA 3KOOA 4PTLA 3KNZA 3C74A 5KVSA 4LEIA 4R1LA 4Y2YA 1SXJA 3MINB 3QJYA 1XZIA 3D8HA 4C22A 4H6WA 1KSFX 2B8JA 1BZYA 3E4CA 1WCYA 3GPLA 2V6MA 3TQ1A 1QSGA 2QLLA 4I9UA 1JH9A 3CKYA 2Y9TA 3OKCA 2XTMA 4BBZA 1Q0SA 5IF3A 1KJZA 3VPAA 4Z7NB 4GEGA 2HB6A 4GOMD 3BTOA 2RGWA 4MF2A 1KAMA 4A0GA 3GJ0A 3T3HA 3DDWA 4BFXA 5HR7A 4IIYA 2ZYVX 1ORTA 3RUCA 4DJEC 3LKVA 3VJLA 2NO4A 5KFKA 4FZ5A 3R0IA 1BAPA 1ECFA 2VT6A 1I3CA 2WP8J 2PSHA 1V1JA 2XXAA 1N5LA 4K9DA 4M8KA 3D54D 1L3VA 1U7OA 4LPSA 2QM7A 1WNTA 2O8FA 4A2WA 8ICSA 3A9TA 1JEJA 3OOHA 4K6GA 1B8OA 3VSDA 3U7GA 1ZR4A 2I7VA 4MUHA 4R2JA 4AZ0A 5KOYA 4CYMA 3OJOA 1DC3A 5A2QA 4YCLA 3QHQA 1DJPA 1UWKA 1N8NA 4EGJA 2QG9A 4P7KA 4HMPA 3V5NA 4ENPA 1P5ZB 2XNCA 4UNRA 4UQGA 5EP1A 4AZTA 2FG5A 4QWEA 4UTPA 2ZI9A 5L45A 3GBPA 2X86A 8ICBA 1VYUA 2O7NA 4KH1A 3QVGA 5CNJA 4UW9A 2CHGA 3WRVA 3LP5A 3QXJA 1T3HA 1W9HA 1V38A 5CR0A 3PUZA 2HRBA 3LHKA 3FDZB 3M4YA 1OVGA 1A5SB 3RUHA 5EWJB 4DA9A 2VA3A 5CH5A 3QPDA 3KTAA 5ALUA 4PXYA 2WAQC 2V54A 2WHEA 3R6GA 3HY3A 3DQZA 1YIDA 4Y9DA 1GAJA 3HN6A 4FFBA 2R18A 2UUOA 4QJ3A 4ZHQB 5E3IA 4NP6A 1UXJA 2VUSA 4C0QC 1TMGE 4KVGA 5ALQA 3BQ1A 5F9HA 2YW9A 1Y4SA 1X9XA 2RGUA 4G5XA 1YOVA 1P1JA 3CG0A 5KTSA 1GY8A 4BVAA 4XGRA 4DLVA 1FSGA 1Z4KA 5SICE 4QNMA 2RH5A 4FD2A 2P3LA 4XD7D 4DMUB 2XMSA 2PSFA 2EP8A 3RH5A 4BFLA 1Z62A 2NM0A 3QX9A 4HDNA 4JSYA 2NVUA 3WYFA 1OYVA 2E49A 2FE9A 3JRWA 1DK3A 4RAOA 1WY5A 1DX6A 2CYCA 2ISSD 1FSZA 1LJLA 4YLYA 3M9WA 5B55A 2YN0A 3OD1A 3LT0A 5EJAA 3WGLA 4PAMA 1I01A 5ALEA 1ZH4A 2XQFA 2VDLB 4WQMA 3CPSA 4I8XA 2VT2A 1EM6A 2Q8NA 4CQMB 1NVGA 1LKYA 4N3NA 1P6UA 5D01A 4ND5A 3K7EA 7ICIA 1ZQBA 4OSEA 3GGJA 5HCUA 1GYPA 3E3AA 3QVWA 2J08A 2F8TA 1UM8A 3AKYA 2FWMX 3PSIA 2QT9A 2HCJB 4ZCMA 1FNCA 4TRJA 5KWEA 2KBEA 5DPMA 1MQ8B 3K30A 1NK7A 4O2RA 3RB4A 721PA 2FRVA 4M86A 3EA0A 4M0UA 5HNKA 3QEOA 1EFKA 2NZUG 2ZYRA 1SCKA 2OCBA 4R7TA 4CTMA 2H1IA 1GGEA 5AKZA 1L6NA 3IP9A 4TV9A 1SD2A 1GL9B 1VBNA 2ZSEA 3GJ5A 2BR5A 4KLGA 3K5IA 3D1JA 4BAUA 3OC6A 5KSOA 2DX7A 3H7IA 2OUIA 3P2MA 2WFLB 2ZUTA 1CETA 4U2FA 1HE8B 1HMPA 4C3ZA 5H02A 4E4TA 2OXEA 3BIOA 2Z0MA 4KPFC 4CM3A 4QFBA 4BVBA 1MC4A 3GNTA 1AKNA 3TQIA 3PKIA 2AOTB 4LVOA 5K3OA 2D74A 2WABA 1I6KA 1I3NA 1CUVA 3QF4A 1EDOA 3OLVA 4P7FA 3H17A 4DV1B 1OWOA 2Y27A 4LRUA 3NDPA 2ZIVA 1QMGA 3S2YA 2X7HA 1E2GA 2HJ9A 2C3YA 3V34A 3ZQKA 3OZVA 1ZD5A 4TZKA 1E1DA 2DQ4A 2KM1A 2YN4A 4QBGB 2GPNA 4Q4AA 1DRUA 2NNLD 4P4OA 2FPUA 3L92A 2BSQA 1RAGA 3IEVA 4ADSG 4W82A 1UK9A 3VA7A 2ZUCA 4QICA 4DQDA 3WGOA 2RHHA 3BREA 2GX6A 3EDCA 2PI4A 3GLFB 5EAIA 3SQNA 4YUWA 4QDOA 1ZEJA 4X6LA 3NJRA 4DKJA 1BKYA 3F74A 2YC4C 2PUHA 1TKCA 1UZLA 2CXOA 1Z0FA 4GFJA 3F53A 3P52A 1F2UB 3WK6A 3AEUB 4XCXA 1TU3A 4UBOA 4QGFA 2LCIA 2EWVA 1YUNA 1GVHA 1YACA 4B2LA 1AO0A 3LWLA 4IV0A 2QTCA 4KLUA 1Q14A 1GG8A 4Y6SA 3ENKA 4DIBA 2BM0A 2D5IA 3KL2A 5CLHA 1OB2A 3C43A 3W6OA 4UDXX 3UKDA 2PJZA 4FCTA 1B73A 4WZAA 5TS3A 4GQAA 1JPNA 3AOEC 1CU1A 1SY7A 1SB3C 2Q5JA 2D8AA 3RS5A 1CVIA 1O97D 1M0EA 2P3OA 4Z9FA 1QNLA 4MYUA 4DIEA 3CLRD 3Q7TA 5EKSA 3GZFA 2WYWA 3M6VA 1GZ7A 4UHBA 4GDFA 4YJ3B 4LYFA 3WZ2A 1CWUA 2A9RA 2O2SA 5HKKA 2OMKA 4DQQA 2FPGA 2VJYA 2WU4A 4N0EA 1AKRA 4EYQA 1R4ZA 3DPUA 2YY5A 4INZA 1FBNA 1NRJB 5AI0A 1ZIPA 1CUWA 5FHRA 1W6RA 3SS9X 3ZV6A 4D2IA 1J2YA 1A7KA 1U8ZA 3LUGA 1KDOA 1RQXA 2QPTA 5KNCD 4YMUA 4JBIA 4EUHA 1B8UA 4PLFA 2IEDA 3LDGA 2W90A 2YFQA 2UYGA 2AIRA 1Z7GA 4GPBA 3UJ7A 1R0SA 3N3AC 4K6CA 3JARB 1KLNA 4TRMA 3IH5A 1GUZA 1MC8A 2XY5A 3IMGA 3DVRX 1KTIA 4ZEXA 3B3GA 1AS0A 2IELA 2XZTA 3SAGA 4B46A 2ANBA 2V7TA 3QFRA 5I7VA 4ZI5A 3IR6A 3ZGNA 4PNEA 4CU5A 1S89A 3V6JA 1L1FA 2WUVA 1E1NA 3UAVA 3NXKA 1Z19A 5L3RA 2I3BA 5ALMA 2FSGA 3UFXA 4NV3A 5AO9A 2EDCA 2NWQA 1RACA 1FW6A 2GXSA 4N8EA 1E3SA 2WF7A 5FXMA 2WY2D 4GO1A 2AEJA 2ZIUB 3B13B 9ICJA 2CL0X 1U8AA 1AZLA 7REQB 1Y7PA 2QTAA 5GIOE 3FSGD 3IX7A 4JZYA 2XGQA 7ICJA 2XTNA 2ZTMA 1M5UA 4KJZA 5J2TA 1K8RA 3FOEC 4N48A 7ICQA 4YC7A 5TJ9A 4BLTA 4OK3A 2FZKA 3R3HA 3OPYI 2ZEJA 1GRVA 1Q6ZA 2Q6OA 3P2YA 1CEYA 3U26A 1DRWA 3AM5A 3HVIA 1WDMA 3BYZA 2C7QA 2OXTA 1VIAA 2BUCA 2EFHB 2Q0QA 5THXA 3B5IA 3HCAA 4TTVA 4PJ0U 1EFRD 1YQXA 3F2DA 2NTNA 3L7JA 5TPZA 4P1ZA 2NU7B 3OBBA 3SJBA 4G1VA 2QT0A 2W3SA 3UMBA 3PQFA 1DNPA 3SDSA 1N7HA 2KZZA 3AUKA 5EWGA 3Q8SB 4ECSA 4UTRA 3HLTA 3WAJA 2J41A 1HEIA 3RSGA 2D6FC 1A7AA 4M9UA 3MCZA 3V80A 2JAXA 3C8ZA 5EZSA 2BGWA 2RSLA 3NTRA 2QD2A 3PZBA 1NPTO 2JAQA 1P31A 5EQTA 3CSSA 3CUSA 5KOJA 3H9BA 4K9KA 4EITA 1AA6A 3DJFA 3MTBA 5HF8A 2R6GA 4L72A 2REBA 3NOXA 1M2HA 2JAUA 1H85A 4YP7A 5CDTA 1NX9A 3OQNA 1JQBA