2NZ6A

Crystal structure of the ptprj inactivating mutant c1239s
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
315
structure length
296
Chain Sequence
HHHHHHSSGVDLGTENLYFQSMKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMESPILVHSSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDLIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Large-scale structural analysis of the classical human protein tyrosine phosphatome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase eta
total genus 98
structure length 296
sequence length 315
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2nz6A00
3QKQA 4RHGA 4KYRA 1Q6PA 2FH7A 1C85A 3I36A 1NWLA 5KA4A 2I3UA 3O4UA 1YTWA 1MKPA 3D1QA 4NX8A 5GTJA 3ZM2A 2CMCA 1Q6SA 2HNQA 3ZV2A 2SHPA 4WOHA 2AHSA 4WU3A 1OHEA 1BZJA 2I4HA 3QCIA 3V0FA 3BM8A 3CM3A 4OHIA 4GFVA 2HVLA 5K24A 2CM8A 3B7OA 3F9BA 3D44A 3EB1A 2HXPA 1WCHA 5KADA 2CNIA 1PXHA 2OUDA 3BLUA 1NNYA 5BX1A 2FJNA 4WTYA 3BLTA 1P15A 1JLNA 3QCBA 5I6VA 1T4JA 1ZC0A 2I6OA 2I75A 2QBQA 2CMBA 1SUGA 2CNEA 5IBMA 1U24A 4RI5A 2WGPA 4QAPA 1XXPA 1YPTA 1GWZA 3N0AA 2VEXA 4JNBA 1G4WR 4YAAA 3PS5A 4OHDA 2Y96A 3A5JA 3ZMQA 4NWFA 3S3FA 2IMGA 4GE2A 4R0SA 4QUNA 5KA8A 1Q6TA 1NO6A 3GXGA 5KA0A 4RDDA 1XRIA 4NYHA 2VEUA 2OOQA 3D1OA 3F9AA 4DGPA 2ZMMA 2NT2A 4PVGA 3QCFA 2H04A 1YGUA 4RH5A 4D3RA 5BZZA 3V0HA 4Z6BA 3LJ8A 4AZ1A 3BRHA 2B4OA 3QCDA 1LYVA 4ZN5A 3QCCA 4D3PA 1RPMA 3AWFA 3U96A 2BIJA 5KA7A 2B07A 2F71A 3F81A 4GWFA 3QCGA 3O4TA 2F6TA 1G7GA 1I9SA 1EENA 1OHDA 3O5XA 2J17A 2H4KA 1YWFA 2I1YA 2I3RA 1ONZA 1YGRA 2QCTA 4J51A 5KABA 1QXKA 2BZLA 1BZCA 2B4UA 5HDEA 5K23A 3ZM3A 2AZRA 4HJQA 1I57A 4GS0A 5AWXA 2B4SA 1X24A 2F6VA 3SMEA 2ZN7A 1BZHA 2C46A 2B4PA 3AWEA 4GE6A 2Q05A 3QCHA 2RF6A 5J8RA 4NNDA 4JMKA 3S4OA 2QEPA 2VEVA 2I6JA 4RKKA 4KI9A 3QCJA 1J4XA 4B04A 3SR9A 4R30A 3O4SA 1OEVA 2NTAA 3D9CA 2PBNA 1PA1A 1Q6MA 4YR8B 1WRMA 2I4GA 4IKCA 2F70A 3MOWA 2A3KA 4GE5A 1PTYA 1OEMX 3RGOA 3S3KA 1EEOA 2M3VA 2E0TA 5MMZB 3QCNA 3EAXA 2QCJA 1PTUA 1G1FA 4ERCA 2CNHA 1OESA 2G6ZA 2Q47A 4HRFA 3OMHA 1A5YA 2HB1A 2B3OA 1ONYA 1QZ0A 3D1HA 1YTSA 3AWGA 3MOZA 1YN9A 1OHCA 5EHPA 1T49A 4R0TA 5BZXA 3EMUA 1PA9A 3F99A 1ZCLA 1C87A 4QUMA 3V0GA 2F6YA 4H1OA 3NMEA 4OHHA 1AAXA 4RH9A 2CFVA 1LARA 1T48A 4PYHA 1M3GA 2PSZA 5M43A 1NZ7A 3EZZA 4OHLA 3RZ2A 1OETA 2H4VA 2NLKA 4TVVA 2I5XA 3S4EA 5K22A 1PTVA 3QKPA 3ZM1A 1V3AA 4OHEA 2I42A 1L8GA 2QBSA 2PQ5A 1RXDA 1ZZWA 2PI7A 2H03A 1OEUA 2H02A 2CJZA 2F6WA 2I6MA 4Y2EA 3CWEA 1OEOX 2HC1A 1C83A 4DGXA 2CM3A 2G59A 2QDMA 1KAVA 3EU0A 4QBEA 1G4US 2F46A 2PA5A 5K9WA 1WAXA 1JF7A 3V0DA 2R0BA 2HNPA 1FPRA 2I6IA 3GXHA 5K25A 3ZMPA 2NT7A 4QBWA 4GRZA 2CNFA 1C84A 4JBCA 4GRYA 2QDPA 2A8BA 2YDUA 2H4GA 3I7ZA 2B49A 2F6ZA 3M4UA 5LXQB 2BGEA 2I4EA 1Q6NA 4HJPA 3OLRA 1R6HA 2JJDA 4D3QA 3V0IA 2Y2FA 2VEWA 2OC3A 1YTNA 1YFOA 1C88A 2HY3A 2PT0A 3QCMA 1C86A 3MMJA 1PTTA 4I8NA 1FQ1A 1FPZA 2NZ6A 2ESBA 4GFUA 1U25A 5KA2A 4MBBA 2F6FA 3RGQA 4NWGA 1PH0A 5EHRA 1XBOA 2HC2A 2CMAA 4S0GA 4WU2A 2J16A 3D42A 3V0JA 2HCMA 2P6XA 5KA9A 3S3EA 3RO1A 3V0EA 3QCEA 2NV5A 4QAHA 1U26A 2GP0A 5IBSA 2FJMA 4BPCA 2QDCA 3A5KA 5KA1A 1PYNA 1Q6JA 3S3HA 5BUGA 3QCLA 5K9VA 1KAKA 2MBCA 4KYQA 2QBPA 4JMJA 1LQFA 4BJOA 1YZ4A 3ZM0A 2GJTA 4ICZA 1XM2A 2CM7A 1ZCKA 1XXVA 3H2XA 2DXPA 2P4DA 1Q1MA 1D5RA 2VEYA 3F41A 4H34A 4ZRTA 2BGDA 4Y14A 2CNGA 4ZI4A 2CM2A 2QBRA 5KAAA 2J16B 3QCKA 2I6PA 1L8KA 4RI4A 5KA3A 1NL9A 2BV5A 3I80A 5KACA 1G1HA 1G1GA 2GWOA 2C7SA 1GFYA 2OZ5A 1ECVA 1I9TA 1G7FA 1NWEA 1VHRA 3O3LA
chains in the Genus database with same CATH superfamily
3QKQA 2GC5A 4RHGA 4KYRA 1Q6PA 2FH7A 1C85A 3I36A 1NWLA 5KA4A 2I3UA 1FGSA 3O4UA 1YTWA 4C13A 1MKPA 3D1QA 4NX8A 5GTJA 3ZM2A 2CMCA 1Q6SA 2HNQA 3ZV2A 2SHPA 4WOHA 2AHSA 4WU3A 1OHEA 1BZJA 2I4HA 3QCIA 3V0FA 4CVLA 3BM8A 3CM3A 4OHIA 1J6UA 4GFVA 2HVLA 5K24A 2CM8A 3B7OA 3F9BA 2VTEA 3D44A 3EB1A 2HXPA 2VTDA 1WCHA 5KADA 2CNIA 1PXHA 2OUDA 3BLUA 1NNYA 5BX1A 2FJNA 4WTYA 4HV4A 3BLTA 1P15A 1JLNA 3QCBA 5I6VA 1T4JA 1ZC0A 2I6OA 2I75A 2QBQA 3ZM6A 2CMBA 1SUGA 2CNEA 5IBMA 2JFGA 1U24A 3MVNA 4RI5A 2WGPA 4QAPA 1XXPA 1YPTA 1GWZA 3N0AA 2VEXA 4JNBA 1G4WR 4YAAA 3PS5A 4ZIYA 4OHDA 2Y96A 3A5JA 3ZMQA 4NWFA 4C12A 3S3FA 2IMGA 4GE2A 4R0SA 4QUNA 1W7KA 5KA8A 1Q6TA 1NO6A 3GXGA 5KA0A 4RDDA 1XRIA 4NYHA 2Y1OA 2VEUA 2OOQA 2AM1A 5A5FA 3D1OA 3F9AA 2X5OA 4DGPA 2ZMMA 2NT2A 4PVGA 3QCFA 2H04A 1YGUA 4RH5A 2GCAA 4D3RA 5BZZA 3V0HA 4Z6BA 3LJ8A 4AZ1A 3BRHA 2B4OA 3QCDA 1LYVA 4ZN5A 3QCCA 4D3PA 1RPMA 3AWFA 3U96A 2BIJA 5KA7A 2B07A 2F71A 2AM2A 3F81A 3QCGA 4GWFA 5A5EA 4QF5A 4QDIA 3O4TA 2F6TA 1G7GA 1I9SA 1EENA 1OHDA 3O5XA 2J17A 2H4KA 1YWFA 3ZL8A 2I1YA 2I3RA 2WJPA 1ONZA 1YGRA 2QCTA 4J51A 5KABA 1QXKA 2BZLA 1BZCA 2B4UA 5HDEA 5K23A 3ZM3A 2AZRA 4HJQA 1I57A 4GS0A 5AWXA 1UAGA 2B4SA 2XPCA 1X24A 2F6VA 3SMEA 2ZN7A 2WTZA 1BZHA 2C46A 2B4PA 3NRSA 3ZM5A 3AWEA 4GE6A 2Q05A 3QCHA 2RF6A 5J8RA 4NNDA 4JMKA 3S4OA 1EEHA 2QEPA 2VEVA 2I6JA 4RKKA 4KI9A 3QCJA 1J4XA 4B04A 2F00A 3SR9A 4R30A 3O4SA 1OEVA 1GQQA 2NTAA 3D9CA 2PBNA 1PA1A 2VOSA 1Q6MA 4YR8B 3N2AA 1WRMA 2I4GA 4IKCA 2F70A 3MOWA 2A3KA 4GE5A 1PTYA 1OEMX 3QCZA 3RGOA 3S3KA 1EEOA 2M3VA 2E0TA 5MMZB 1P3DA 3QCNA 3EAXA 2QCJA 1GG4A 1PTUA 1G1FA 4ERCA 2CNHA 1OESA 1JBVA 2G6ZA 2Q47A 4HRFA 3OMHA 1A5YA 1O5ZA 2HB1A 2B3OA 1ONYA 1QZ0A 3D1HA 1GQYA 1YTSA 3AWGA 3MOZA 1E8CA 1YN9A 1OHCA 5EHPA 1T49A 4CVKA 4R0TA 5BZXA 3EMUA 1PA9A 3F99A 1ZCLA 1C87A 4QUMA 3V0GA 2F6YA 4H1OA 3NMEA 4OHHA 1AAXA 4RH9A 2CFVA 1LARA 1T48A 4PYHA 1M3GA 2PSZA 5M43A 1NZ7A 3EZZA 4OHLA 3RZ2A 1OETA 2H4VA 2UUOA 2NLKA 3PYZA 4TVVA 2I5XA 3S4EA 2Y66A 5K22A 1PTVA 1E0DA 3QKPA 3ZM1A 2VORA 1V3AA 4OHEA 2I42A 1L8GA 2QBSA 2PQ5A 1RXDA 1ZZWA 2JFFA 2PI7A 2Y68A 2H03A 1OEUA 2H02A 2CJZA 1P31A 2F6WA 2I6MA 4Y2EA 3CWEA 1OEOX 2HC1A 1C83A 4DGXA 2CM3A 2G59A 2QDMA 1KAVA 3EU0A 1W78A 4QBEA 1G4US 2F46A 2PA5A 2UAGA 5K9WA 1WAXA 3HN7A 2GCBA 1JF7A 3V0DA 2R0BA 2HNPA 1FPRA 2I6IA 3GXHA 5K25A 3ZMPA 2NT7A 4QBWA 4GRZA 2CNFA 1C84A 4JBCA 4GRYA 2QDPA 2A8BA 2XJAA 2YDUA 2H4GA 3I7ZA 2B49A 2F6ZA 3M4UA 2JFHA 2Y67A 5LXQB 2BGEA 2I4EA 1Q6NA 4HJPA 3OLRA 1R6HA 2JJDA 4D3QA 3LK7A 2Y2FA 2VEWA 3V0IA 2OC3A 1YTNA 1YFOA 1C88A 2HY3A 2PT0A 3MMJA 1C86A 3QCMA 1PTTA 4BUCA 4I8NA 1FPZA 1FQ1A 2NZ6A 2ESBA 4GFUA 1U25A 5KA2A 4MBBA 2F6FA 3RGQA 4BUBA 4NWGA 1PH0A 5EHRA 1XBOA 2HC2A 2CMAA 4S0GA 4WU2A 2J16A 3D42A 3V0JA 2HCMA 2P6XA 5KA9A 3S3EA 3RO1A 3V0EA 3QCEA 2NV5A 4QAHA 1U26A 2GP0A 5IBSA 2FJMA 4BPCA 2QDCA 3A5KA 5KA1A 1PYNA 1Q6JA 3S3HA 5BUGA 2GC6A 3UAGA 3QCLA 5K9VA 1KAKA 2MBCA 4KYQA 2QBPA 4JMJA 4UAGA 1LQFA 4BJOA 1YZ4A 3ZM0A 2GJTA 4ICZA 1XM2A 2CM7A 1ZCKA 1XXVA 3H2XA 2DXPA 2P4DA 1JBWA 1Q1MA 1D5RA 2VEYA 3F41A 4H34A 4ZRTA 2BGDA 4Y14A 2CNGA 2UUPA 2CM2A 2QBRA 4ZI4A 5KAAA 2J16B 3QCKA 2I6PA 1L8KA 4RI4A 5KA3A 1NL9A 2BV5A 3I80A 5KACA 1G1HA 1G1GA 2GWOA 2C7SA 1GFYA 2OZ5A 4CVMA 1ECVA 1I9TA 1G7FA 1NWEA 1VHRA 3O3LA
chains in the Genus database with same CATH topology
3QKQA 4RHGA 4KYRA 1Q6PA 2FH7A 1C85A 3I36A 1NWLA 5KA4A 2I3UA 3O4UA 1YTWA 1MKPA 3D1QA 4NX8A 5GTJA 3ZM2A 2CMCA 1Q6SA 2HNQA 3ZV2A 2SHPA 4WOHA 2AHSA 4WU3A 1OHEA 1BZJA 2I4HA 3QCIA 3V0FA 3BM8A 3CM3A 4OHIA 4GFVA 2HVLA 5K24A 2CM8A 3B7OA 3F9BA 3D44A 3EB1A 2HXPA 1WCHA 5KADA 2CNIA 1PXHA 2OUDA 3BLUA 1NNYA 5BX1A 2FJNA 4WTYA 3BLTA 1P15A 1JLNA 3QCBA 5I6VA 1T4JA 1ZC0A 2I6OA 2I75A 2QBQA 2CMBA 1SUGA 2CNEA 5IBMA 1U24A 4RI5A 2WGPA 4QAPA 1XXPA 1YPTA 1GWZA 3N0AA 2VEXA 4JNBA 1G4WR 4YAAA 3PS5A 4OHDA 2Y96A 3A5JA 3ZMQA 4NWFA 3S3FA 2IMGA 4GE2A 4R0SA 4QUNA 5KA8A 1Q6TA 1NO6A 3GXGA 5KA0A 4RDDA 1XRIA 4NYHA 2VEUA 2OOQA 3D1OA 3F9AA 4DGPA 2ZMMA 2NT2A 4PVGA 3QCFA 2H04A 1YGUA 4RH5A 4D3RA 5BZZA 3V0HA 4Z6BA 3LJ8A 4AZ1A 3BRHA 2B4OA 3QCDA 1LYVA 4ZN5A 3QCCA 4D3PA 1RPMA 3AWFA 3U96A 2BIJA 5KA7A 2B07A 2F71A 3F81A 4GWFA 3QCGA 3O4TA 2F6TA 1G7GA 1I9SA 1EENA 1OHDA 3O5XA 2J17A 2H4KA 1YWFA 2I1YA 2I3RA 1ONZA 1YGRA 2QCTA 4J51A 5KABA 1QXKA 2BZLA 1BZCA 2B4UA 5HDEA 5K23A 3ZM3A 2AZRA 4HJQA 1I57A 4GS0A 5AWXA 2B4SA 1X24A 2F6VA 3SMEA 2ZN7A 1BZHA 2C46A 2B4PA 3AWEA 4GE6A 2Q05A 3QCHA 2RF6A 5J8RA 4NNDA 4JMKA 3S4OA 2QEPA 2VEVA 2I6JA 4RKKA 4KI9A 3QCJA 1J4XA 4B04A 3SR9A 4R30A 3O4SA 1OEVA 2NTAA 3D9CA 2PBNA 1PA1A 1Q6MA 4YR8B 1WRMA 2I4GA 4IKCA 2F70A 3MOWA 2A3KA 4GE5A 1PTYA 1OEMX 3RGOA 3S3KA 1EEOA 2M3VA 2E0TA 5MMZB 3QCNA 3EAXA 2QCJA 1PTUA 1G1FA 4ERCA 2CNHA 1OESA 2G6ZA 2Q47A 4HRFA 3OMHA 1A5YA 2HB1A 2B3OA 1ONYA 1QZ0A 3D1HA 1YTSA 3AWGA 3MOZA 1YN9A 1OHCA 5EHPA 1T49A 4R0TA 5BZXA 3EMUA 1PA9A 3F99A 1ZCLA 1C87A 4QUMA 3V0GA 2F6YA 4H1OA 3NMEA 4OHHA 1AAXA 4RH9A 2CFVA 1LARA 1T48A 4PYHA 1M3GA 2PSZA 5M43A 1NZ7A 3EZZA 4OHLA 3RZ2A 1OETA 2H4VA 2NLKA 4TVVA 2I5XA 3S4EA 5K22A 1PTVA 3QKPA 3ZM1A 1V3AA 4OHEA 2I42A 1L8GA 2QBSA 2PQ5A 1RXDA 1ZZWA 2PI7A 2H03A 1OEUA 2H02A 2CJZA 2F6WA 2I6MA 4Y2EA 3CWEA 1OEOX 2HC1A 1C83A 4DGXA 2CM3A 2G59A 2QDMA 1KAVA 3EU0A 4QBEA 1G4US 2F46A 2PA5A 5K9WA 1WAXA 1JF7A 3V0DA 2R0BA 2HNPA 1FPRA 2I6IA 3GXHA 5K25A 3ZMPA 2NT7A 4QBWA 4GRZA 2CNFA 1C84A 4JBCA 4GRYA 2QDPA 2A8BA 2YDUA 2H4GA 3I7ZA 2B49A 2F6ZA 3M4UA 5LXQB 2BGEA 2I4EA 1Q6NA 4HJPA 3OLRA 1R6HA 2JJDA 4D3QA 3V0IA 2Y2FA 2VEWA 2OC3A 1YTNA 1YFOA 1C88A 2HY3A 2PT0A 3QCMA 1C86A 3MMJA 1PTTA 4I8NA 1FQ1A 1FPZA 2NZ6A 2ESBA 4GFUA 1U25A 5KA2A 4MBBA 2F6FA 3RGQA 4NWGA 1PH0A 5EHRA 1XBOA 2HC2A 2CMAA 4S0GA 4WU2A 2J16A 3D42A 3V0JA 2HCMA 2P6XA 5KA9A 3S3EA 3RO1A 3V0EA 3QCEA 2NV5A 4QAHA 1U26A 2GP0A 5IBSA 2FJMA 4BPCA 2QDCA 3A5KA 5KA1A 1PYNA 1Q6JA 3S3HA 5BUGA 3QCLA 5K9VA 1KAKA 2MBCA 4KYQA 2QBPA 4JMJA 1LQFA 4BJOA 1YZ4A 3ZM0A 2GJTA 4ICZA 1XM2A 2CM7A 1ZCKA 1XXVA 3H2XA 2DXPA 2P4DA 1Q1MA 1D5RA 2VEYA 3F41A 4H34A 4ZRTA 2BGDA 4Y14A 2CNGA 4ZI4A 2CM2A 2QBRA 5KAAA 2J16B 3QCKA 2I6PA 1L8KA 4RI4A 5KA3A 1NL9A 2BV5A 3I80A 5KACA 1G1HA 1G1GA 2GWOA 2C7SA 1GFYA 2OZ5A 1ECVA 1I9TA 1G7FA 1NWEA 1VHRA 3O3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKQ A;  4RHG A;  4KYR A;  1Q6P A;  2FH7 A;  1C85 A;  3I36 A;  1NWL A;  5KA4 A;  2I3U A;  3O4U A;  1YTW A;  1MKP A;  3D1Q A;  4NX8 A;  5GTJ A;  3ZM2 A;  2CMC A;  1Q6S A;  2HNQ A;  3ZV2 A;  2SHP A;  4WOH A;  2AHS A;  4WU3 A;  1OHE A;  1BZJ A;  2I4H A;  3QCI A;  3V0F A;  3BM8 A;  3CM3 A;  4OHI A;  4GFV A;  2HVL A;  5K24 A;  2CM8 A;  3B7O A;  3F9B A;  3D44 A;  3EB1 A;  2HXP A;  1WCH A;  5KAD A;  2CNI A;  1PXH A;  2OUD A;  3BLU A;  1NNY A;  5BX1 A;  2FJN A;  4WTY A;  3BLT A;  1P15 A;  1JLN A;  3QCB A;  5I6V A;  1T4J A;  1ZC0 A;  2I6O A;  2I75 A;  2QBQ A;  2CMB A;  1SUG A;  2CNE A;  5IBM A;  1U24 A;  4RI5 A;  2WGP A;  4QAP A;  1XXP A;  1YPT A;  1GWZ A;  3N0A A;  2VEX A;  4JNB A;  1G4W R;  4YAA A;  3PS5 A;  4OHD A;  2Y96 A;  3A5J A;  3ZMQ A;  4NWF A;  3S3F A;  2IMG A;  4GE2 A;  4R0S A;  4QUN A;  5KA8 A;  1Q6T A;  1NO6 A;  3GXG A;  5KA0 A;  4RDD A;  1XRI A;  4NYH A;  2VEU A;  2OOQ A;  3D1O A;  3F9A A;  4DGP A;  2ZMM A;  2NT2 A;  4PVG A;  3QCF A;  2H04 A;  1YGU A;  4RH5 A;  4D3R A;  5BZZ A;  3V0H A;  4Z6B A;  3LJ8 A;  4AZ1 A;  3BRH A;  2B4O A;  3QCD A;  1LYV A;  4ZN5 A;  3QCC A;  4D3P A;  1RPM A;  3AWF A;  3U96 A;  2BIJ A;  5KA7 A;  2B07 A;  2F71 A;  3F81 A;  4GWF A;  3QCG A;  3O4T A;  2F6T A;  1G7G A;  1I9S A;  1EEN A;  1OHD A;  3O5X A;  2J17 A;  2H4K A;  1YWF A;  2I1Y A;  2I3R A;  1ONZ A;  1YGR A;  2QCT A;  4J51 A;  5KAB A;  1QXK A;  2BZL A;  1BZC A;  2B4U A;  5HDE A;  5K23 A;  3ZM3 A;  2AZR A;  4HJQ A;  1I57 A;  4GS0 A;  5AWX A;  2B4S A;  1X24 A;  2F6V A;  3SME A;  2ZN7 A;  1BZH A;  2C46 A;  2B4P A;  3AWE A;  4GE6 A;  2Q05 A;  3QCH A;  2RF6 A;  5J8R A;  4NND A;  4JMK A;  3S4O A;  2QEP A;  2VEV A;  2I6J A;  4RKK A;  4KI9 A;  3QCJ A;  1J4X A;  4B04 A;  3SR9 A;  4R30 A;  3O4S A;  1OEV A;  2NTA A;  3D9C A;  2PBN A;  1PA1 A;  1Q6M A;  4YR8 B;  1WRM A;  2I4G A;  4IKC A;  2F70 A;  3MOW A;  2A3K A;  4GE5 A;  1PTY A;  1OEM X;  3RGO A;  3S3K A;  1EEO A;  2M3V A;  2E0T A;  5MMZ B;  3QCN A;  3EAX A;  2QCJ A;  1PTU A;  1G1F A;  4ERC A;  2CNH A;  1OES A;  2G6Z A;  2Q47 A;  4HRF A;  3OMH A;  1A5Y A;  2HB1 A;  2B3O A;  1ONY A;  1QZ0 A;  3D1H A;  1YTS A;  3AWG A;  3MOZ A;  1YN9 A;  1OHC A;  5EHP A;  1T49 A;  4R0T A;  5BZX A;  3EMU A;  1PA9 A;  3F99 A;  1ZCL A;  1C87 A;  4QUM A;  3V0G A;  2F6Y A;  4H1O A;  3NME A;  4OHH A;  1AAX A;  4RH9 A;  2CFV A;  1LAR A;  1T48 A;  4PYH A;  1M3G A;  2PSZ A;  5M43 A;  1NZ7 A;  3EZZ A;  4OHL A;  3RZ2 A;  1OET A;  2H4V A;  2NLK A;  4TVV A;  2I5X A;  3S4E A;  5K22 A;  1PTV A;  3QKP A;  3ZM1 A;  1V3A A;  4OHE A;  2I42 A;  1L8G A;  2QBS A;  2PQ5 A;  1RXD A;  1ZZW A;  2PI7 A;  2H03 A;  1OEU A;  2H02 A;  2CJZ A;  2F6W A;  2I6M A;  4Y2E A;  3CWE A;  1OEO X;  2HC1 A;  1C83 A;  4DGX A;  2CM3 A;  2G59 A;  2QDM A;  1KAV A;  3EU0 A;  4QBE A;  1G4U S;  2F46 A;  2PA5 A;  5K9W A;  1WAX A;  1JF7 A;  3V0D A;  2R0B A;  2HNP A;  1FPR A;  2I6I A;  3GXH A;  5K25 A;  3ZMP A;  2NT7 A;  4QBW A;  4GRZ A;  2CNF A;  1C84 A;  4JBC A;  4GRY A;  2QDP A;  2A8B A;  2YDU A;  2H4G A;  3I7Z A;  2B49 A;  2F6Z A;  3M4U A;  5LXQ B;  2BGE A;  2I4E A;  1Q6N A;  4HJP A;  3OLR A;  1R6H A;  2JJD A;  4D3Q A;  3V0I A;  2Y2F A;  2VEW A;  2OC3 A;  1YTN A;  1YFO A;  1C88 A;  2HY3 A;  2PT0 A;  3QCM A;  1C86 A;  3MMJ A;  1PTT A;  4I8N A;  1FQ1 A;  1FPZ A;  2NZ6 A;  2ESB A;  4GFU A;  1U25 A;  5KA2 A;  4MBB A;  2F6F A;  3RGQ A;  4NWG A;  1PH0 A;  5EHR A;  1XBO A;  2HC2 A;  2CMA A;  4S0G A;  4WU2 A;  2J16 A;  3D42 A;  3V0J A;  2HCM A;  2P6X A;  5KA9 A;  3S3E A;  3RO1 A;  3V0E A;  3QCE A;  2NV5 A;  4QAH A;  1U26 A;  2GP0 A;  5IBS A;  2FJM A;  4BPC A;  2QDC A;  3A5K A;  5KA1 A;  1PYN A;  1Q6J A;  3S3H A;  5BUG A;  3QCL A;  5K9V A;  1KAK A;  2MBC A;  4KYQ A;  2QBP A;  4JMJ A;  1LQF A;  4BJO A;  1YZ4 A;  3ZM0 A;  2GJT A;  4ICZ A;  1XM2 A;  2CM7 A;  1ZCK A;  1XXV A;  3H2X A;  2DXP A;  2P4D A;  1Q1M A;  1D5R A;  2VEY A;  3F41 A;  4H34 A;  4ZRT A;  2BGD A;  4Y14 A;  2CNG A;  4ZI4 A;  2CM2 A;  2QBR A;  5KAA A;  2J16 B;  3QCK A;  2I6P A;  1L8K A;  4RI4 A;  5KA3 A;  1NL9 A;  2BV5 A;  3I80 A;  5KAC A;  1G1H A;  1G1G A;  2GWO A;  2C7S A;  1GFY A;  2OZ5 A;  1ECV A;  1I9T A;  1G7F A;  1NWE A;  1VHR A;  3O3L A; 
#chains in the Genus database with same CATH topology
 3QKQ A;  2GC5 A;  4RHG A;  4KYR A;  1Q6P A;  2FH7 A;  1C85 A;  3I36 A;  1NWL A;  5KA4 A;  2I3U A;  1FGS A;  3O4U A;  1YTW A;  4C13 A;  1MKP A;  3D1Q A;  4NX8 A;  5GTJ A;  3ZM2 A;  2CMC A;  1Q6S A;  2HNQ A;  3ZV2 A;  2SHP A;  4WOH A;  2AHS A;  4WU3 A;  1OHE A;  1BZJ A;  2I4H A;  3QCI A;  3V0F A;  4CVL A;  3BM8 A;  3CM3 A;  4OHI A;  1J6U A;  4GFV A;  2HVL A;  5K24 A;  2CM8 A;  3B7O A;  3F9B A;  2VTE A;  3D44 A;  3EB1 A;  2HXP A;  2VTD A;  1WCH A;  5KAD A;  2CNI A;  1PXH A;  2OUD A;  3BLU A;  1NNY A;  5BX1 A;  2FJN A;  4WTY A;  4HV4 A;  3BLT A;  1P15 A;  1JLN A;  3QCB A;  5I6V A;  1T4J A;  1ZC0 A;  2I6O A;  2I75 A;  2QBQ A;  3ZM6 A;  2CMB A;  1SUG A;  2CNE A;  5IBM A;  2JFG A;  1U24 A;  3MVN A;  4RI5 A;  2WGP A;  4QAP A;  1XXP A;  1YPT A;  1GWZ A;  3N0A A;  2VEX A;  4JNB A;  1G4W R;  4YAA A;  3PS5 A;  4ZIY A;  4OHD A;  2Y96 A;  3A5J A;  3ZMQ A;  4NWF A;  4C12 A;  3S3F A;  2IMG A;  4GE2 A;  4R0S A;  4QUN A;  1W7K A;  5KA8 A;  1Q6T A;  1NO6 A;  3GXG A;  5KA0 A;  4RDD A;  1XRI A;  4NYH A;  2Y1O A;  2VEU A;  2OOQ A;  2AM1 A;  5A5F A;  3D1O A;  3F9A A;  2X5O A;  4DGP A;  2ZMM A;  2NT2 A;  4PVG A;  3QCF A;  2H04 A;  1YGU A;  4RH5 A;  2GCA A;  4D3R A;  5BZZ A;  3V0H A;  4Z6B A;  3LJ8 A;  4AZ1 A;  3BRH A;  2B4O A;  3QCD A;  1LYV A;  4ZN5 A;  3QCC A;  4D3P A;  1RPM A;  3AWF A;  3U96 A;  2BIJ A;  5KA7 A;  2B07 A;  2F71 A;  2AM2 A;  3F81 A;  3QCG A;  4GWF A;  5A5E A;  4QF5 A;  4QDI A;  3O4T A;  2F6T A;  1G7G A;  1I9S A;  1EEN A;  1OHD A;  3O5X A;  2J17 A;  2H4K A;  1YWF A;  3ZL8 A;  2I1Y A;  2I3R A;  2WJP A;  1ONZ A;  1YGR A;  2QCT A;  4J51 A;  5KAB A;  1QXK A;  2BZL A;  1BZC A;  2B4U A;  5HDE A;  5K23 A;  3ZM3 A;  2AZR A;  4HJQ A;  1I57 A;  4GS0 A;  5AWX A;  1UAG A;  2B4S A;  2XPC A;  1X24 A;  2F6V A;  3SME A;  2ZN7 A;  2WTZ A;  1BZH A;  2C46 A;  2B4P A;  3NRS A;  3ZM5 A;  3AWE A;  4GE6 A;  2Q05 A;  3QCH A;  2RF6 A;  5J8R A;  4NND A;  4JMK A;  3S4O A;  1EEH A;  2QEP A;  2VEV A;  2I6J A;  4RKK A;  4KI9 A;  3QCJ A;  1J4X A;  4B04 A;  2F00 A;  3SR9 A;  4R30 A;  3O4S A;  1OEV A;  1GQQ A;  2NTA A;  3D9C A;  2PBN A;  1PA1 A;  2VOS A;  1Q6M A;  4YR8 B;  3N2A A;  1WRM A;  2I4G A;  4IKC A;  2F70 A;  3MOW A;  2A3K A;  4GE5 A;  1PTY A;  1OEM X;  3QCZ A;  3RGO A;  3S3K A;  1EEO A;  2M3V A;  2E0T A;  5MMZ B;  1P3D A;  3QCN A;  3EAX A;  2QCJ A;  1GG4 A;  1PTU A;  1G1F A;  4ERC A;  2CNH A;  1OES A;  1JBV A;  2G6Z A;  2Q47 A;  4HRF A;  3OMH A;  1A5Y A;  1O5Z A;  2HB1 A;  2B3O A;  1ONY A;  1QZ0 A;  3D1H A;  1GQY A;  1YTS A;  3AWG A;  3MOZ A;  1E8C A;  1YN9 A;  1OHC A;  5EHP A;  1T49 A;  4CVK A;  4R0T A;  5BZX A;  3EMU A;  1PA9 A;  3F99 A;  1ZCL A;  1C87 A;  4QUM A;  3V0G A;  2F6Y A;  4H1O A;  3NME A;  4OHH A;  1AAX A;  4RH9 A;  2CFV A;  1LAR A;  1T48 A;  4PYH A;  1M3G A;  2PSZ A;  5M43 A;  1NZ7 A;  3EZZ A;  4OHL A;  3RZ2 A;  1OET A;  2H4V A;  2UUO A;  2NLK A;  3PYZ A;  4TVV A;  2I5X A;  3S4E A;  2Y66 A;  5K22 A;  1PTV A;  1E0D A;  3QKP A;  3ZM1 A;  2VOR A;  1V3A A;  4OHE A;  2I42 A;  1L8G A;  2QBS A;  2PQ5 A;  1RXD A;  1ZZW A;  2JFF A;  2PI7 A;  2Y68 A;  2H03 A;  1OEU A;  2H02 A;  2CJZ A;  1P31 A;  2F6W A;  2I6M A;  4Y2E A;  3CWE A;  1OEO X;  2HC1 A;  1C83 A;  4DGX A;  2CM3 A;  2G59 A;  2QDM A;  1KAV A;  3EU0 A;  1W78 A;  4QBE A;  1G4U S;  2F46 A;  2PA5 A;  2UAG A;  5K9W A;  1WAX A;  3HN7 A;  2GCB A;  1JF7 A;  3V0D A;  2R0B A;  2HNP A;  1FPR A;  2I6I A;  3GXH A;  5K25 A;  3ZMP A;  2NT7 A;  4QBW A;  4GRZ A;  2CNF A;  1C84 A;  4JBC A;  4GRY A;  2QDP A;  2A8B A;  2XJA A;  2YDU A;  2H4G A;  3I7Z A;  2B49 A;  2F6Z A;  3M4U A;  2JFH A;  2Y67 A;  5LXQ B;  2BGE A;  2I4E A;  1Q6N A;  4HJP A;  3OLR A;  1R6H A;  2JJD A;  4D3Q A;  3LK7 A;  2Y2F A;  2VEW A;  3V0I A;  2OC3 A;  1YTN A;  1YFO A;  1C88 A;  2HY3 A;  2PT0 A;  3MMJ A;  1C86 A;  3QCM A;  1PTT A;  4BUC A;  4I8N A;  1FPZ A;  1FQ1 A;  2NZ6 A;  2ESB A;  4GFU A;  1U25 A;  5KA2 A;  4MBB A;  2F6F A;  3RGQ A;  4BUB A;  4NWG A;  1PH0 A;  5EHR A;  1XBO A;  2HC2 A;  2CMA A;  4S0G A;  4WU2 A;  2J16 A;  3D42 A;  3V0J A;  2HCM A;  2P6X A;  5KA9 A;  3S3E A;  3RO1 A;  3V0E A;  3QCE A;  2NV5 A;  4QAH A;  1U26 A;  2GP0 A;  5IBS A;  2FJM A;  4BPC A;  2QDC A;  3A5K A;  5KA1 A;  1PYN A;  1Q6J A;  3S3H A;  5BUG A;  2GC6 A;  3UAG A;  3QCL A;  5K9V A;  1KAK A;  2MBC A;  4KYQ A;  2QBP A;  4JMJ A;  4UAG A;  1LQF A;  4BJO A;  1YZ4 A;  3ZM0 A;  2GJT A;  4ICZ A;  1XM2 A;  2CM7 A;  1ZCK A;  1XXV A;  3H2X A;  2DXP A;  2P4D A;  1JBW A;  1Q1M A;  1D5R A;  2VEY A;  3F41 A;  4H34 A;  4ZRT A;  2BGD A;  4Y14 A;  2CNG A;  2UUP A;  2CM2 A;  2QBR A;  4ZI4 A;  5KAA A;  2J16 B;  3QCK A;  2I6P A;  1L8K A;  4RI4 A;  5KA3 A;  1NL9 A;  2BV5 A;  3I80 A;  5KAC A;  1G1H A;  1G1G A;  2GWO A;  2C7S A;  1GFY A;  2OZ5 A;  4CVM A;  1ECV A;  1I9T A;  1G7F A;  1NWE A;  1VHR A;  3O3L A; 
#chains in the Genus database with same CATH homology
 3QKQ A;  4RHG A;  4KYR A;  1Q6P A;  2FH7 A;  1C85 A;  3I36 A;  1NWL A;  5KA4 A;  2I3U A;  3O4U A;  1YTW A;  1MKP A;  3D1Q A;  4NX8 A;  5GTJ A;  3ZM2 A;  2CMC A;  1Q6S A;  2HNQ A;  3ZV2 A;  2SHP A;  4WOH A;  2AHS A;  4WU3 A;  1OHE A;  1BZJ A;  2I4H A;  3QCI A;  3V0F A;  3BM8 A;  3CM3 A;  4OHI A;  4GFV A;  2HVL A;  5K24 A;  2CM8 A;  3B7O A;  3F9B A;  3D44 A;  3EB1 A;  2HXP A;  1WCH A;  5KAD A;  2CNI A;  1PXH A;  2OUD A;  3BLU A;  1NNY A;  5BX1 A;  2FJN A;  4WTY A;  3BLT A;  1P15 A;  1JLN A;  3QCB A;  5I6V A;  1T4J A;  1ZC0 A;  2I6O A;  2I75 A;  2QBQ A;  2CMB A;  1SUG A;  2CNE A;  5IBM A;  1U24 A;  4RI5 A;  2WGP A;  4QAP A;  1XXP A;  1YPT A;  1GWZ A;  3N0A A;  2VEX A;  4JNB A;  1G4W R;  4YAA A;  3PS5 A;  4OHD A;  2Y96 A;  3A5J A;  3ZMQ A;  4NWF A;  3S3F A;  2IMG A;  4GE2 A;  4R0S A;  4QUN A;  5KA8 A;  1Q6T A;  1NO6 A;  3GXG A;  5KA0 A;  4RDD A;  1XRI A;  4NYH A;  2VEU A;  2OOQ A;  3D1O A;  3F9A A;  4DGP A;  2ZMM A;  2NT2 A;  4PVG A;  3QCF A;  2H04 A;  1YGU A;  4RH5 A;  4D3R A;  5BZZ A;  3V0H A;  4Z6B A;  3LJ8 A;  4AZ1 A;  3BRH A;  2B4O A;  3QCD A;  1LYV A;  4ZN5 A;  3QCC A;  4D3P A;  1RPM A;  3AWF A;  3U96 A;  2BIJ A;  5KA7 A;  2B07 A;  2F71 A;  3F81 A;  4GWF A;  3QCG A;  3O4T A;  2F6T A;  1G7G A;  1I9S A;  1EEN A;  1OHD A;  3O5X A;  2J17 A;  2H4K A;  1YWF A;  2I1Y A;  2I3R A;  1ONZ A;  1YGR A;  2QCT A;  4J51 A;  5KAB A;  1QXK A;  2BZL A;  1BZC A;  2B4U A;  5HDE A;  5K23 A;  3ZM3 A;  2AZR A;  4HJQ A;  1I57 A;  4GS0 A;  5AWX A;  2B4S A;  1X24 A;  2F6V A;  3SME A;  2ZN7 A;  1BZH A;  2C46 A;  2B4P A;  3AWE A;  4GE6 A;  2Q05 A;  3QCH A;  2RF6 A;  5J8R A;  4NND A;  4JMK A;  3S4O A;  2QEP A;  2VEV A;  2I6J A;  4RKK A;  4KI9 A;  3QCJ A;  1J4X A;  4B04 A;  3SR9 A;  4R30 A;  3O4S A;  1OEV A;  2NTA A;  3D9C A;  2PBN A;  1PA1 A;  1Q6M A;  4YR8 B;  1WRM A;  2I4G A;  4IKC A;  2F70 A;  3MOW A;  2A3K A;  4GE5 A;  1PTY A;  1OEM X;  3RGO A;  3S3K A;  1EEO A;  2M3V A;  2E0T A;  5MMZ B;  3QCN A;  3EAX A;  2QCJ A;  1PTU A;  1G1F A;  4ERC A;  2CNH A;  1OES A;  2G6Z A;  2Q47 A;  4HRF A;  3OMH A;  1A5Y A;  2HB1 A;  2B3O A;  1ONY A;  1QZ0 A;  3D1H A;  1YTS A;  3AWG A;  3MOZ A;  1YN9 A;  1OHC A;  5EHP A;  1T49 A;  4R0T A;  5BZX A;  3EMU A;  1PA9 A;  3F99 A;  1ZCL A;  1C87 A;  4QUM A;  3V0G A;  2F6Y A;  4H1O A;  3NME A;  4OHH A;  1AAX A;  4RH9 A;  2CFV A;  1LAR A;  1T48 A;  4PYH A;  1M3G A;  2PSZ A;  5M43 A;  1NZ7 A;  3EZZ A;  4OHL A;  3RZ2 A;  1OET A;  2H4V A;  2NLK A;  4TVV A;  2I5X A;  3S4E A;  5K22 A;  1PTV A;  3QKP A;  3ZM1 A;  1V3A A;  4OHE A;  2I42 A;  1L8G A;  2QBS A;  2PQ5 A;  1RXD A;  1ZZW A;  2PI7 A;  2H03 A;  1OEU A;  2H02 A;  2CJZ A;  2F6W A;  2I6M A;  4Y2E A;  3CWE A;  1OEO X;  2HC1 A;  1C83 A;  4DGX A;  2CM3 A;  2G59 A;  2QDM A;  1KAV A;  3EU0 A;  4QBE A;  1G4U S;  2F46 A;  2PA5 A;  5K9W A;  1WAX A;  1JF7 A;  3V0D A;  2R0B A;  2HNP A;  1FPR A;  2I6I A;  3GXH A;  5K25 A;  3ZMP A;  2NT7 A;  4QBW A;  4GRZ A;  2CNF A;  1C84 A;  4JBC A;  4GRY A;  2QDP A;  2A8B A;  2YDU A;  2H4G A;  3I7Z A;  2B49 A;  2F6Z A;  3M4U A;  5LXQ B;  2BGE A;  2I4E A;  1Q6N A;  4HJP A;  3OLR A;  1R6H A;  2JJD A;  4D3Q A;  3V0I A;  2Y2F A;  2VEW A;  2OC3 A;  1YTN A;  1YFO A;  1C88 A;  2HY3 A;  2PT0 A;  3QCM A;  1C86 A;  3MMJ A;  1PTT A;  4I8N A;  1FQ1 A;  1FPZ A;  2NZ6 A;  2ESB A;  4GFU A;  1U25 A;  5KA2 A;  4MBB A;  2F6F A;  3RGQ A;  4NWG A;  1PH0 A;  5EHR A;  1XBO A;  2HC2 A;  2CMA A;  4S0G A;  4WU2 A;  2J16 A;  3D42 A;  3V0J A;  2HCM A;  2P6X A;  5KA9 A;  3S3E A;  3RO1 A;  3V0E A;  3QCE A;  2NV5 A;  4QAH A;  1U26 A;  2GP0 A;  5IBS A;  2FJM A;  4BPC A;  2QDC A;  3A5K A;  5KA1 A;  1PYN A;  1Q6J A;  3S3H A;  5BUG A;  3QCL A;  5K9V A;  1KAK A;  2MBC A;  4KYQ A;  2QBP A;  4JMJ A;  1LQF A;  4BJO A;  1YZ4 A;  3ZM0 A;  2GJT A;  4ICZ A;  1XM2 A;  2CM7 A;  1ZCK A;  1XXV A;  3H2X A;  2DXP A;  2P4D A;  1Q1M A;  1D5R A;  2VEY A;  3F41 A;  4H34 A;  4ZRT A;  2BGD A;  4Y14 A;  2CNG A;  4ZI4 A;  2CM2 A;  2QBR A;  5KAA A;  2J16 B;  3QCK A;  2I6P A;  1L8K A;  4RI4 A;  5KA3 A;  1NL9 A;  2BV5 A;  3I80 A;  5KAC A;  1G1H A;  1G1G A;  2GWO A;  2C7S A;  1GFY A;  2OZ5 A;  1ECV A;  1I9T A;  1G7F A;  1NWE A;  1VHR A;  3O3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...