2NZ4A

Structural investigation of the glms ribozyme bound to its catalytic cofactor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Investigation of the GlmS Ribozyme Bound to Its Catalytic Cofactor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
molecule keywords substrate strand RNA 13-mer
total genus 23
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nz4A00
4LIRA 3CPWR 2DGWA 5HL7Q 2HVZA 2Q79A 2DNKA 2LECA 2KI2A 1FHTA 2V94A 1FJCA 2LQ5A 1URNA 2DNRA 1U1PA 2KH9A 3IRWP 2KG0A 4W92B 1ZZFA 1WI8A 1ZH5A 2M7SA 1KOOA 5GAEU 2CPYA 2DNHA 2RT3A 2DGUA 2HGNA 2MY8A 5DM6Q 1X5OA 4P6QA 2MJUA 3S6EA 3MUTP 4IO9Q 2M52A 5GAHU 1X4FA 4M5DB 4WFAQ 1PGZA 2HYIB 1S79A 2BOPA 2XB2D 3S01A 2J76E 1FXLA 3CMAS 1WHVA 2RQCA 1XN9A 3MOJB 2I2YA 4ERDA 2D9OA 4YB1P 5LJ3Y 3DXBA 2BZ2A 4A8XA 4F26A 1UAWA 1X5SA 3VAIA 2J0QD 1CVJA 3TO8A 1X0FA 4LJMA 3UD3P 1YITS 2G1DA 2CPZA 3BEGB 1UP1A 5JVGQ 1M5VC 2CQCA 2FC8A 2M8HA 3L3CA 3JB9k 1M90T 1WG1A 2NLWA 5LXYA 2KXFA 2PEHA 2RS2A 1U2FA 1SJ4P 4TU8A 2KYXA 4IUFA 2DHXA 2AYGA 3G96A 3U1LA 4UQTA 2RU3A 2O3DA 5CA5A 1KD1T 2LKZA 5DDRC 3J7ZT 3CCMS 1U1NA 2MGZB 5IQQA 2JVRA 2VODA 1YHQS 2CPFA 2KFYA 3VAFA 3ULHA 2MPUA 4F25A 2RRAA 3I56S 1M5OC 2MXYA 1VC5A 1F9FA 4Z2XA 1VBZA 1ZZNA 2MKIA 3TYTA 1A9NB 4U67Q 2MSTA 1SJFA 2FPHX 1UW4A 3MI7X 1VQ6S 4QQBA 2MQOA 1JJ2R 3VAGA 3PIPQ 1VQ9S 2AYMA 2YWKA 2KVIA 5MLCV 2MQPA 5BJRA 2YH0A 1N52B 2M4MA 1U6FA 1OPIA 3EX7B 4WCEQ 5IFMA 4WFNQ 2B0GA 4RU2A 3THTA 1X5TA 4CQ1A 2AYBA 2JVOA 5CXTA 3CMES 2MKSA 5FJ4A 1VQ7S 1QVGR 2X1GA 3S8SA 4TLQA 3OW2R 2L08A 3G9CA 2DHSA 1WHWA 2YTCA 4WFBQ 5IM0A 3SXLA 2MHNA 2OTJS 2LMIA 4ED5A 2ZJRQ 4WF9Q 1KOHA 2DNYA 1PO6A 3P6YC 2DB1A 2KHCA 3CCSS 1DZ5A 2LXIA 1KQSR 3H2UB 2X1AA 3G6ES 4QPTA 4UY8T 2CQ4A 3CC2S 2CQBA 2LEAA 5LSOA 3CTRA 3MD1A 3CCVS 2CQ1A 2DNPA 3FEYB 1HD1A 4V19X 1N8RT 3V4MA 1SXLA 1VQ5S 3US5A 1Q86T 1U1QA 3UCUP 2LYVA 3IWNC 5JVHQ 1L3KA 4YOEA 3EGNA 2LEBA 4C0OC 2M8DB 2MSSA 3UD4P 5EN1A 2N82B 5GADU 1FJ7A 5LSLA 3MD3A 2MY7A 5D77A 2K3KA 1UFWA 2G0CA 2F9DA 3CF5Q 2KRBA 1WG4A 3G8TA 1YJWS 1M5KC 4EGLA 3DLLQ 4Y00A 3B4DA 1G2EA 2N3OA 3VALA 3CC4S 1VC0A 2E5HA 4FXVA 2XS7A 1X4CA 1Q81T 2DGOA 4J5OA 3MXHP 1K73T 3CULA 5HO4A 2CQHA 5IM0B 2VONA 2X1FA 1DHMA 3VAKA 1Q82T 3FEXB 2U1AA 2XSFA 2L9WA 2D3OR 5ITHA 4TU7A 1OO0B 2MZ1A 5DDOC 2QA4S 3UCZP 1X4GA 1S72S 1WELA 2DHAA 4C7QA 1QVFR 2MQLA 2QEXS 2CPJA 2RRBA 3D2WA 1D9AA 4LMZA 3ZZZA 2KRRA 3S7RA 2LXUA 3NS5A 5GVQA 5LXRA 1FNXH 1VBXA 2RUGA 3R1HA 3TP2A 2MKHA 2A3JA 2MZQA 2DNQA 2MMYA 2ADBA 1H2UX 1VQNS 2XS2A 1B7FA 1K9MT 2MKJA 2KG1A 2DGSA 2M2BA 4CIOA 3CCUS 3VAHA 3CXCR 2DH7A 2FHOB 2XS5A 3NMRA 2XNRA 1N88A 1HD0A 1NO8A 4TU9A 2MGZA 2FC9A 2DIVA 2N7CA 2OJ3A 3P5TL 3RW6A 2EK1A 1X5PA 2DNNA 2ADCA 3UWTA 3P49B 2CPIA 1Q7YT 1WF2A 5GMKa 1SJRA 2DNMA 4IOCQ 2FY1A 2MJNA 3ZZYA 1WWHA 1DBDA 1WG5A 2CPHA 1U1RA 1JMTA 1U6BA 2YH1A 4YUDA 2RNEA 2EK6A 2AD9A 2CPDA 2UP1A 3Q2SC 2G4BA 4OZ0A 4PR6A 2KM8B 2J0SD 2DGXA 2U2FA 4C4WA 1P27B 2CQPA 3CUNA 2VOPA 1VQ8S 4OZ1A 2XNQA 2DGTA 1WHXA 3I55S 2OTLS 2CQ3A 2MQNA 2QFJA 3NS6A 1FT8A 1VQMS 2KXNB 2RVJA 2E44A 1SJQA 3HI9A 1VBYA 2M9KA 1WHYA 2N3LA 1AUDA 1O0PA 2E5IA 1VQPS 3CC7S 2DH8A 1WTBA 1SJ3P 3Q2TC 3H2VE 3VAJA 3LPYA 1NJIT 2MZSA 2CQIA 1WF0A 2DH9A 5H1SV 3RW7A 2CQDA 1OWXA 3THPA 1VQ4S 3U1MA 1M5PC 4IOAQ 3G4SS 2DO0A 3N9UC 3G71S 3R27A 2J8AA 1N54B 2I38A 4QU7A 2OIHA 5CYJA 3K0JA 3G8SA 2ERRA 1YIJS 5DETA 1R8PA 2HGLA 2M88A 1U1LA 4Y0FA 1YI2S 2M0GB 2EVZA 3UE2A 2CPXA 4FXWA 2JWNA 2NZ4A 1H2TZ 2E5JA 1D8ZA 4QU6A 3CCRS 2SXLA 4CH1A 1FO1A 1X4DA 2AYEA 3CCLS 2MZTA 1BY9A 3BO4A 2LA4A 4CH0S 2ZJPQ 1JJHA 3R1LA 2MQMA 3SDEA 1YWXA 3NNAA 3HHNB 2DNLA 2KT5A 2DITA 1P1TA 1X4AA 1YTYA 1HL6A 3P3DA 1A7GE 3MUVP 2MZRA 2E5GA 2HZCA 3SMZA 3EGZA 1M1KT 2DNOA 2X1BA 3LQVA 3UCGA 1NU4A 1RKJA 3BS9A 2OSRA 2DNGA 3CCQS 3PIOQ 2MKCA 2DK2A 2DO4A 2F9JA 2OSQA 1WEXA 5DDQC 3CCJS 1K8AT 2K8GA 2RS8A 2WBRA 2CQ0A 3MURP 1WEZA 5DDPC 3BO2A 1QM9A 1JJ4A 4W90B 1U1MA 5LJ5Y 1RK8A 2DNZA 1WF1A 1U1OA 1VC6A 2MQQA 4PKDB 2CQ2A 2GHPA 1U1KA 2CQGA 2JX2A 4WKRA 2LA6A 1H6KX 1WEYA 3MDFA 1IQTA 2ZJQQ 1X4EA 2CPEA 1FJEB 2MKKA 2DGQA 2YKAA 3NNHA 2VOOA 1W2BR 1WI6A 1H2VZ 2KXHA 3B4MA 2LCWA 4WIIA 2PE8A 4ZKAA 1VQLS 2MYFA 2CJKA 3SDEB 5DM7Q 1YJ9S 2M70A 3J7YU 1X4HA 2L41A 3BO3A 1VQKS 2RQ4A 2KM8C 4F02A 1X4BA 2MB0B 2MZJA 1YJNS 1VQOS 2GO9A 1R8HA 1HA1A 3NNCA 2KN4A 3CCES 1KC8T 4BS2A 2KU7A 1OIAA 2DISA 1DRZA 2JRSA 5D78A 2F3JA 2HGMA 3CD6S 2DIUA 3MUMP 3VF0B 3VAMA 5GAGU 2DGVA 2D9PA 2DHGA 4PRFA
chains in the Genus database with same CATH superfamily
4LIRA 2L48A 3CPWR 4B9UA 2LDYA 3J7AN 2CNNB 2Q79A 1SC6A 1YJRA 3CIMA 4DZDA 3GIJA 4ED6A 2RD5C 1JLGB 2QYGA 4C8ZA 3BF4A 4LSNA 1XQIA 2H5EA 2V94A 1XC9A 1X7VA 4LF2A 1XMBA 1PJ7A 2DNRA 4YDDB 2FB0A 1WC4A 5KAKA 2KG0A 2NXUA 3PYFA 4W92B 1UZDA 1SKSA 4PYAA 5KFCA 3PFOA 2HFNA 1WI8A 2HS3A 2YWHA 4TLRA 1DARA 2M7SA 2WOMA 3LP1A 4WPAA 4QWEA 4ZPTR 4HT5A 3K58A 4OZ3A 2RDDA 2KDOA 1SL1A 1RYSA 2HGNA 2VZ9A 4MK7A 3OV7A 3MAHA 5K14A 4OI0A 2UXDJ 1X5OA 3MEDB 1QAIA 3NMAA 3DOKA 3R2DJ 1KSPA 3TAQA 4IO9Q 2HW3A 2ZH8A 3DDIA 3WZ0A 3AD9C 2RRNA 5CYQA 3LWLA 2QTWA 1PGZA 2HYIB 4DR6J 2XB2D 4DQSA 1OPZA 3NOGA 3W9JA 3EZ5A 3QGGA 4NCGB 1FXLA 4KTQA 2BQ3A 1U1OA 5A8RB 3MOJB 2Z4PA 3LH2S 3FJ2A 3BYPA 4P9SA 5C24A 1AYEA 2BJ7A 3MAAA 4J7CA 4YB1P 1FXRA 2W9BB 4CM0A 4LRBA 3RB3A 3HHKA 1G4CA 2HFOA 3KHLA 3IR7B 3WBZA 4A8MP 2JNJA 2XI2A 3VAIA 2W7PA 3FDSA 1VCTA 2Z0GA 1FERA 2B3TB 4LJMA 1SQFA 2G1DA 1UFLA 2AW0A 1C0TB 3JQKA 4OYXA 4Z7YA 4J91A 2E1AA 5JVGQ 1M5VC 3GU0A 3N5BA 3R9LA 4ECSA 1M90T 4ZPAA 2ZEJA 5CCMA 2HNZB 2PT0A 4JV0A 3UI3A 3X1LB 3LANA 1SJ4P 2F8EX 4TU8A 2KYXA 5J2PB 4DLGA 3RB0A 4BCAA 2ASLA 3SSQA 3U1LA 4Y2CA 5FDLA 3M8PB 5CA5A 4DL7A 3KWMA 2AP6A 2MGZB 4PQUA 4KRWA 2JVRA 4NE9C 4C0HA 3OSNA 4JV5J 1YHQS 1HHSA 1KQGB 2N4DA 2W01A 2VJVA 5KFBA 5C24B 3BKTA 3ETMA 2KFYA 5ADZA 5L38A 2PFDA 1R31A 2XMVA 5C42B 3NG8A 1WSVA 1TKTA 3FUYA 4ZPWR 2BE7D 2GQQA 4OZJA 5KFAA 5DLFA 2RRAA 3PRDA 3K17A 2BANB 1UA1A 3R7SB 2P8IA 3DXSX 4C8OA 1LWCA 2IRYA 2JOQA 3PM9A 2CJ9A 1HNZJ 3PRBA 2K06A 2FLOA 3EDRB 3R6LB 4H4KA 4C3MA 1N5YB 1YJUA 4PEOA 1A9NB 3ENAA 1ZM4A 3V4IB 2MSTA 1SJFA 1VMBA 1JLGA 2FPHX 2G13A 1U09A 2IC3A 2JDJA 4B3SJ 5HAOA 1MW7A 2I1RA 1VQ6S 2L9NA 4ZK7M 1RTIB 4DS5A 2IVYA 1KQSR 4BDPA 1EQMA 1S48A 2VPWB 1A0OB 2P5VA 3IWLA 2OPRB 1BD6A 1MNEA 3PIPQ 1S9GB 2AYMA 1SIZA 2BKNA 2KVIA 4DUYF 3SCIE 3FSIA 3NBPB 2HEKA 2VV5A 1S59A 4KV8A 2BE2A 4KB7A 4DOZA 1U6FA 2C28A 1TU0B 3N6LA 4YY3J 4WFNQ 3SV4A 1NCLA 4CLKA 4ED7A 3H8YA 5F8MA 3JSMA 2IM2A 4MK9A 2VPYB 1C4CA 4CQ1A 3M6XA 2BKPA 1HBUB 2OPSA 4Q7AA 2PMZD 4PUOB 1TVRA 2MKSA 1QE1B 1Q78A 1RWOB 2X1GA 5GAHI 5CD4H 1QVGR 3OW2R 2OMOA 5HMXA 2XYHB 3HVTB 2P9GA 5I3UA 3CD7A 2WW4A 1FD2A 1EP4B 1TZ0A 4C6AA 9ATCB 1WHWA 5CCLA 4KH0B 4DG1B 4X65J 1XR6A 3G6XA 2MLZA 2OMLA 3BGRB 3HSDA 3E01B 3TJ9A 1R0AB 1T03B 2ZOFA 3SXLA 4ENOA 3TUZC 3T19A 3DLGA 3F0NA 1D1UA 4J9QA 1TFWA 2OTJS 3M32B 2ZJRQ 1QTMA 4F2SA 4WF9Q 4OYMA 1RBAA 3P6YC 1IKXA 5IS2A 3CCSS 4ECXA 1HQEA 1FI4A 2EWHA 3DRYA 4NRUA 2LXIA 4ZP7A 5ETQA 5T7LB 4ED0A 1RJJA 4QPXA 1M1HA 3OFHA 2YKMA 4CWBA 2ZM6J 3LOUA 4ZN1A 2J7WA 2E9RX 3KG0A 3TAMB 2RQKA 3MD1A 4URQU 4OYAA 1PKUA 2Y1IA 4J90A 2FJEB 1U45A 3AXKA 1HQ2A 2EFPA 2KKHA 3B54A 1I5OB 3PYEA 3QPIA 2QG9B 4AUKA 4Y2IA 2XEXA 2O5DA 1T0TV 2HG4A 4H4OA 4MJKA 1HWIA 4CH7A 3D0HE 1PAUB 1NK0A 2G0IA 3O5TB 2NYHA 3EVMA 4F3MA 3FK4A 5BYRA 4UZCA 2V8DA 1L3KA 3LF0A 1LQ9A 3MCOA 2LEBA 2C3MA 3BZQA 1YX2A 1S5ZA 4U6PA 3M9MB 3OL9A 2N82B 1S76D 3KDNA 2QGFB 3C66A 3ILOA 3T5KA 1OYDA 1MROB 3PX0A 5D77A 1ZAWA 1HR0J 1HNWF 1UFWA 2YNFB 4C3KA 2G0CA 1XEZA 4FP9A 4J9UE 1JKHA 2OHDA 4OFZA 4HACB 4DX8H 1TL1B 2BW2A 3MECB 2C2NA 4OI3A 1F2GA 1YJWS 3DM2B 2IBKA 2W4PA 2YQ3A 4FVMA 4ES2A 1QUVA 2YNGA 4QZVB 2WVBA 2Z2ZA 3I31A 5H9FJ 4RW9A 5JMNA 3M8YA 2CJBA 2ZOGA 3PJXA 2JZ5A 1TR0A 5DO2A 2W9CA 5EWEA 3AOAA 3JSBA 2C22A 1S4FA 3J81Y 3M9OB 2XS7A 4LBIA 1Q81T 1CS4B 2DGOA 1S99A 1S9GA 2XMJA 1NK8A 3EUNA 3EZUA 3T9ZA 4BC9A 1K73T 5ETMA 4PWUA 3CULA 4DG1A 1D3WA 2IM0A 4G1QA 2U1AA 2OPRA 3R97A 4PG8A 2E1CA 1RXOB 5E7OB 3ET6B 2CJQA 5KFGA 3D66A 2A2CA 2NPIA 2ZE2A 5K5MA 1KN6A 2HWHA 2P6SA 1RTZA 1OO0B 3ZO7A 2MZ1A 4PPZA 1IM4A 2B4UA 2FTRA 4DV1F 1IBMF 4WYLA 3D5MA 2F65A 3QLHA 2A6MA 1Q4RA 4NMXA 1NSKL 1LWCB 3HJVA 3AQPA 3R7BB 4GRSA 4HR2A 2KL8A 4WJBA 3BV8A 2G2ZA 3DLBA 3HX9A 4OHWA 3IG1A 4WXOA 2NREA 2B4VA 1PAEX 1S1XA 2FJAB 4WFZA 3TA2A 1I6JA 4F4KA 1NXIA 3MEGB 4ES3A 4P74A 4LMZA 3POTB 1I3OB 3OTEA 4GVBA 4OX6A 4ZVPB 3TZWA 3I96A 3M2RB 5IC4B 5T14A 1XR5A 2HFVA 3Q83A 2WZ1A 1FNXH 1WUUA 3BPSP 1TL4A 3GG1A 4P2SA 4C97A 4I2PB 4DCOB 2CA9A 3VVUA 4DU8A 2FJWA 2F63A 2R4FA 2VH7A 4MKVA 4RNHA 3W8GA 4YFUA 3R1HA 3RR7A 4ELUA 3KLHA 4IFVB 1P1LA 1Q79A 2MZQA 1SCJB 4UOGA 2DNQA 2MMYA 3MM9B 1Q16B 3Q0AA 2ZWOA 1VQNS 1FCAA 4MT1A 3KLGA 4ILLA 1S1WA 4S0MA 5HANA 2KG1A 2DGSA 5A8RA 2M2BA 4CO3A 1PJ6A 2LQ9A 4NXMF 2AJQA 2R7VA 1HBMB 3CXCR 1N32J 3G82B 5DQHA 3NMRA 4KR0B 1YBTA 1K0TA 3H5XA 1HD0A 2RF2A 1FWKA 4EMDA 3HVAA 2HNDA 3MMAA 1GK8A 4TU9A 3OVAA 4CLPA 2V9KA 2FC9A 3Q89A 3SSSA 4LRFA 4NLRA 4B17A 2YNHA 2VQFJ 4IFVA 4NA3A 2Y8WA 3P5TL 3U1NA 1J5OA 5BR8J 4X4OA 2QX0A 1X5PA 1WKLA 1RT6A 2J6UA 5AJ3F 3W9HA 5KFNA 1UJ6A 4C11B 2ZVIA 3Q8SB 4O4GB 4RW6A 4DR2F 1HWUA 4LF6J 4DV4J 2MLYA 4IOCQ 2IDLA 2C2KB 3BBCA 3ZZYA 2QRRA 4OYPA 3FGVA 1UCNA 4NLUA 2AV5A 1WG5A 4M5JA 2BKOA 1D9FA 2V8PA 4P7VA 1JMTA 1XIQA 5CYQB 1FFGB 2C2MB 2CUYA 4O44B 1IKVA 2BACA 3T1HJ 2RNEA 4KC5A 4OYIA 3KJQB 2IVMA 1QY7A 2UP1A 4BWJA 2EBEA 2CZ4A 4X66F 4CT8A 4WIQA 4ED4A 2RDJA 2EEYA 3DOKB 1QSYA 2G4BA 1RKIA 2R8HA 4LF6F 4J9MA 3UNGC 4DV4F 2CZ9A 4QYRA 5C7PA 2L3MA 2W1BA 2O01C 4RBUA 4Q8EA 3DRXA 1TQLA 4DZ6A 3BDEA 4F0HA 1VQ8S 4DFKA 2DGTA 4B3MJ 1XERA 3FQLA 4X62J 1JLFA 2DR6A 2QV6A 1EKRA 3NEKA 3GFZA 4CLLA 1S7HA 3QZ7A 3H7HB 1FT8A 1Z2LA 1VOMA 4HTIA 4OI4A 3SSRA 4DFMA 3FVYA 3W9IA 4YHHJ 1VRTA 2VBWA 3IGVA 4X66J 5F8JA 3CDUA 1RCXB 3H20A 3HI9A 3W8PA 2ILYA 4A8WA 1Q0NA 1SH0A 3K59A 2P6TA 3K5OA 5HJYA 1AUDA 4DR7J 1VJQA 2DH8A 1WTBA 2MTLA 3UDLA 4DPYA 1HNVB 2W25A 3CMQA 1SJ3P 5L8RC 3SIPB 2OH2A 2R7XA 1S12A 3L9ZA 3QO9A 2NS1B 2CG8A 2V68A 4TYAA 3UDEA 4NCBA 3RW7A 2HRTA 4FPRA 3M2RA 4PXEA 3THPA 4ZVSB 3U1MA 2JC1A 1HPZA 1G7CB 4DV7F 2AHOB 1LV5A 1T02A 1X9MA 1I94J 3UVJA 2J8AA 4B3TJ 1FXDA 3BBBA 1HW9A 3QRRA 4OX7A 2B5JB 2HRUA 3GJSB 3G8SA 2ZH5A 4ECUA 1AXQA 4OHVA 4I7FB 4U96A 2HURA 2XYGB 2O1PA 3CJKB 1AROP 2HGLA 2AMCB 2D74B 3DHXA 2AZ1A 3JTNA 4ZIWA 5B08A 3OR1A 1ZM2A 2OPPB 3EGVA 3OT9A 4JI2F 5CAAA 1DLOA 2EVZA 1FESA 3C15A 1JQGA 2B6AA 2XYPB 1MN9A 1UEUA 2PA8D 1RT1A 1Y9OA 4N7TA 5AE1A 4X64F 4DV3J 1YVFA 2JWNA 4LIWA 4H4KC 4FDFA 4FYYB 3M1VB 4OHZA 1TV6A 2GV1A 5LMUF 4QU6A 1TKXA 4CH1A 2FDNA 1FVQA 3SFUA 4QCLA 2CWKA 1JNRB 4A4JA 3HK2A 1X4DA 3HSZA 4KT0C 1Y5NB 2ZH7A 1BY9A 3UD5A 2AQ4A 3D6TB 4ZVUB 2F4VJ 4JI2J 1WOSA 3VWSA 2LA4A 3CJ8A 3IBFB 2E7WA 2OPPA 1PJ5A 1G3OA 3M2VA 4ILRA 4NASA 1JWWA 3I0SB 2LXFA 3M05A 1SKUB 3NNAA 1FRLA 2X3DA 3GR1A 2HFZA 2CJAA 2DNLA 1TL3A 4ECRA 4LF5J 2DITA 4K4WA 3X3UA 2R8KA 3QGPA 1X9WA 5CQGA 2QLBB 2ZC3A 5DRKA 3SCKE 2CAJA 2B7BB 1VIOA 2HZCA 1AA1B 1UL3A 4DSIA 1CEZA 4I2PA 4MK8A 4C48A 1WOPA 4RO0A 2UVWA 1K47A 2DNOA 3MZIA 2X1BA 2FGOA 3LQVA 3UCGA 3RTVA 2OPQA 4LF7J 2H5JB 3BS9A 4NLVA 3UR3C 3BPDA 3KYLA 2R9LA 4B9LA 5J1EA 2XMTA 2BE9B 1JK9B 2MKCA 2XG8A 3P45B 3PIOQ 2DK2A 4ANCA 4AT1B 3V81A 2JEGA 3MGJA 5DDQC 4IFYB 4B08A 3FBBA 4X4SA 2K8GA 4QBUA 1RQ0A 2W7OA 3HSJA 4DSKA 4P71A 2BJEA 1VHIA 2OKQA 2BA9A 1UVIA 5AXKA 1S57A 1SVDA 3BO2A 4W90B 1X8DA 5EWFA 3BGFA 2Z30B 1Y7PA 1RK8A 3MF5A 3PHTA 3WHIA 5KFTA 2MQQA 3CCWA 1RT2A 3KHGA 1ZPVA 4G1QB 2C2RA 2JSXA 4DI6A 1KVJA 3D68A 5IOLA 3AA9A 3AXMA 2HMIB 4F04B 1U1KA 2JX2A 4LRDA 3D1OA 4XTTA 2LA6A 4WE1A 5B0DA 4EZ9A 1OQ3A 2IM3A 2ZD1A 3MDFA 5EWGA 1X4EA 1FJEB 1HNIA 3GYXB 4I4BA 3MM6A 1NJZA 2VOOA 5BXIA 4ETZA 2NQPA 2V4JB 2QLWA 5HQLA 3C6UB 2FVPA 1H74A 4OZLA 3J80Y 3OD2A 2H54B 2ROPA 4GKJJ 2PE8A 3B6BA 3FCVA 2DJWA 5J2PA 3D0IE 1VQLS 1RT7A 1XMQJ 2W8LA 4P2MA 1OQ6A 4KV8B 5A76A 1L3VA 1GMVA 4OIXA 4ZVEA 1RT5A 4C98A 4LRCA 5DM7Q 1X4HA 1NZAA 1YJ9S 3GFXA 4DUZJ 4DQQA 5H9EK 2KM8C 1TP7A 1X4BA 5IT0A 2FZCB 3SEOA 2MB0B 4C9DA 3RB4A 3GYGA 1GMUA 3KFWX 1LNQA 2GO9A 4H4MA 4B3OB 2VG7B 4PCQA 4P73A 2B9EA 3KMSA 3HLUA 1S0NA 4DEZA 4CLFA 2XMUA 4KIAA 4B3RF 3IRXB 2YX4A 1YZ6A 4KFBA 4TY8A 2YKNB 1JXVA 1OSDA 1Q8IA 1VK8A 2KU7A 1OIAA 1Y00A 3DLEA 2V2KA 4LBPA 4RWXA 3BQ0A 3CDWA 2LU2A 2I6WA 1UVNA 3FRZA 2KZZA 2KJWA 4NWBA 2E1MC 4X4UA 2MEWA 3FZBA 3QMQA 2ZHAA 4U8VA 5D78A 5KFDA 4M5LA 4ECYA 3BQ2A 3PY8A 2GQCA 4KGXB 1NNDA 4ID5B 4QJVA 2V4RA 3V4IA 2G9OA 4PWDA 2GZOA 5GAGU 1HHTP 4P7TA 2VPXB 2XGPA 1RT6B 1IBKF 2VFRA 2GHVC 4NLSA 2HVZA 5HL7Q 5KT2A 4L75A 1RHQB 4QIFA 2B9WA 3IP0A 2ZFHA 1RA7A 5ETTA 4K4SA 3RRHA 4HDHA 3DLJA 3QFWA 2OLWA 2DR8A 2LECA 4IYQA 1DJ0A 2OD4A 5F8NA 1FHTA 2COLA 2RU9A 1N36J 3W3SA 2LQ5A 3JSRA 1U1PA 3IRWP 2ZH4A 1V5VA 2GVDA 2RH3A 4PG4A 4PPDA 1H38A 4WP3A 4WFYA 3OR1B 3FNNA 1EARA 1NRKA 1ZH5A 1MWZA 3POTA 4LR7A 3RGIA 5GAEU 1S97A 1KS2A 1N4LA 1WDDA 4NRTA 4DX7A 3D4JA 5EUHA 2DGUA 2MY8A 4RZRA 2F8HA 2RJZA 1WC3A 2W2NP 3BSAA 2MJUA 2YX1A 3HHEA 3F44A 3BN7A 4KKOA 4IG0B 4EBEA 1VQYA 1ZBTA 4TNOA 1R8CA 4MMOA 5GAHU 4DR5F 4M5DB 3UN3A 4WFAQ 4JI6J 2WRMA 1EIYB 1P8GA 3J80U 2QJ3A 1S1VA 3TUJC 2OUGA 2VASA 4RW4B 3NOCA 2UUCJ 2HHUA 3NLCA 2HS4A 1S6UA 1TKZA 1KQFB 4ERDA 1BQNA 2CXEA 4I6AA 2ALZA 3DFEA 1REVA 2D9OA 4ZDNA 5KFUA 2P9EA 3HXMA 3V6HA 2KT2A 1N5QA 1CS4A 3DXBA 2HBRB 4O4RA 4LFBF 4TQSA 3KJNB 1U7LA 4RU9A 2M5YA 2BZ2A 2RAQA 4F26A 4ETXA 1FKOA 1CJVB 1UAWA 4ECZA 2J0QD 3ILJA 2J9EA 1RZMA 1VYAA 2XTJP 3WC0A 1FRJA 1TK0A 2O66A 1R8AA 1RAGB 1X0FA 2BW7A 9RUBA 1HPZB 2C2EA 1T05A 3ET6A 3BEGB 5DG8A 1ELOA 2XWYA 2CQCA 2FC8A 4A8QA 3HJFA 3MCMA 1GX6A 4XIUA 3JB9k 2JLEA 4EYHB 3FMWA 1U6ZA 1LW0A 3M6VA 4RW4A 5LXYA 2WW8A 1FDBA 2PA3A 4HKQA 1TAUA 2PEHA 2V8VA 3MFIA 1NDLA 2LFVA 1HWLA 4IUFA 1NAQA 2GJIA 2W4DA 2GIFA 4USJC 4NLYA 2FYXA 4ZMMA 1PYTA 4WTOB 2DXEA 3M8PA 5KFQA 4J9LA 2IMWP 1H7WA 1KD1T 2LKZA 5I3PA 1RHMB 3ZFVA 1UWBB 3JTPA 3ETOA 2V50A 3J7ZT 3U02A 3CCMS 4F4YA 2VODA 1TTHB 4USKA 2CPFA 3PFEA 1DY3A 1LOUA 4ZLJA 4PG5A 4J9RA 1IWGA 4I2QA 3ULHA 3DMJA 2UV8G 1ULRA 3W64A 4F25A 1FFWB 4Y2MA 3AH6A 4PAAA 4R0EA 3KLFB 3I56S 1S77D 1RAHB 4LUBA 1FK9A 1Z1ZA 5K8PA 2OEJA 1F9FA 4N76A 4M95A 4Z2XA 3I5AA 2ZH9A 1RWVB 2AWZA 2MQ8A 3KJFB 2ZDOA 3GCXP 2JJ4D 4FYVB 4IG0A 1JXEA 3TYTA 4U67Q 5E3AA 2ZDPA 3IFEA 3MMBA 2XLJA 5LMNF 5L1IA 4FF4A 4V19J 3MI7X 3KNGA 1RTJA 3M2UB 3W2VB 3MMAB 2NUHA 4F4XA 1JLAA 3ZTQA 4NZ0A 1T9XA 5GMEA 2CADA 4K4TA 4NLDA 3CO9A 4C8MA 1D09B 1HI0P 4NZ6A 3CD5A 3VAGA 3F41A 1FRXA 4MIWA 1L3UA 4HH0A 4QYZJ 1BQXA 2RQMA 3ISNC 4YMEA 3TVYA 2M4MA 2R8JA 2V63A 5ETVA 5I42A 4B9NA 4JI8J 1T3OA 2AEJA 1LWEA 4QWDA 3DDNA 3DLEB 3IS9A 4CYUB 4I6WA 2B0GA 5IWAJ 1KQKA 2K1RA 1S0MA 4N41A 1AZSA 2WVEA 1C2PA 2BYCA 3THTA 1X5TA 1CJTA 2AYBA 2IY5B 2JVOA 5FLXY 3DGPB 4Y2AA 3J81j 4RL1A 3CMES 8ATCB 1FRHA 4F4AA 2DKOB 2L08A 3A12A 3HVRA 2C3YA 3G9CA 1CULA 1SC3B 3K8WA 2XMWA 1DLOB 3C15B 1IM6A 2YTCA 3ISZA 6AT1B 5HMYA 2NXJA 3OTBA 4AL6A 5F8IA 3KLGB 5IM0A 1VRQC 2GMHA 4N8NA 4MIBA 2LMIA 2Y1JA 4ED5A 2IJRA 1KOHA 2DNYA 1FRIA 2HNYB 2HBZB 2AIRB 2DB1A 2E1RA 2KHCA 2OGUA 1P9QC 2DCLA 4JI7F 2FVSA 4A8YA 4GO7X 2ZZTA 2HFUA 3H2UB 2XWXA 4QPTA 2X1AA 2EFGA 2EG1A 2RSQA 3MTKA 3G6ES 1S1TB 2CQ4A 2W4CA 5K8OA 4L74A 2BJ8A 2YNIA 1S0OA 4LF9J 2CQBA 2UXDF 2LEAA 3ZZ0A 5LSOA 4LR9A 3Q8RB 1B64A 2HK3A 3TZXA 2UXCF 1V5IB 1RAIB 3V4MA 3W2WA 4HT7A 2QMWA 4OI6A 1XMQF 1UPMB 4KPCA 1MN7A 5L39A 2W2MP 1N32F 5H9FK 3LALA 1CJTB 4JV5F 3FRYA 5E2QA 1H72C 4ED3A 1XNRJ 1K44A 2JEJA 5DQGA 1NK5A 5AT1B 2Z2MA 5G0RB 1QAYA 5JVHQ 4NZ7A 3EGNA 1EAYC 3D6MB 1S6QB 2HIYA 4ZVOB 2IVFB 2HNYA 3UD4P 4IFYA 2M8DB 3RRGA 1IWAA 2KVQE 5F0WA 4X84A 3SCLE 5KG2A 4FPIA 1NDCA 2IRXA 3T5JA 2GVZA 5J1EB 1WOOA 2F9DA 1WACA 3HM9A 4XDCA 1EQ0A 1HYSA 1MROA 4C3LA 4USUA 1JLAB 3G8TA 2FZGB 3RBEA 3DRPB 1EX8A 1WC0A 1JLEA 1S1TA 5KG3A 4EGLA 1GTHA 4USVA 1WNEA 1KVKA 2EXUA 3HKWA 5DS7A 2N3OA 2DTJA 4X65F 2E5HA 3VTIA 1X4CA 4LSZB 1RT1B 1LW2B 1SQEA 3MPVA 4J5OA 1N5VA 5I42B 2NCKL 4DDFA 1MSWD 2VFTA 5HO4A 2CVIA 5L46A 1E6VB 2D7SA 3PNIA 1YRXA 4DHVA 3I0SA 4DF8A 1RGVA 1DHMA 1SH3A 5D15A 2X1FA 3FEXB 2PO4A 5THWA 3D1HA 1N36F 3UPFA 1RTHB 3N28A 4AL5A 4OQJA 1ZM9A 4FF1A 3AA8A 5B0EA 3A13A 2D3OR 1O8BA 3OSPA 3DGPA 2YQ1A 4MIAA 4JBCA 3PYDA 3WX4A 3GV8B 3UCZP 3FSYA 4LF4F 1WELA 2DHAA 5DG7A 2RHQB 2QL9B 5IT9Y 1CC7A 1VLYA 4XO0A 2MQLA 2R2SA 1HNZF 2RRBA 5D4PA 4AD6A 3D2WA 1KLNA 2J8SA 3OQ2A 1S6PA 1GNKA 1GEHA 2KRRA 1SBRA 2W2QP 3BDPA 3TX8A 2CNLB 5AE3A 2A6OA 1VLOA 3KKFA 3OFFA 5GVQA 4B3SF 1NPPA 3IGNA 3KTQA 1XBWA 3DLKA 3PTWA 4I2QB 3K2YA 3KLEB 3TARA 1TELA 2EFQA 5EDWA 2PMHA 4WZMA 1Y3KA 1SH2A 2DR5A 1VS3A 2R7TA 5ETPA 2A0FB 1TV6B 3GJRB 3HHLD 2AZ3A 2H4WB 3O3LA 2VPZB 4Q2LA 3UVJB 1RA6A 3BREA 3GV7B 3KK1B 1CC8A 1QAXA 1NB2A 2MDAA 3EDQB 5KT6A 4J9VA 1T9WA 3ZXWA 2CKWA 4YDXA 4QIEA 3VAHA 4JI5F 5EGYA 3MMJA 2WTFA 5M2UA 2FHOB 3DDKA 5HN0A 2Z2YB 5HVFA 4GKKJ 2HWIA 2HHQA 4M5GA 1CJVA 2RUSA 1T05B 1N33F 2QE5A 2NXCA 3JSMB 1NK6A 1ZAVA 4OV1A 3W7BA 2DIVA 1YBAA 1NJXA 3BH6B 2GAHC 3C8YA 4ZA1A 2B9XA 4ZVRB 8AT1B 2N7CA 5LMUJ 2IFXA 4ED8A 2Y9HA 3O8WA 2EK1A 2QZ8A 3U27A 3VCDA 4NXNJ 2BM1A 3P49B 2CPIA 4CLTA 1WF2A 4RBTA 5GMKa 1GAOA 4G1PA 4C8YA 2DNMA 3TR5A 2MJNA 4ZP6A 3Q23A 1WWHA 2GVDB 2VA3A 4Q0BA 3OFGA 2ZKUA 1U1RA 4M5DA 3FC9A 3JS9A 1U6BA 1RTIA 2YH1A 1HNVA 2XY5A 2OEKA 4K4XA 2Q6BA 1FEEA 3KUHA 2YNHB 1CQNA 3G87A 4L6V3 4GC6A 2EK6A 4OX9J 2CPDA 3OUYA 2AU0A 1E6YA 4RKUC 3C3LA 3CB4A 2M3DA 4DL6A 1Y0HA 4QWBA 3O1LA 1N56A 5KFPA 2I5JA 1C1BA 4OZ0A 3L7PA 1C0UB 3QNWB 3QJPA 4K4VA 1HQUA 4ID5A 2J0SD 3ILLA 1NPRA 2U2FA 1UA0A 3PVXA 1Q8BA 4LVOP 3MR2A 4X2BA 3JYTB 4ID8A 1NLKL 2YNFA 4OZ1A 2YKPA 1VGYA 3C19A 4USWA 1S1VB 1WHXA 3UR0A 4L3NA 1LK5A 4KGKA 2OTLS 5AXNA 2QFJA 4A8SA 5I4MA 5DQIA 4HHJA 4KPYA 3BQ1A 3KNAA 3TEHB 2AKWB 1KRPA 2VA2A 1O5JA 3PEHA 4R8UB 4NA1A 3RAXA 1PSDA 3KDOA 1VBYA 4EBDA 2OEMA 1JLEB 1U02A 2E5IA 3NS7B 4RJVA 3PR5B 3CC7S 4UOHA 3H2VE 3D3CJ 3SQGB 3NGDA 5L1KA 2MZSA 3VAJA 2CQIA 4WU3A 1UETA 8RUCA 3C46A 3UDCA 2DH9A 3RUBL 4OYOA 3NWRA 3W62A 3ZNUA 1IVZA 4CNZA 1BLUA 1OMSA 4NCGA 1C0UA 1IUJA 1U26A 1RWKB 3ICLA 4W4MA 4EWTA 1NJYA 1SL2A 1SKWA 2R7UA 2GJ2A 1S1WB 2R2UA 3G86A 3N9UC 1WC6A 3DC2A 4A8FA 6FD1A 4HHUA 4IH6A 1N54B 4FYXB 4ZVTB 2E9ZA 2QFIA 4KBIA 2OIHA 1CSJA 3I82A 4EEYA 4ITSA 3C2PA 3QAUA 1SB6A 4FVCA 5IXUA 5KG5A 3T5LA 1HI8A 4AQYF 2N7YA 4UQGA 3K57A 1FTCA 3R3TA 3S1TA 3P5BP 2JLGA 2ERRA 4K5SA 3A3NB 3M8QA 4ZS6A 1BXNA 3P4UB 2VG5A 3R8YA 2IYIA 2Z57B 3C6TA 4JI7J 1AFJA 2CWXA 5DJBA 2M88A 1F5AA 1U1LA 1RTHA 2V67A 4M5IA 2OELA 4A47A 3UE2A 5RUBA 2CPXA 3K7RA 4FXWA 2UZAA 1W26A 2DYAA 3B78A 3BH7B 5B7WA 5KFHA 5DLGA 2QMUB 3AB2B 4OHYA 2JC0A 3SCJE 1PBAA 3IRXA 4UUWA 4DR1J 2B7CB 3EVWA 2GX8A 4B3RJ 2YY3A 4H4MB 4AFFA 2KZMA 2AYEA 2ZKTA 2QA1A 2NPFA 3VQTA 4X4QA 3NL0A 1K1SA 1KR4A 1YKWA 1LFPA 1HNIB 4USIA 2MZTA 5SUHA 2HS0A 1KEKA 3MR6A 3OTDA 3F56A 3T1HF 1PILA 3B8HA 3R2CJ 4NA2A 3PYGA 1SKRA 4WYWA 2QL7B 4QIWD 1JJHA 1UVKA 2XMMA 2LDIA 4HEA9 4CH0S 3R1LA 3DCAA 5HJXA 3C6TB 1CJUA 1YWXA 3HHNB 2UUTA 1NSPA 1RT2B 1RT7B 3BN4A 2H48B 2KT5A 4AYBD 2W9AA 2ZWPA 3OJUA 3DRSB 5FD1A 3MMCB 1YTYA 1EZZB 3P3DA 1A7GE 2K1RB 4UY85 2HHPA 1UZHA 4DUTA 4AE5A 4NI2B 1VFJA 4ZVGA 4O3RA 4ZJOA 1T95A 2HQIA 3DLKB 3EGZA 2XZTB 2ZE2B 4Y6IA 1DURA 1HWKA 2GAGC 4RNOA 3UN2A 4B9SA 4LQ9A 4HVZA 2BANA 4NEYA 4FYWB 1BQMB 4IDKB 4IO1A 2DNGA 1NPKA 3SBMA 4UF4A 4UT4A 1DFDA 2BJ3A 2OPQB 5GAEI 3SQGA 2PC6A 3L95X 2WB1D 2OSQA 4I64A 1WEXA 4PQAA 4PABA 4ZJLA 3W63A 2ATLA 5ETSA 3TVKA 3TUPA 1IKXB 2KFZA 3IM9A 3ISND 3DOMA 5A0YB 4R8UA 1RT3A 1QM9A 2HLTA 1DQAA 1V6HA 2V2QA 3E51A 3A3OB 2XY7A 1U1MA 1JJCB 2W24A 4DV3F 1Q8LA 3D28A 2GIRA 1XK8A 4PKDB 2CQ2A 2GHPA 5I3QA 5L1JA 2XZWA 4DV7J 1EB0A 3FZ2A 3SV3A 2BR0A 1JKHB 4P52A 4JI6F 3UDVA 2ZBCA 3TZYA 3PR4A 3KLFA 2XSJB 3T1YJ 1ZTTA 3OFEA 1FKPB 3JTOA 1FX4A 4WKRA 4DUYJ 2UUCF 1H6KX 3D9BA 2Y8YA 2CVEA 5KFLA 1WD6A 4C2MA 2ZJQQ 4PUOA 2MKKA 2DGQA 4L3KA 4K4YA 3CO0P 1BWEA 4CO1A 4JI1F 4BHQA 1W2BR 1WI6A 3EWGA 1H2VZ 3LAMA 1UEKA 1EETB 1N5SA 1UPPA 2KXHA 1FRKA 1V3SA 2Y1RI 3Q86A 2FHMA 3AHPA 3DRPA 3V5RA 4ZKAA 2BQRA 4J9NA 4ELTA 4EK2A 2MYFA 3DLGB 4OI2A 3MEKA 4LF5F 2N4CA 2J0WA 3H5YA 2C42A 2XGQA 1VQKS 5J1NA 3R5JB 3OTCA 2RQ4A 2G2YA 1C1BB 2VB6A 3CSKA 1S10A 2JH3A 4M1KA 4DL3A 2YKMB 1NB7A 5J2MA 5D4OA 2NXNA 3N6MA 3LP2A 1S7IA 4ZP8A 4LF7F 1H7XA 1HA1A 3M4XA 4EFAC 3MR5A 4A8KA 3LP0A 2D41A 4ZPBA 3RAMA 3ILIA 5HSPA 2J5AA 2UXBJ 3M32A 3HZEA 3R5CA 4GKKF 4DV0J 3SZ2A 2KB2A 2DISA 3ZZRA 1REVB 2D69A 1LXNA 1RHJB 2JRSA 2LU1A 2ILZA 1DRZA 4A46A 4MKYA 3L09A 2VDHA 5A8KB 1SUQB 1QD1A 4C8LA 4RNMA 3K5LA 4XK8C 3MUMP 1ICEB 3VF0B 3RBXA 2ZBRA 2BX6A 1VI7A 1FDDA 4OL8A 3Q8YA 2DHGA 4OJHA 4PRFA 3NGUA 1RB0A 3OLBA 3PV8A 2DGWA 5KFXA 4RPFA 3KLIA 4ZN3A 3NGSA 1RACB 1RT4A 2VC1A 4K2JA 2DNKA 2LQJA 2IHR1 4CI0B 2UUAF 2CIMA 5E5NA 3LAKA 4ANEA 4Q2MA 2VFUA 3AOBA 2QSFA 1RWWB 2PN6A 2ALYB 1RCOB 2Q1LA 3GE9A 4LREA 1F60B 3M9NB 4ECTA 1XMOF 3PX4A 4F50A 2R8GA 5HROA 2Z56B 1JLCB 4Y3CA 1KLMB 1J2VA 1P9YA 3M8WA 5LL6d 3M8QB 4G65A 4CLUA 1Q8KA 1TUVA 2CPYA 2DNHA 2RT3A 3IR5B 3MM7B 4DCPB 4C8KA 4I67A 3HHLB 3JAMU 2FGCA 5DM6Q 4WK1A 4U7CA 5A6PA 4DWIA 3GONA 1L3SA 2DVIA 2DRBA 4UW2A 5IWAF 3DLHA 1KBRA 2YXLA 4U8YA 3RJMB 1B99A 2ZITA 5DGAA 3GFYA 1X4FA 3GV5B 3MWBA 1KNZA 4PG7A 7FDRA 3HDSA 2BOPA 3Q8QB 2VIHA 1NBEB 2Q43A 2J76E 3CMAS 1KKHA 3VQSA 2RQCA 1UMJA 4NLGA 4ALZA 1YQHA 3M8SA 2I2YA 1MU2B 5KT3A 3MPYA 2J6SA 1DAXA 4JV2A 1N6QB 1SC4B 5CYMA 3PHEA 2XQCA 1IR2A 1LW2A 4DV2F 3B82A 1TUWA 2GCFA 1M5SA 3NY0A 3V6KA 3MMBB 2E66A 2Z2LA 4OMFG 1B0PA 1LWFB 1X5SA 1CVJA 1RHUB 4KKOB 1Y5IB 3I32A 5KFIA 3TO8A 3H25A 4ED2A 2YPZA 1YSJA 3UD3P 1YITS 2AJ1A 2CPZA 3PW7A 2OFGX 4RW7B 4ZVFA 2M8HA 1Y5LB 2FD2A 4LF9F 5F3ZA 3OXLA 4Q8FA 1FX2A 1NDPA 1KHVA 1F0XA 1HBNA 2HQFA 2UXCJ 1UJ5A 5KG4A 4EO8A 2FQQB 1YBUA 5F8LA 3H5UA 2RS2A 2PMWA 3FQKA 3OVSA 1FVSA 3HFZB 2DHXA 4NEZA 3G96A 1RT4B 2VL1A 3QYYA 1FWLA 1FNOA 1M0SA 1RWMB 2BRKA 4M8LA 4UQTA 2O3DA 3UQSA 2V4JA 3TRGA 3D54A 1YZ7A 4M5KA 4QW9A 4EZ6A 1U1NA 5DZ6A 5E33A 3PG9A 5FLXU 4F8RA 2W7AA 2RF2B 4USMA 2MPUA 3C16B 3TUIC 3G82A 1NHUA 4OLPA 1SUQA 2D3UA 2VBZA 1K1QA 1N34F 3QT5A 4CZCA 2VG6A 3ZTOA 3HT0A 5KG0A 4ECVA 1B70B 1LFWA 4XPEA 5HMWA 3V6DA 2V2VA 2QYCA 3R7NB 5J2NB 1UJ4A 3A8KA 2WVFA 1VBZA 1HIYA 2EFNA 1ZZNA 2MKIA 2F40A 3O6QA 1KFDA 5C2CA 1UW4A 3BGOP 3Q24A 3WC2A 1GMWD 3CJRA 4N47A 4B3OA 3DHWC 3MM7A 5KOXA 4IR9A 2BJDA 4JYAF 2FZKB 4DR2J 3HMJG 3LTOA 1KLMA 4Q0BB 4WKYA 1A6LA 2MQOA 2QMXA 1OJ4A 4TN2A 2ZOMA 3D67A 4RW8B 1AT1B 1L3TA 1VQ9S 3GWCA 2YWKA 2VKZG 2HHSA 2YNIB 3AD7C 1HI1A 5BJRA 1RYRA 2YH0A 3K89A 1ZOTA 1LWXA 1N52B 3VGVA 3BB5A 4KGMA 4LFAJ 5D0GA 3MUTP 2DXFA 2BV3A 4LSNB 4WCEQ 3EX7B 4FBUA 1BMQB 1XTZA 2CRLA 4M5MA 4NL5A 3T1AA 1V3RA 2HRYA 3ELHA 1GTEA 1NM2A 1B7YB 4O3PA 4DPXA 3J7YI 4RU2A 2FLNA 4LF4J 2B56A 3KLEA 4HACA 2ZH1A 1R0CB 1RP5A 3VVTA 4TVAB 4UZBA 4TLQA 2VFSA 2V0NA 4CP5A 1VQ7S 5F3TA 2DHSA 2HQCA 2YWEA 3RBDA 1FE0A 4HL9A 3TAMA 3NAHA 3PKMA 1TUGB 2B4OA 1WSRA 2R2TA 3DKDA 2MHNA 3H4DA 1NKEA 2R42A 4EUVA 2BJ9A 5ETKA 1RU1A 4ZVHA 4B9TA 4LFAF 5KFZA 1RAFB 4DMZA 1HQEB 5T7LA 3CJ5A 1RBLA 1ZTWA 3IS9B 4DR7F 1REGX 4RX6A 1Z4UA 2C1EB 2K2PA 3U7JA 4UY8T 2GHWA 5D4NA 4ZLLA 2JEFA 3DI6B 1Y10A 3DM2A 2ZNZA 3EM1A 3FKBA 3RG6A 3CC2S 1W2IA 4O3NA 2AGOA 2E29A 3CNQP 3T3FA 2ZH6A 2I8EA 3BKFA 2DNPA 1FA0A 1U0HA 2FJVA 1HD1A 3I5BA 2RE1A 1N8RT 2OO4A 3BM7A 4JI5J 3BKUA 1VQ5S 1I94F 2J9DE 4KFBB 3US5A 5H9EJ 1Q86T 4F2RA 1WTFA 2GW8A 4R0JA 5KTQA 1U1QA 2DPJA 2LYVA 2J0XA 3M1VA 3J81U 4YOEA 5F9LA 4C0OC 4LSLA 5EHHA 1KONA 2GS8A 2MSSA 3CDBA 3E01A 5KG1A 2XCAA 4DR4F 5EN1A 1FJ7A 5C25B 1SJ1A 1ZYQA 1YLXA 1O51A 3K5MA 5LSLA 5KOWA 2MY7A 1WC5A 3OR2A 1B0TA 5L9XA 3TQ1A 2W2OP 1VJWA 1AUSL 1TMJA 1ZA2B 3AB4B 2UV8A 1U0HB 4UOCA 2E7VA 2KRBA 1EP4A 1WG4A 2ZHOA 5GAGI 4O0IA 4DV0F 4X64J 3EVOA 3IBCB 1PBUA 1UW9A 3CT9A 2DRAA 3CJ2A 1Q7LB 1IJEB 4BWMA 1JLQB 3WIUA 2GJFA 3DLLQ 1M5KC 1TVRB 2L9DA 2YKOA 2WAQD 3B4DA 5F9NA 5E0OA 2HVEA 5A0YA 1VBKA 3VALA 5KFJA 4I6YA 3CC4S 4WWSA 3T6BA 3HO1A 4KSEB 2E5LF 3ZTSA 1SQGA 3MM8A 4RUBA 3UNYA 4KH1B 5K8NA 5CZVA 2HVHA 4NLPA 2XO6A 4Q5VA 1R6VA 4TYBA 2CQHA 4CLZA 1T03A 2UUBJ 4ZCLA 2EG2A 2VONA 4CDIA 3CCTA 4DS4A 2DT9A 5C42A 1Q82T 4LR8A 3BYRA 1AB8A 2ZH2A 2XSFA 3R6GB 4RW8A 5CD4A 4DUZF 2R3VA 1NJWA 4ICLA 3HF5A 4M94A 2P2CB 4WZQA 3C14A 2L9WA 1R8BA 2HHTA 4KO0B 5ITHA 4TU7A 1TK5A 1F6TA 4IOBA 2H1YA 4NX9A 1N5YA 5DDOC 5E3CA 2EC2A 3CWJA 4RBVA 4DSLA 2DXDA 4C7QA 2RKIA 4DX5A 4LF8F 1QVFR 2WB4A 2EI5A 3J7A1 3AAWB 3WDOA 2CPJA 2QEXS 1RUSA 5IC6B 4X4VA 1HARA 1BQNB 1D9AA 2QLFB 4D3GA 2MKYA 3AJDA 3DNCA 3ZZZA 1TL7B 1YDLA 2FVCA 3C16A 2LXUA 3NS5A 2A10A 1F2HA 1V9OA 3QQCD 1NK9A 4RNNA 2B43A 3PZPA 3GILA 4O23A 3QWPA 2A2DA 2B8PA 5HP1A 1VBXA 1CJKB 4NLXA 1RBOB 4HLBA 5LT5A 4YB5A 1NHKL 4Y65A 5EX3A 3TP2A 3QT7A 2MKHA 2OP5A 3UO0A 3AODA 4CYUA 4LF8J 2PIIA 4XDDA 2B4PA 2YWWA 4Y34A 5D0RA 3W61A 2ADBA 4K50A 2WHOA 4O44A 2ZZNA 2DHHA 5B0AA 2H51B 4RUAA 3TANA 5B0GA 3FFIB 2HNZA 5CHCB 4CIOA 5KT5A 1S9FA 1PYOB 2AJ4A 2IMOA 5AXMA 3CCUS 1S49A 2DH7A 5CH7B 3CE8A 4ZCIA 2XS5A 2VG5B 2XNRA 5KFKA 1N88A 2DCUB 4BBYA 3K5PA 1R6YA 1NO8A 4DF4A 2ASDA 4E0DA 1Q1KA 1RHKB 1LWFA 4YR3A 1AZSB 1FFSB 3EGWB 5HLFB 2MGZA 4JI4F 3D7SB 4CTAB 3CJSA 4OI1A 5K14B 2RIJA 4FBTA 2HNDB 2VG7A 2DBBA 2ADCA 1R89A 3N01A 1IKWB 3UWTA 3KHRA 3PO4A 1KHWA 4Z7CA 1IN0A 1RABB 4DR3F 5J2QB 2HLUA 3PW2A 1Q7YT 1FK9B 2YKQA 3QSIA 1HBMA 3RU0A 3PJWA 1HBNB 2FY1A 4U7UD 4YEAA 2VBYA 2V4QA 1RWUA 1DBDA 4JI3F 2CPHA 4YB7A 4DSFA 1H3DA 4YUDA 4ELVA 4LFCJ 1RI7A 4ZCKA 1RTJB 2IJNA 3O2IA 4LFBJ 2HZAA 2YKNA 5KFEA 4K0KJ 1OS5A 3KLHB 3MM5B 3HHLA 3HCXA 4B9MA 4WU2A 3ZTPA 1ZPWX 3M30A 3FEZA 1IKYA 1MWQA 3KK2B 4PR6A 3DYAB 4QWAA 4ZLPA 4URSA 3TEGA 3N6NA 4C4WA 3FBCA 2CQPA 3I9ZA 3CUNA 4JI3J 5KFOA 2VOPA 2BDPA 3QO9B 3NCQA 4F0MA 3IA0A 2XNQA 4J9KA 2BABA 1TAQA 1HQUB 2XLKA 1KTQA 2QLJB 2MQNA 4TQRA 3KJVB 1T7PA 3MM8B 3NS6A 4UTGA 2ZUGA 1EKSA 3TQEA 1VQMS 4NLTA 2EBGA 3LPEA 2KXNB 2E44A 3C6UA 1FKOB 1SJQA 1VRTB 3GYNA 3LGNA 3PACA 3MR7A 2VD3A 5ETOA 2N3LA 4U95A 2IAJA 1C4AA 1H98A 2KHDA 4PZVA 1JLQA 3H40A 1VQPS 4ICLB 2HQ3A 1R0BG 1KVIA 3LPYA 1O6XA 5KFSA 2PGCA 1R43A 1WF0A 3TI0A 2JEIA 1ITPA 4HTJA 2HK2A 4I56A 3PW5A 1LXJA 1APSA 5H1SV 4P75A 1RE1B 2CQDA 3MEEB 4DL5A 2QC3A 3OR2B 4YB6A 2XM3A 4CCHA 1NHVA 2ZHBA 1M5PC 2APOA 1OYEA 4URGA 4NXNF 3P8BB 1S72S 3N5FA 1ZM3A 3QATA 2V8HA 2BVZA 3G71S 1GX5A 2KJVA 1DTQB 2PEBA 3R27A 1YI2S 2HHXA 2YBVA 2I38A 4QU7A 4OX8A 3I4HX 5T41A 4JI1J 3D6FB 3HD2A 5CYJA 1VRUB 4KGZB 1SL0A 2YX7A 3QLHB 4WFXA 4WBFA 5HBMB 3HHLC 4MYTA 1YIJS 5DETA 1ZETA 1FDNA 3KG4A 1HLWA 1VK3A 1R8PA 3UFCX 4N56A 4ATNA 2WK4A 4C8NA 2PI5A 3OJSA 1F5CA 3NXZA 2WONA 1N33J 3UN5A 5KT4A 4NLWA 4EBCA 2E9TA 3LO3A 1HMVB 1S6PB 4GO5X 3D3BJ 2NZ4A 1IXKA 3DI6A 1H2TZ 1XWLA 5A2QU 3ZZUA 2E5JA 1D8ZA 2XHCA 2ZUAA 2ZVSA 2Q3PA 3DOMB 3E3XA 3HSGA 4NPOA 4KJIA 3LP0B 2AJ2A 1Y11A 4WP9A 1X0PA 3ENVA 3I6PA 4IRCA 3QRQA 4RNFA 3AD8C 1X31C 4G1IA 3NKYA 4RW9B 4ECWA 3JAMY 1HBOA 5HATA 2BXJA 3T41A 3CCLS 7AT1B 4F4WA 4MYUA 2XY6A 2K3IA 4MAKA 4DL0C 4PG6A 3M2VB 4DQIA 3BO4A 4P72A 2ZJPQ 3CJ0A 4I0WA 2HQDA 1ROFA 2AJ0A 3FFIA 4WXWA 1G1XA 4DR4J 3PJ9A 3SDEA 3IR6B 3HVWA 5D4LA 2GFFA 1SI9A 1ZA1B 2OFHX 5C25A 3TOQA 5SZTA 2H4YB 2W8KA 1WC1A 5IT4A 4IG3B 2HKEA 2P9CA 2QN6B 3VHQA 5M2RA 4DV1J 2MZRA 1IBMJ 5B09A 1CG2A 2HZVA 1NKCA 1X9SA 1DTTA 3GB0A 2AT1B 2EKNA 4R25A 5HP1B 1M5HA 4E2FB 2I0XA 2LQ8A 4AXIA 3EXYA 4Y0FA 1HMVA 3T5HA 5FIIA 1BQMA 1RKJA 3OL6A 1JX4A 2QIFA 2OSRA 1S9EA 1GQEA 2WSEC 3GMGA 1D0EA 3GG0A 4JI0J 4OJ1A 3IG1B 2ZBPA 1U8WA 3RAQA 1NDKA 3ONQA 1EJ7L 4RWWA 3BSCA 4F36A 4GMKA 4MTPA 5HI7A 2WBRA 1VRUA 4TXSA 3DRSA 3EJMA 4HDGA 4DPWA 1WEZA 4ZHRB 5DDPC 1GT8A 2BE2B 4DPOA 2NZCA 1U47A 2B8QA 2X7IA 3HPOA 3MR3A 3OTOJ 1H0HB 2FIUA 2XC9A 4O0NA 4AL7A 4OHXA 4PXCA 3KUEA 4XAKA 4NXMJ 4K8RA 4JI0F 4IDKA 3MPUB 1OSCA 4CO5A 3HVTA 5I3UB 2OI2A 1FTRA 4AQYJ 1QSLA 1RAEB 3TJAA 4DJBA 3NNHA 4UUXA 4E98A 3SFGA 1WKJA 1Z2ZA 1QLNA 3M8RA 3UW1A 2BJ1A 2DY1A 2VUGA 3RR8A 3NGRA 2RMLA 2YNGB 1U2CA 2VQFF 3B4MA 4K2XA 3CEDA 5U47A 2LCWA 3NP5A 4WIIA 3MAQA 2DEIA 5DZ7A 2QSWA 2GGPB 4CO2A 3AJ1A 3PRVA 1RAOA 2B9YA 2XMKA 1CJUB 2CJKA 3RZAA 3T9NA 4O3QA 4YQWA 4RUHA 5HK4A 5A2QY 4IQMA 3J7YU 2L41A 3BO3A 3GJQB 3PX6A 3RB6A 3IXQA 1S0VA 4RW7A 2HIQA 4DR1F 3IM8A 4P2FA 2J9DA 5BYQA 4DR6F 5AXLA 3ZNJ1 4ANDA 1BE4A 1VQOS 1RAJA 1J5OB 4QYZK 2F4FA 1YGYA 5KFRA 4K4UA 3TX0A 2ACMA 2IC3B 5K9FA 2KN4A 2GIQA 5DGBA 3J7Z5 3CCES 1KC8T 4BS2A 3NNCA 1MMDA 2W9BA 5CYMB 5CZXA 1T11A 3R5BA 4HI1A 4U7UK 4Q43A 1U0SA 2K7JA 2ASJA 3H98A 3OBIA 3ITHA 2F3JA 1JIHA 2HGMA 2VG6B 2Y1LB 3CJ3A 4G6VB 3PXGa 2DIUA 5KFWA 3KUGA 3KK3B 2R7RA 4ECQA 3R5GA 3LGMA 3DU5A 5CABA 4DR3J 1FEHA 2D9PA 2A1BA 3BSOA 1WHVA 1IKWA 3GLJA 3HKZD 5D6GA 1UVMA 2POKA 3ADAC 4NLQA 2RHSB 3MM9A 3VGUA 4FKYA 4IG3A 4L72B 1TKXB 1LWEB 2KI2A 4LFCF 3A3PB 2KYZA 2H65B 2VKRA 4P10A 4G3IA 1AW0A 1FJCA 1URNA 4MH8A 2KH9A 2KT3A 3QFHA 3R5DA 1BC6A 2R7SA 3CJ4A 2C2ZB 2G2OA 2FHJA 3OL8A 4PWDB 1ZZFA 4Q45A 3ITHB 4TY9A 4MKBA 4USHA 1TL7A 3I4PA 1OY9A 1KOOA 2WVDA 4O3SA 2C3UA 2QA2A 4EI2A 2XULA 3TA1A 4DL2A 2I5JB 2NUUG 4P6QA 1KWMA 2IIHA 1PC4A 3S6EA 2XCPA 1UWBA 3FBEA 1BWVA 1F5BA 3MEDA 5K8MA 2M52A 3CDAA 1RLDA 2HVIA 1N0UA 2EFOA 2Z8QA 4R5PA 1MG7A 1S79A 1TKZB 3MPWA 3N79A 4QR1A 3Q8PB 3S01A 5B0FA 2C2DA 1JLCA 2NSBA 3BR9A 1VR6A 5C2GA 1XN9A 3MCSA 3MEGA 1JNZB 4K5RA 3ENWA 4CM2A 4EYIB 3BR8A 5KFYA 4JUZA 5HBMA 5LJ3Y 1NUEA 3HFVA 4LT6A 4W98A 4Y2KA 2ZNYA 2RKIB 2IAJB 3GFHA 3H5SA 5BYSA 2VFVA 4YS2A 4A8XA 4ZVQB 3OLAA 2XLIA 1U25A 4PXBA 1TL5A 2CDQA 2IDEA 1RWXB 1YRTA 3GSDA 3AY0A 4J9SA 5J2NA 4KO0A 3GIMA 3A1YG 3I87A 4CO4A 2C3PA 1JLFB 2XMAA 1UP1A 1UKUA 3THVA 3MEEA 1TL1A 3MECA 1T8EA 3L3CA 4WE1B 2HVDA 3CIZA 4LVNP 2F4VF 1WG1A 2NLWA 3GP9A 5KT7A 2HMIA 3WX8A 2AF6A 1UVJA 2KXFA 4X62F 3DYAA 1U2FA 2UUWA 4N5SA 4U9RA 1P6TA 3DGVA 2ZH3A 1XMOJ 3HZGA 3KK1A 2WSFC 3QSYB 1MMNA 1PC5A 2AYGA 3T1YF 1JLBB 2NXEA 1F3VA 3MM5A 5DDRC 2BRLA 3LA0A 3CJQA 1JXLA 4CRJA 5IQQA 1J5EF 2YWGA 3KJVA 2ATCB 1IKVB 2D3O1 1KDNA 2LEPA 5D0EA 2C3OA 4CLYA 3FMBA 2PI4A 3PO5A 5IZHA 2B51A 2UVUA 2CZVC 4OYWA 5JUMA 3VAFA 4FS1A 1M1GA 2CJXB 2ZZMA 2XO7A 2C2OB 1E6VA 2E1PA 1M5OC 1CQMA 2DPIA 2MXYA 5D3GB 4C11A 2UUAJ 6FDRA 1VC5A 1SIWB 3JQJA 1F9HA 1U8SA 2ZM6F 1X60A 3EPIA 3KG1A 4WTYA 4WP8A 1URRA 3LW5C 3OHAA 5E3RA 1EETA 2AEMA 3NGKA 1NZ8A 5G4DA 2XZDB 3MHYA 2CYYA 3TJ8A 3NCRA 7FD1A 5E41A 4OJ3A 2HSEB 2R8IA 2V2ZA 4DFJA 1J5EJ 2EC0A 1RAAB 1N5TA 2QL5B 2ZBIA 2G1HA 1VIXA 3D1QA 3LP2B 4ZPDA 1U49A 4QQBA 4GKJF 4USTA 5D0HA 2Y0BB 1MU2A 4X4PA 5HVGA 2RU3A 2QLXA 4CT9A 2HHWA 3VGTA 1R27B 3K8VA 1JJ2R 4LQ3A 1RDRA 3PCOB 4DQPA 2UUBF 3OHBA 2HAIA 1S1UB 2AEFA 2UXBF 1RWPB 5MLCV 1TKDA 2AX0A 2V9WA 2MQPA 4HYKA 3IMQJ 3OPKA 3N0VA 1OPIA 1RT3B 1HBUA 2OPSB 4OX9F 1HR0F 4F3QA 3OXGA 4CTAA 1HNWJ 4JB8B 5IFMA 2CNKB 3MM6B 3NRBA 1RTDB 2O67A 1VHFA 3CGIA 4I1TA 5CXTA 1CJKA 1IJFB 3QJLA 2MHEA 5FJ4A 4I69A 3S8SA 1WORA 3L4BC 3BGRA 3HD1A 4OV6A 2GVZB 1R3NA 4YR2A 3HHDA 4CO0A 4B9VA 4HH1A 1YG0A 3GJTB 4WFBQ 1RT5B 5L1LA 5BR8F 4DCJB 3TA0A 3CJKA 3GIIA 3BSNA 1H73A 2WBMA 3GR0A 1NSAA 3L7OA 1UEVA 1PO6A 2DY9A 5A8WA 3H2LA 3EE3A 1DZ5A 1TK8A 3PW0A 1IBLF 3IC1A 2UVVA 3SI8A 2UU9J 4IRKA 4K7QA 3NBPA 5F41A 2VC0A 4DN0A 4GVLA 2VBXA 2R7OA 4YN3B 3V6DB 1HKAA 1U48A 3CTRA 2VQEF 3CCVS 5L9NA 2BEFA 2CQ1A 2YPYA 3FEYB 1WKKA 1YK9A 3W1YC 4V19X 1S1XB 3H0PA 1SXLA 4EO6A 4JYAJ 2Y3YA 2WVCA 3DU6A 4I68A 2ACYA 1S6QA 2IA6A 3VV2B 2DRDA 3UCUP 2K7KA 2VF3A 2V8GA 2R7QA 4NI2A 1GXUA 5G0RA 1IBLJ 3IWNC 4JI4J 1I1GA 3I0RA 3NGTA 1W25A 4RUCA 3M6WA 4JP8A 5GADU 2R2RA 2UVRA 3QT8A 4F67A 2YVSA 4IQXA 2J9CA 3MD3A 2VQEJ 3M6UA 2FUG9 2X51A 2IM1A 3FBFA 3QIPA 3IAM9 2K3KA 3QGHA 3W2WB 1CULB 3KLVA 2WSCC 1S9EB 1TKTB 4PXDA 1UVLA 1PG5B 3G6VA 3CF5Q 2BM0A 1NH7A 2F8MA 4RR5A 1S6OA 1VISA 5F8HA 2VU5A 4JI8F 1AFIA 4ER8A 3D0GE 1Q95G 2IA0A 2FHKA 2FHJD 2I9SA 4NYOA 4Y00A 1RU2A 1G2EA 5KG6A 3OXFA 1RTDA 3TZZA 4K0KF 4KAIA 3GPAA 3EICA 4FXVA 4DN9A 4UOFA 2V6AA 3MXHP 2HPUA 2ASYA 2AGPA 2LQBA 2Q66A 4ILMA 3Q8VA 5ETRA 5IM0B 2J7UA 3FCWA 4LF1A 5JJBA 1IQZA 2XSJA 4OZ2A 3DOLB 3VAKA 4PYDA 4FKXA 4J37A 3SYZA 4TKTA 2RB7A 3W60A 4ZLNA 2JFKA 1YJ7A 4QWCA 4O4GA 1B0VA 5AJ3J 2VDIA 4YY3F 1HBOB 1LKZA 2CNOB 2A18A 3CW2C 4HI2A 3QT6A 1B3TA 1FDAA 2AJFE 3EMTA 3G6YA 4KYZA 3M2UA 2X3GA 2JFDA 1JLBA 1X4GA 3FCHA 3W2VA 2QA4S 1L5UA 1PYSB 1QDUB 2D3ZA 4FN5A 2HFSA 4A8OA 5E3QA 1HFEL 4JV1A 3MCNA 4YHHF 1R0AA 4IH5A 3P96A 2WOMB 4KHPJ 3S7RA 2IBOA 4QIGA 1NK7A 3AJ2A 1NSQA 2FLPA 5D3GA 4DV6F 5IV3A 5LXRA 5KFFA 2UU9F 3G2XA 1RADB 5B0CA 2HWTA 3HFKA 4NYPA 2RUGA 3EZOA 2BOAA 1ACMB 1DQ8A 3KOAA 1E6YB 3W65A 2A3JA 2FY8A 2GNKA 4ZPCA 1XNQF 4OYZA 3KLIB 3Q22A 1T3NA 4IKAA 5GADI 1H2UX 1DTQA 3HT3A 2BQUA 5IT9U 1GFWB 1V3ZA 2PFFB 2HQGA 2XS2A 1LW0B 2FJBB 2MKJA 1K9MT 1B7FA 5GMDA 3CD0A 4BC7A 4F0KA 3V6JA 4DV6J 3F73A 1HNXJ 1G6BA 4CLWA 2FLLA 1J27A 3GCWP 2LP4A 3CDEA 5KFVA 4YP3A 2OAUA 2V5HG 4D3HA 3KK2A 1FKAF 4DV5J 4ED1A 2FVRA 3GSIA 4O3OA 4FYDA 1CLFA 3MTJA 2YWFA 1RWNB 4KHMA 4A48A 4QR2A 1LK7A 2DD8S 3BBFA 1XNQJ 1XR7A 3IAS9 1NKBA 4C0BA 2OJ3A 3GZ7A 2HAFA 1GH8A 4FZVA 2J7KA 3RW6A 3OUYB 2DNNA 4DX6A 3W5ZA 3FSXA 1SV5A 3DRRA 5IQ6A 1HHQA 5E3PA 1BGXT 1N0VC 1SJRA 1VC0A 4CNYA 1HNXF 2DR9A 1Q5YA 2MLXA 4B3TF 1K0VA 4NOHA 3CJTA 4E8UA 1N48A 5J2QA 1KTVA 5A8KA 4DV5F 3AOCA 3KMQA 2E7XA 2JL9A 1RLCL 4KE5A 2E5LJ 4P2XA 4LRAA 3BJYA 4ZIVA 3LWMA 4DV2J 1KFSA 1Q5VA 3IWXA 3OVBA 4ZOSA 2GC8A 2AD9A 5HLFA 2HBQB 5ETNA 3ZTRA 5FDLB 1QAJA 1QSSA 4K4ZA 4L73A 1BHNA 3VZHA 4YR0A 5F0UA 3NWGA 5LM7E 3Q2SC 3MFHA 2KFNA 4NLOA 3AT1B 2RDIA 2KM8B 2DGXA 4OZNA 1P27B 3RRKA 3JSYA 1RSCA 3DOLA 1TMMA 1W7WA 3PKYA 5MAOA 3A8IA 4DQRA 1R7IA 1YJVA 1NK4A 3QJJA 3I55S 4RW6B 2CQ3A 5HQMA 5HMZA 1IR1A 2W2PP 4LBHA 1YRUA 1D8YA 2RVJA 3RBZA 1IBCB 1C1CA 2QT7A 3R5AA 3L7UA 2IYGA 1WHYA 2M9KA 2RILA 2YQ0A 1BUXA 2XHWA 1O0PA 5ETLA 2QA4G 3V2UC 3H59A 1QTNB 4FS2A 2OD6A 3JQMA 5HVHA 4FF3A 3Q2TC 1NJIT 4DSJA 4FF2A 1KP6A 3OTOF 1GMWA 2AGQA 3BGLA 4QR0A 3KK3A 3W66A 1OWXA 3QIPB 4J9OA 1GXLA 1VQ4S 1ZS6A 2GGPA 4IOAQ 5D8HB 2BUNA 3G4SS 4DL4A 2DO0A 2EPIA 1NH8A 4OZ5A 3E8OA 2J6TA 3GQCA 5DG9A 4V1Ak 3SQOP 5LMNJ 4IH7A 4M63A 4X4RA 4TY8B 2IPOB 1Y3JA 4ZP9A 4J9PA 4K59A 3K0JA 2R7WA 4FXDA 4QW8A 1GXTA 2ZD1B 1N6QA 5M2PA 1HYSB 1FNMA 4KGVB 2Y0SD 1IBKJ 4MFBA 4L76A 1RISA 2BBEA 5KFMA 1UWAA 3DN9A 4IRDA 2EFVA 2M0GB 1OY8A 4Z37A 5KG7A 2F1FA 4QOTA 4FNIA 4DXLA 1NEEA 1SV5B 3DRRB 3HP6A 3KXDA 5AE2A 4M5NA 3N4WA 1ZAXA 2KO1A 3I0RB 5IV4A 2LLZA 3LUYA 4F3OA 3CVKA 3ENQA 3T6JA 3VGSA 4NMLA 4DU7A 2CDRB 3CCRS 1HW8A 4KY3A 1F3FA 2SXLA 1T9VA 1FO1A 3M8ZA 1TFYA 2NR0A 1HWJA 1MLAA 3MMCA 2F5GA 3M7VA 2XI3A 2HBYB 1T94A 3PDNA 3LP1B 4JOUA 3A4TA 4DBQA 4ZJQA 2FJXA 3QAEA 3VR1A 1MWYA 4NCAA 2EKYA 5HROB 3VZIA 3H4BA 2DR7A 2G0JA 2DEJA 2H5IB 4GVBB 2GA7A 3Q8UA 3PW4A 2D1CA 4M5HA 1JB0C 2MQMA 4MFBB 1EHWA 2HHHF 1FRMA 4LSLB 1YJTA 4OLOA 4OJGA 3JXOA 5F8GA 4ES1A 2GMJA 1NMEB 2Q6CA 1P1TA 1X4AA 1Q53A 2CG4A 3CCZA 1HL6A 4KHRA 2V34A 3G8QA 4OYBA 1XJWB 3TVZA 3MUVP 2VJUA 1RHRB 2HHVA 1SPBP 2E5GA 1CBKA 1F1BB 1I51B 3SMZA 5J2MB 4DLEA 3TNVA 1M1KT 3C14B 4ZCMA 4RLEA 3GTYX 2ABYA 1U2RA 1NU4A 3V81B 3NCPA 1DQ9A 4AXJA 3OL7A 3GIKA 5LOQA 3IN5A 3IO1A 1N34J 4B3MF 3A8EA 1UTAA 3CCQS 2JHEA 2HHHJ 5LSRA 4EU0A 4BLGA 2DO4A 1T9YA 2CFXA 3HULA 1Y4ZB 5EX0A 2F9JA 2PD1A 3CCJS 1K8AT 5B0BA 1XNRF 4B02A 2GMLA 2JLFA 2RS8A 2XBPA 2W9CB 2BMBA 4IR1A 2CQ0A 3QIDA 1DTTB 3TW0A 4ZHRA 3MURP 4PQUB 4PWWA 1C1CB 1JJ4A 1OY6A 2F7VA 3ZZPA 3QBCA 5A8WB 1WDTA 1WF1A 2DNZA 3AQOA 1F9EB 3BGUA 4F7VA 5LJ5Y 3EYZA 1VC6A 2GO8A 2GQ2A 2ZBQA 4H54A 1S1UA 2PSZA 3ZZTA 5K20B 1FWPA 3TWZA 1FKPA 3I5CA 2V69A 3QZ8A 2CQGA 3JYTA 3DMJB 4DR5J 4GC7A 5C5JA 3PEJA 1WEYA 3NAIA 1PCAA 1IQTA 1C0TA 2LVWA 2CPEA 4N8OA 3MPDA 2YKAA 4KHPF 1MMLA 4NYZA 2NYIA 4CLSA 2H9ZA 1QJHA 3QWUA 2FVQA 3W5XA 1UFKA 2ZC4A 4DPUA 3EXCX 3A8JA 1FE4A 1WJ9A 4H4OB 1TL3B 4X4TA 2VICA 2B6AB 2ROEA 1SC1B 3D6HB 2WCXA 3MAAB 1B4SA 2EW9A 3SDEB 5HQ8A 2CJYB 2ROGA 3ZC4A 4FNHA 2M70A 1VQSA 2PDAA 2Z58B 1VDHA 3I9V9 3EPGA 4MKAA 4DSEA 1FJGF 3IBWA 3GIRA 4ZPVR 4HHHA 3K5NA 1D9DA 2IJFA 1IR0A 2QO3A 3O44A 4KQZA 4F02A 3TAPA 3ZZOA 4XPCA 1T9UA 5A6WA 1PIEA 2MZJA 4ZITA 1QUPA 1QE1A 1YJNS 4I7FA 1R8HA 1LEOA 2B5JA 3H90A 1CPZA 4DPTA 1FF2A 1U4BA 2AX1A 1S4EA 3QGIA 2KTQA 2H3EB 3MOZA 2NSCA 3RYLA 1FD8A 3W5YA 3LGHA 4Q44A 4WK3A 3E2EA 3KHHA 4X4NA 2FJDB 3QRPA 3AFGA 3WIVA 3WQPA 5JXSA 5J1PA 1FJGJ 2VHGA 3CD6S 2WONB 4QIVA 4Y28C 3VAMA 4DFPA 1IKYB 1U24A 1T9TA 2DGVA 4R5PB 4F4ZA 2IRUA 4N77A 3H42A 3M30B
chains in the Genus database with same CATH topology
4LIRA 2L48A 3CPWR 4B9UA 2LDYA 2Q79A 1SC6A 1YJRA 3CIMA 4ED6A 3GIJA 2RD5C 1JLGB 4C8ZA 3BF4A 4LSNA 2H5EA 2V94A 1XC9A 1X7VA 1XMBA 2DNRA 4YDDB 2FB0A 5KAKA 2KG0A 2NXUA 4W92B 1SKSA 5KFCA 3PFOA 2HFNA 1WI8A 2HS3A 2YWHA 4TLRA 1DARA 2M7SA 2WOMA 3LP1A 4QWEA 4ZPTR 4HT5A 3K58A 2KDOA 1SL1A 1RYSA 2HGNA 2VZ9A 4MK7A 3OV7A 3MAHA 5K14A 4OI0A 1X5OA 3MEDB 1QAIA 3NMAA 3DOKA 1KSPA 3TAQA 4IO9Q 2HW3A 2ZH8A 3WZ0A 2RRNA 5CYQA 3LWLA 1PGZA 2HYIB 2XB2D 4DQSA 1OPZA 3EZ5A 3QGGA 4NCGB 1FXLA 4KTQA 2BQ3A 5A8RB 3MOJB 2Z4PA 3LH2S 3FJ2A 5C24A 4YB1P 1FXRA 2W9BB 3RB3A 3HHKA 2HFOA 3KHLA 3IR7B 3WBZA 4A8MP 2XI2A 3VAIA 2W7PA 3FDSA 2Z0GA 1FERA 2B3TB 4LJMA 2G1DA 1UFLA 2AW0A 1C0TB 5JVGQ 1M5VC 2E1AA 3N5BA 4ECSA 1M90T 4ZPAA 5CCMA 2HNZB 2PT0A 4JV0A 3UI3A 3X1LB 3LANA 1SJ4P 2F8EX 4TU8A 2KYXA 5J2PB 4DLGA 3RB0A 4BCAA 2ASLA 3SSQA 3U1LA 4Y2CA 5FDLA 3M8PB 5CA5A 4DL7A 3KWMA 2AP6A 2MGZB 4PQUA 4KRWA 2JVRA 4C0HA 3OSNA 1CPZA 1YHQS 1HHSA 1KQGB 2N4DA 5KFBA 5C24B 2KFYA 5ADZA 5L38A 2XMVA 1R31A 5C42B 3NG8A 1TKTA 4ZPWR 2GQQA 4OZJA 5KFAA 2RRAA 3PRDA 2BANB 1UA1A 3DXSX 4C8OA 1LWCA 2IRYA 2JOQA 3PM9A 2CJ9A 3PRBA 2FLOA 4H4KA 1A9NB 4C3MA 1N5YB 1YJUA 1ZM4A 3V4IB 2MSTA 1SJFA 1VMBA 1JLGA 2FPHX 2G13A 1U09A 2IC3A 2JDJA 1MW7A 2I1RA 1VQ6S 2L9NA 4ZK7M 1RTIB 4DS5A 2IVYA 4BDPA 1S48A 2VPWB 2P5VA 3IWLA 2OPRB 1BD6A 1MNEA 3PIPQ 1S9GB 2AYMA 1SIZA 2KVIA 4DUYF 3SCIE 3FSIA 3NBPB 2VV5A 4KV8A 2BE2A 4KB7A 4DOZA 1U6FA 2C28A 3N6LA 4WFNQ 3SV4A 4ED7A 3H8YA 5F8MA 3JSMA 2IM2A 4MK9A 2VPYB 1C4CA 4CQ1A 3M6XA 4PUOB 1HBUB 2OPSA 4Q7AA 2PMZD 1TVRA 2MKSA 1QE1B 1Q78A 5CD4H 2X1GA 5GAHI 1QVGR 3OW2R 2OMOA 5HMXA 3HVTB 2P9GA 5I3UA 3CD7A 5CCLA 1FD2A 1EP4B 1TZ0A 5DLFA 1WHWA 4DG1B 3G6XA 1XR6A 2OMLA 3BGRB 1R0AB 3E01B 4FXDA 1D1UA 1T03B 2ZOFA 3SXLA 3TUZC 3T19A 3DLGA 4J9QA 1TFWA 2OTJS 3M32B 2ZJRQ 1QTMA 4F2SA 4WF9Q 3P6YC 1IKXA 5IS2A 3CCSS 4ECXA 1HQEA 2EWHA 3DRYA 4NRUA 4ZP7A 2LXIA 5T7LB 4ED0A 1RJJA 4QPXA 3OFHA 2YKMA 3LOUA 2J7WA 2E9RX 3KG0A 3TAMB 2RQKA 3MD1A 4URQU 1U45A 2Y1IA 2FJEB 2EFPA 4AUKA 2KKHA 3QPIA 4Y2IA 2XEXA 2O5DA 2HG4A 4CH7A 4H4OA 4MJKA 1HWIA 3D0HE 1NK0A 3O5TB 4F3MA 5BYRA 2V8DA 1L3KA 3LF0A 1LQ9A 2LEBA 2C3MA 3BZQA 4U6PA 3M9MB 3OL9A 2N82B 1S76D 3C66A 3T5KA 1MROB 3PX0A 5D77A 1ZAWA 1HNWF 1UFWA 2YNFB 4C3KA 1XEZA 2G0CA 4FP9A 1JKHA 4OFZA 4DX8H 1F2GA 1TL1B 2BW2A 3MECB 4OI3A 1YJWS 3DM2B 2IBKA 2W4PA 2YQ3A 4FVMA 4ES2A 1QUVA 2YNGA 4QZVB 3I31A 5H9FJ 4RW9A 2CJBA 2ZOGA 3PJXA 2JZ5A 1TR0A 5DO2A 2W9CA 5EWEA 3JSBA 2C22A 1VC0A 1S4FA 3J81Y 3M9OB 2XS7A 1Q81T 2DGOA 1S99A 1S9GA 2XMJA 1NK8A 3EUNA 3EZUA 3T9ZA 4BC9A 1K73T 3CULA 4PWUA 4DG1A 1D3WA 2IM0A 4G1QA 2U1AA 2OPRA 4PG8A 2E1CA 5E7OB 2CJQA 5KFGA 2A2CA 2NPIA 2ZE2A 5K5MA 1KN6A 2HWHA 2P6SA 1OO0B 2MZ1A 4PPZA 1IM4A 2B4UA 2FTRA 4DV1F 1IBMF 4WYLA 3D5MA 4O3RA 3QLHA 1S72S 1Q4RA 1LWCB 3AQPA 4WJBA 3DLBA 3HX9A 4OHWA 3IG1A 4WXOA 2B4VA 1S1XA 2FJAB 4WFZA 3TA2A 1I6JA 4F4KA 4ES3A 3MEGB 4LMZA 3POTB 3OTEA 4OX6A 3I96A 3M2RB 5T14A 1XR5A 1FNXH 1TL4A 3GG1A 4P2SA 4C97A 4I2PB 2FJWA 2VH7A 2R4FA 4RNHA 4YFUA 3R1HA 4ELUA 3RR7A 3KLHA 4IFVB 1P1LA 1Q79A 2MZQA 2DNQA 2MMYA 3MM9B 1Q16B 3Q0AA 1VQNS 1FCAA 3KLGA 4ILLA 1S1WA 2KG1A 2DGSA 5A8RA 2M2BA 4CO3A 2LQ9A 4NXMF 2AJQA 2R7VA 1HBMB 3CXCR 5DQHA 3NMRA 4KR0B 1K0TA 3H5XA 1HD0A 2RF2A 3HVAA 2HNDA 3MMAA 4TU9A 3OVAA 2V9KA 2FC9A 3SSSA 4NLRA 4B17A 2YNHA 4IFVA 4NA3A 3P5TL 3U1NA 1J5OA 4X4OA 1X5PA 1RT6A 2J6UA 5AJ3F 5KFNA 1UJ6A 4C11B 3Q8SB 4DR2F 4O4GB 4RW6A 1HWUA 4IOCQ 3ZZYA 2QRRA 3FGVA 4NLUA 2AV5A 1WG5A 1D9FA 5CYQB 4P7VA 1JMTA 4O44B 1IKVA 2BACA 2RNEA 4KC5A 2IVMA 1QY7A 2UP1A 4BWJA 2EBEA 2CZ4A 4X66F 4CT8A 2RDJA 3DOKB 1QSYA 2G4BA 1RKIA 2R8HA 4LF6F 4J9MA 3UNGC 4DV4F 4QYRA 2L3MA 2O01C 4RBUA 4Q8EA 3DRXA 1TQLA 1VQ8S 3BDEA 4DFKA 2DGTA 1XERA 3FQLA 1JLFA 2QV6A 3GFZA 1S7HA 3QZ7A 1FT8A 1Z2LA 1VOMA 4HTIA 4OI4A 3SSRA 4DFMA 3FVYA 5F8JA 1VRTA 2VBWA 3IGVA 3CDUA 3H20A 3HI9A 2ILYA 4A8WA 1AUDA 1SH0A 3K59A 2P6TA 3K5OA 2DH8A 1WTBA 3UDLA 1SJ3P 1HNVB 2W25A 5L8RC 2OH2A 2R7XA 3QO9A 2NS1B 4TYAA 4NCBA 3RW7A 4FPRA 3M2RA 4PXEA 3THPA 3U1MA 2JC1A 1HPZA 1G7CB 4DV7F 1LV5A 1T02A 1X9MA 2J8AA 1FXDA 1HW9A 4OX7A 2B5JB 2HRUA 3G8SA 2ZH5A 4ECUA 1AXQA 4OHVA 4I7FB 2O1PA 3CJKB 1AROP 2HGLA 2D74B 3DHXA 3JTNA 5B08A 3OR1A 1ZM2A 2OPPB 2R2UA 4JI2F 4Y0FA 1YI2S 1DLOA 2EVZA 1FESA 2B6AA 5AE1A 1UEUA 2PA8D 1RT1A 1Y9OA 4X64F 1YVFA 2JWNA 4LIWA 4H4KC 3M1VB 4OHZA 1TV6A 2GV1A 5LMUF 4QU6A 1TKXA 4CH1A 1FVQA 2FDNA 3SFUA 4QCLA 1JNRB 4A4JA 3HK2A 1X4DA 4KT0C 1Y5NB 2ZH7A 1BY9A 2AQ4A 3VWSA 2LA4A 3M2VA 2E7WA 2OPPA 1G3OA 4ILRA 1JWWA 3I0SB 2LXFA 3M05A 3NNAA 1FRLA 3GR1A 2CJAA 2DNLA 2HFZA 1TL3A 4ECRA 2DITA 4K4WA 3X3UA 2R8KA 3QGPA 1X9WA 5CQGA 2ZC3A 5DRKA 3SCKE 2B7BB 1VIOA 2HZCA 1UL3A 4DSIA 1CEZA 4I2PA 4MK8A 2UVWA 2DNOA