2NZDB

Nucleosome core particle containing 145 bp of dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
total genus 29
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdB00
1P3AA 3W99A 5B33B 2L5AA 3AYWD 2CV5B 3MVDA 3V9RB 5AV5A 3AZFD 3AFAD 5AV5D 3AV1D 4X23B 3UT9C 5B40B 3AZHC 1F66A 1TAFB 5AY8D 1P3AD 2FJ7C 3TU4D 2NQBD 3LZ1D 5F99B 1AOIA 1P3MD 1N1JA 3VH5T 5JRGD 5B2JD 4J8XD 3LZ0C 5CPIB 3LELB 1P3GB 4QLCA 4E45A 3KWQC 3UTBC 3AZGD 3LELC 1P3GC 3W98B 2NZDB 5CPKC 2PYOC 5B24B 3X1UC 4XUJB 2YFWA 3LJAB 5BS7C 5CP6B 3AZNC 4H9PB 5CPJD 4QLCC 3KWQA 5B1MB 4J8VA 3AZHA 1H3OB 3R45B 5BNVB 4WU9D 1ZLAC 4YM6A 1M18A 4UUZA 3B0DC 2CWEA 3AZGA 4H9OA 5B31G 5B32B 5B2JA 5JA4A 2NQBB 2FJ7D 3WTPA 3MGRC 3AZFC 3REJB 4X23D 5AV9D 3AZMC 5DNMA 4Z5TA 4Z2MG 1S32D 1EQZB 1P3FA 4KGCC 3C1CD 5JRGA 2AROB 5AVBC 4J8XA 4LD9C 2BYMB 1P3PA 3LZ0D 5G49B 3WAAC 4J8WC 1KU5A 4H9NB 4XZQD 1P3MB 2F8NH 1P3LD 1F66D 5GXQA 3REKC 3MNNA 1P34A 1U35C 3LJAC 1P3BC 1P3FC 3KUYA 4KGCA 3REKB 3B0BA 3UTAA 4H9SA 3UT9D 3AZLC 3WA9B 1TZYD 3W96A 4KUDB 1BH9B 5AV5C 5AY8C 1HQ3D 1P3OA 3WTPC 3MGRA 4JJNB 5B40C 5AVCD 1P3ID 2FJ7B 1KX4A 5B0YB 4AWLB 5F99C 3C1CA 2F8NA 3W96C 4J8UA 3B6FB 3MGQD 1KX3A 1M1AC 4YM6D 1M18D 5B33C 4EO5C 5KDMA 3WKJC 4KHAB 1P3LA 3O62C 3REHA 3X1SC 5CPKB 5BT1C 2PYOB 1P3OC 3AZJB 5C3IB 5AV6A 1EQZD 3NQJA 5AV9A 4Z66C 1KX3D 4CSRB 4WU8C 3REIA 5B2IA 1WWIA 2HIOD 1P3BD 3AYWB 2CV5D 3LZ1B 1ID3C 1M1AA 5AVCA 3X1UB 3X1VA 4H9RA 3MGPB 3UTAD 5DNND 5AVBD 3X1UA 3A6NA 4KGCD 4J8UD 1M1AB 4Z66A 5E5AB 5AV8C 3LZ1A 5B33D 4HGAB 1M19C 5GT3A 5B2IB 3O62B 4H9SC 3REIB 1ID3D 4YM6C 3AV2B 1M18C 3AZNA 3AN2A 4CSRA 1U35B 4WU9B 4ZBJC 3NQJB 1P3KC 1JFIB 3X1TC 1ZLAB 1P3IC 4ZUXA 5CPJB 1KX3C 3WTPD 5GXQD 3AZJD 5B1LD 3REHB 4WV4B 5CHLB 3UT9A 3A6ND 3X1UD 1WWSA 3C1BB 3AN2D 1M19A 3W97B 3REKD 3B6FA 3MVDC 1U35D 3MGQC 4J8UB 2F8NB 3WKJD 4J8WA 3WAAA 3C1CB 2YFVB 1P3BB 5B31C 4XZQA 4G91B 5B0YA 4LD9B 4EO5B 5B0ZB 5B0ZA 5JRGC 4J8XC 4XZQB 4LD9A 2FJ7A 2YFVA 1P3BA 4J8WB 1P3MC 3WAAB 4JJNA 1P3OB 3UTAC 1A7WA 3W97A 4WU8D 1BH9A 3C1BA 1M19B 1B67A 3WA9A 4KUDA 3REIC 3UTAB 4E44A 4NE5A 3UT9B 1P34C 1BFMA 1P34B 3AFAC 5GXQB 3VH6T 2JSSA 5CPJA 4ZUXB 4H9NA 5G49A 1JFIA 1ZLAA 5BT1D 4WU9A 5B32G 1U35A 3W97D 3AN2B 1EQZA 3AZNB 3VH6A 3AV2A 5BS7A 5GT3B 3O62A 3C1BC 3AN2C 5GT0D 3KXBC 2IO5C 3A6NC 5E5AA 5JA4B 4Z66B 4G92C 5B1MC 5CPKD 5B32A 3A6NB 3AZGC 4Z5TC 5DNMC 4ZUXD 2PYOD 3MGRD 3RELC 4H9OB 3MGPA 3AZGB 4H9RB 3X1VB 4UUZB 3X1TD 4YM6B 1M18B 4JJND 1H3OA 5AVCB 5BNVA 3AZHB 4WU9C 3AYWA 4J8VB 1KX5D 5B1MA 1F66C 4DRBA 5CP6A 3LJAA 3LJAD 4J8WD 3WAAD 3AZID 3W98A 5AV9B 5AV6C 3W98D 1P3FD 3MNND 5AV6B 5AV9C 3B0CW 3MGPC 3LELA 1P3GA 3W97C 3AZJA 1N1JB 1S32C 5CPKA 2PYOA 5GT3C 3C1CC 1AOIB 1P3LB 4KHAA 5KDMB 3REJD 5B0ZC 3VH6W 4G92B 3X1VD 1KX3B 5B40A 4X23A 5AV5B 3V9RA 5B32D 2CV5A 3AZHD 1KX4B 5B33A 1P3AB 3AZLD 1HQ3C 3O62D 3MGRB 3NQUB 5CPIC 5DNNA 3W96B 3AZKD 3X1SB 2RVQC 3REKA 3B6FD 3KUYB 4KGCB 3C1BD 3MNNB 5GT0C 3KXBD 3UTBA 5BNXA 5GSUA 5F99D 3MNNC 1P3MA 5B1LA 4R8PC 4YS3D 1B6WA 2BYMA 4XUJD 1P3PB 2AROA 5JRGB 4J8XB 2F8NK 1P3FB 3AFAB 1HQ3A 4WZSB 4Z5TB 1TZYC 5DNMB 3B0DB 3LZ1C 3REJA 5AY8B 3X1VC 5B2JC 3TU4B 3WTPB 3AZIA 5B0ZD 2NQBA 5B2JB 3AYWC 5FUGA 2HIOB 5AV8A 4Z66D 2BYKA 1P3PD 3AZEA 3AZFA 3R45A 4HGAC 4Z5TD 5DNMD 1S32A 3MGPD 3W98C 3MGSC 3W99D 3AZND 3KWQB 5CP6D 4H9PA 5E5AC 2YFWB 4XUJA 3AZKC 3LZ0A 4ZBJB 4CAYB 5GT0B 5B24A 3AZJC 3AZEC 5C3IC 5B2IC 2NZDA 3UTBD 3X1TA 1P3PC 3KUYD 4QLCB 3B0CT 5CPIA 4DRAA 3RELA 3AV1B 1TZYB 5B32C 2LY8A 5AVCC 3AV1C 5F99A 3B6GA 4YS3B 5B31A 1TAFA 1F66B 1ID3B 3AV2D 5B2ID 3REID 4G91C 5DNNC 4XZQC 3MVDB 1P3LC 2AROD 1M1AD 1BH8A 3MGQB 4J8UC 3KWQD 3W99B 3WTPE 4WNNB 5GSUD 1P3IA 3REHD 4R8PB 4X23C 3AV2C 3AZMD 1P3KA 5B40D 3WKJA 4WU8A 1KX5C 4NE6A 4WU8B 1P3KB 2F8NG 1Q9CA 1P34D 1P3IB 5GXQC 3AZLA 5BO0B 4WNNA 1KX4D 4ZUXC 3KUYC 3RELD 5B1MD 4Z2MH 1KX5A 4M6BA 3VH5A 1P3OD 1BH8B 3MGQA 4R8PD 3X1SD 3MVDD 3VH5W 5B0YC 4AWLC 2NZDD 5CP6C 1ID3A 3KXBB 5B31B 3MGSD 2IO5B 3MGSA 4YS3A 5AV8D 2HUEC 5E5AD 3B6GB 3LELD 1P3GD 3AZKB 2HUEB 1HTAA 1TZYA 3W96D 4H9QB 5B24C 3AV1A 3RELB 4J8VC 3B6GC 5AVBA 2HIOC 3X1TB 2NQBC 3AZMA 1P3KD 4CAYA 5GT0A 3REJC 3TU4C 3LZ0B 3KSYA 3AZMB 1EQZC 1S32B 2AROC 5AVBB 1AOIC 4H9QA 3AZFB 1R4VA 3AZEB 2BYKB 4XUJC 3AZKA 4NE3A 5AV6D 5AV8B 2HIOA 5FUGB 5B31D 3MGSB 3AZIC 2CV5C 3KXBA 5B0YD 3AZIB 2RVQD 3WA9C 3TU4A 4KUDC 5AY8A 1P3AC 5CPID 4JJNC 1HQ3B 3AFAA 1ZLAD 4J8VD 1KX5B 5B1LC 1KX4C 3B6GD 5BO0A 1ULYA 3AZLB 5B1LB 5B24D 4NFTA 5BNXB 5GSUB 3UTBB 3W99C 4YS3C 5CPJC 1M19D 3WA9D 4KUDD 2NZDC 5GSUC 2F8ND 3WKJB 4QLCD 3X1SA 3REHC 4R8PA 3AZED 5DNNB 3NQUA 1AOID 5GT3D 1F1EA 4LD9D 3B6FC
chains in the Genus database with same CATH superfamily
1P3AA 3W99A 5B33B 2L5AA 3AYWD 2CV5B 3MVDA 3V9RB 5AV5A 3AZFD 3AFAD 5AV5D 2JE5A 3AL0C 2ZY5A 3AV1D 4X23B 2VQRA 3UT9C 5B40B 3F6TA 3AZHC 1F66A 1TAFB 5AY8D 1P3AD 2FJ7C 3TU4D 2NQBD 3LZ1D 5F99B 1AOIA 3KFUG 1P3MD 1N1JA 3VH5T 5JRGD 5B2JD 2FFFB 4J8XD 3LZ0C 5CPIB 3LELB 1P3GB 4QLCA 4E45A 3KWQC 4DQYB 3UTBC 3AZGD 3LELC 1P3GC 3W98B 2NZDB 2DQNC 5CPKC 2PYOC 2F2AC 5B24B 3X1UC 4XUJB 2YFWA 3LJAB 5BS7C 5CP6B 3EPLA 4H9PB 5CPJD 3AZNC 4QLCC 3KWQA 5B1MB 4J8VA 3AZHA 1H3OB 3R45B 5BNVB 4WU9D 1ZLAC 4YM6A 1M18A 4UUZA 3B0DC 2CWEA 3AZGA 4H9OA 5B31G 5B32B 5B2JA 5JA4A 2NQBB 2FJ7D 3WTPA 3MGRC 3AZFC 3REJB 4X23D 5AV9D 3AZMC 5DNMA 4Z5TA 4Z2MG 1S32D 1EQZB 1P3FA 4KGCC 3C1CD 5JRGA 2AROB 5AVBC 4J8XA 4LD9C 2BYMB 1P3PA 3LZ0D 5G49B 3WAAC 4J8WC 1KU5A 4H9NB 4XZQD 1P3MB 2F8NH 1P3LD 1F66D 5GXQA 3REKC 3MNNA 1P34A 1U35C 3LJAC 1P3BC 1P3FC 3KUYA 4KGCA 3REKB 3B0BA 3UTAA 4H9SA 3UT9D 3AZLC 3WA9B 1TZYD 3W96A 4KUDB 1BH9B 5AV5C 5AY8C 1HQ3D 1P3OA 3WTPC 3A1KA 3MGRA 4JJNB 5B40C 5AVCD 1P3ID 2FJ7B 1KX4A 5B0YB 4AWLB 5F99C 3C1CA 2F8NA 3W96C 4J8UA 3H0RC 3B6FB 3MGQD 1KX3A 1M1AC 4YM6D 1M18D 5B33C 4EO5C 5KDMA 3WKJC 4KHAB 1P3LA 3O62C 3REHA 3X1SC 5CPKB 5BT1C 2PYOB 1P3OC 3AZJB 5C3IB 2JCHA 5AV6A 1EQZD 3NQJA 5AV9A 4Z66C 1KX3D 4CSRB 4WU8C 2XD5A 3REIA 5B2IA 1WWIA 2HIOD 1P3BD 3AYWB 2CV5D 3LZ1B 2XD1A 1ID3C 1M1AA 5AVCA 3X1UB 3X1VA 4H9RA 3MGPB 3UTAD 5DNND 5AVBD 3X1UA 3A6NA 2Y2OA 4J8UD 4KGCD 1M1AB 4Z66A 5E5AB 5AV8C 3LZ1A 5B33D 2RIQA 4HGAB 1M19C 5GT3A 5B2IB 3O62B 4H9SC 3REIB 1ID3D 4YM6C 3AV2B 1M18C 3AZNA 3AN2A 4CSRA 1U35B 4WU9B 2Y2GA 4ZBJC 3NQJB 1P3KC 1JFIB 3X1TC 1ZLAB 1P3IC 4ZUXA 5CPJB 1KX3C 3WTPD 5GXQD 3AZJD 5B1LD 3REHB 4WV4B 2W8SA 5CHLB 3UT9A 3A6ND 3X1UD 1WWSA 3C1BB 3AN2D 1M19A 3W97B 3REKD 3B6FA 3MVDC 1U35D 3MGQC 4J8UB 2F8NB 3WKJD 4J8WA 3WAAA 3C1CB 2YFVB 1P3BB 5B31C 4XZQA 5B0YA 4G91B 4LD9B 4EO5B 5B0ZB 5B0ZA 5JRGC 4J8XC 4XZQB 4LD9A 2FJ7A 2YFVA 1P3BA 4J8WB 1P3MC 3WAAB 4JJNA 1P3OB 3UTAC 1A7WA 3W97A 4WU8D 1BH9A 3C1BA 1M19B 1B67A 3WA9A 4KUDA 3REIC 3UTAB 4E44A 4NE5A 3UT9B 1P34C 1BFMA 1P34B 3AFAC 5GXQB 3VH6T 2JSSA 5CPJA 4ZUXB 4H9NA 5G49A 1JFIA 1ZLAA 5BT1D 4WU9A 5B32G 1U35A 3W97D 3AN2B 1EQZA 3AZNB 3VH6A 3AV2A 5BS7A 5GT3B 3O62A 3C1BC 3AN2C 2Y2LA 2G5HC 5GT0D 3KXBC 2J8PA 2IO5C 3IP4C 3A6NC 5E5AA 5JA4B 4Z66B 4G92C 5B1MC 5CPKD 3H0LC 5B32A 3A6NB 5DNMC 4Z5TC 4ZUXD 3AZGC 2PYOD 2ZY3A 3P5JB 3MGRD 2Y2HA 3RELC 4H9OB 3MGPA 3AZGB 4H9RB 3X1VB 4UUZB 3X1TD 4YM6B 1M18B 4JJND 1H3OA 5AVCB 5BNVA 3AZHB 2G5IC 4WU9C 3AYWA 4J8VB 1KX5D 5B1MA 1F66C 4DRBA 5CP6A 3LJAA 3LJAD 4J8WD 3WAAD 3AZID 3W98A 5AV9B 5AV6C 3W98D 1P3FD 3MNND 5AV6B 5AV9C 3B0CW 3MGPC 3LELA 1P3GA 3W97C 3AZJA 1N1JB 1S32C 5CPKA 2PYOA 5GT3C 3C1CC 1AOIB 1P3LB 4KHAA 5KDMB 3REJD 5B0ZC 3VH6W 4G92B 4WJ3C 3X1VD 1KX3B 5B40A 4X23A 3EPHA 5AV5B 3V9RA 5B32D 2CV5A 3AZHD 1KX4B 2Y2QA 5B33A 1P3AB 3AZLD 1T3UA 1HQ3C 3O62D 3MGRB 3NQUB 5CPIC 5DNNA 3W96B 3AZKD 3X1SB 2RVQC 3REKA 3B6FD 3KUYB 4KGCB 3EPKA 3C1BD 3MNNB 5GT0C 3KXBD 3UTBA 5BNXA 5GSUA 5F99D 3MNNC 1P3MA 5B1LA 4R8PC 4YS3D 1B6WA 2BYMA 4XUJD 1P3PB 2AROA 5JRGB 4J8XB 2F8NK 1P3FB 3AFAB 1HQ3A 4UPKA 4WZSB 4Z5TB 1TZYC 5DNMB 3B0DB 3H0MC 3LZ1C 3REJA 5AY8B 3X1VC 5B2JC 3TU4B 2BG1A 3WTPB 3AZIA 5B0ZD 2NQBA 5B2JB 3AYWC 5FUGA 2HIOB 5AV8A 4Z66D 2BYKA 1P3PD 3AZEA 3AZFA 3R45A 4HGAC 4Z5TD 5DNMD 1S32A 3MGPD 3W98C 3MGSC 3W99D 1Z2CB 3AZND 3KWQB 5CP6D 4H9PA 5E5AC 2UWXA 2YFWB 4XUJA 3AZKC 3LZ0A 4ZBJB 4CAYB 5GT0B 5B24A 3AZJC 3EPJA 3AZEC 5C3IC 5B2IC 2NZDA 3UTBD 3X1TA 1P3PC 3KUYD 2DF4C 4QLCB 3B0CT 5CPIA 4DRAA 3RELA 3AV1B 1TZYB 5B32C 2LY8A 5AVCC 3AV1C 5F99A 3B6GA 4YS3B 5B31A 1TAFA 1F66B 1ID3B 3AV2D 1PZRA 5B2ID 3REID 4G91C 2ZY2A 5DNNC 4XZQC 3MVDB 1P3LC 2AROD 1M1AD 1BH8A 3MGQB 4J8UC 3KWQD 3W99B 3WTPE 4WNNB 5GSUD 1P3IA 3REHD 4R8PB 4X23C 3AV2C 3AZMD 1P3KA 5B40D 3WKJA 4WU8A 1KX5C 2ZM5A 4NE6A 4WU8B 1P3KB 2F8NG 1Q9CA 1P34D 1P3IB 5GXQC 3AZLA 5BO0B 4WNNA 1KX4D 4ZUXC 3KUYC 3RELD 5B1MD 4Z2MH 1KX5A 4M6BA 3VH5A 1P3OD 1BH8B 3A1IA 3MGQA 4R8PD 3X1SD 3MVDD 3VH5W 5B0YC 4AWLC 2NZDD 5CP6C 1ID3A 3KXBB 5B31B 3MGSD 2IO5B 3MGSA 4YS3A 5AV8D 2HUEC 5E5AD 3B6GB 3LELD 1P3GD 3AZKB 2HUEB 2Y2NA 1HTAA 1TZYA 3W96D 4H9QB 5B24C 3AV1A 3RELB 4J8VC 3B6GC 5AVBA 2HIOC 2Y2IA 3X1TB 2NQBC 3AZMA 1P3KD 4CAYA 5GT0A 3REJC 3TU4C 3LZ0B 3KSYA 3AZMB 1EQZC 1S32B 2AROC 3FDDA 2Y2PA 5AVBB 1AOIC 4H9QA 3AZFB 1R4VA 3AZEB 2BYKB 4XUJC 3AZKA 4NE3A 5AV6D 5AV8B 2HIOA 5FUGB 5B31D 3MGSB 3AZIC 2CV5C 3KXBA 5B0YD 3AZIB 2RVQD 3WA9C 3TU4A 4KUDC 5AY8A 1P3AC 5CPID 4JJNC 1HQ3B 3AFAA 1ZLAD 4J8VD 1KX5B 5B1LC 1KX4C 3B6GD 2Y2KA 5BO0A 1ULYA 2Y2JA 3AZLB 5B1LB 5B24D 5GSUB 4NFTA 5BNXB 3UTBB 2Y2MA 3W99C 4YS3C 5CPJC 1W2EA 1M19D 3WA9D 4KUDD 2NZDC 5GSUC 2F8ND 3WKJB 4QLCD 3X1SA 3REHC 4R8PA 3AZED 5DNNB 3EG5B 3NQUA 1AOID 5GT3D 1F1EA 4LD9D 3B6FC 2ZY4A
chains in the Genus database with same CATH topology
1P3AA 3W99A 5B33B 2L5AA 3AYWD 2CV5B 3MVDA 3V9RB 5AV5A 3AZFD 3AFAD 5AV5D 2JE5A 3AL0C 2ZY5A 3AV1D 4X23B 2VQRA 3UT9C 5B40B 3F6TA 3AZHC 1F66A 1TAFB 5AY8D 1P3AD 2FJ7C 3TU4D 2NQBD 3LZ1D 5F99B 1AOIA 3KFUG 1P3MD 1N1JA 3VH5T 5JRGD 5B2JD 2FFFB 4J8XD 3LZ0C 5CPIB 3LELB 1P3GB 4QLCA 4E45A 3KWQC 4DQYB 3UTBC 3AZGD 3LELC 1P3GC 3W98B 2NZDB 2DQNC 5CPKC 2PYOC 2F2AC 5B24B 3X1UC 4XUJB 2YFWA 3LJAB 5BS7C 5CP6B 3EPLA 4H9PB 5CPJD 3AZNC 4QLCC 3KWQA 5B1MB 4J8VA 3AZHA 1H3OB 3R45B 5BNVB 4WU9D 1ZLAC 4YM6A 1M18A 4UUZA 3B0DC 2CWEA 3AZGA 4H9OA 5B31G 5B32B 5B2JA 5JA4A 2NQBB 2FJ7D 3WTPA 3MGRC 3AZFC 3REJB 4X23D 5AV9D 3AZMC 5DNMA 4Z5TA 4Z2MG 1S32D 1EQZB 1P3FA 4KGCC 3C1CD 5JRGA 2AROB 5AVBC 4J8XA 4LD9C 2BYMB 1P3PA 3LZ0D 5G49B 3WAAC 4J8WC 1KU5A 4H9NB 4XZQD 1P3MB 2F8NH 1P3LD 1F66D 5GXQA 3REKC 3MNNA 1P34A 1U35C 3LJAC 1P3BC 1P3FC 3KUYA 4KGCA 3REKB 3B0BA 3UTAA 4H9SA 3UT9D 3AZLC 3WA9B 1TZYD 3W96A 4KUDB 1BH9B 5AV5C 5AY8C 1HQ3D 1P3OA 3WTPC 3A1KA 3MGRA 4JJNB 5B40C 5AVCD 1P3ID 2FJ7B 1KX4A 5B0YB 4AWLB 5F99C 3C1CA 2F8NA 3W96C 4J8UA 3H0RC 3B6FB 3MGQD 1KX3A 1M1AC 4YM6D 1M18D 5B33C 4EO5C 5KDMA 3WKJC 4KHAB 1P3LA 3O62C 3REHA 3X1SC 5CPKB 5BT1C 2PYOB 1P3OC 3AZJB 5C3IB 2JCHA 5AV6A 1EQZD 3NQJA 5AV9A 4Z66C 1KX3D 4CSRB 4WU8C 2XD5A 3REIA 5B2IA 1WWIA 2HIOD 1P3BD 3AYWB 2CV5D 3LZ1B 2XD1A 1ID3C 1M1AA 5AVCA 3X1UB 3X1VA 4H9RA 3MGPB 3UTAD 5DNND 5AVBD 3X1UA 3A6NA 2Y2OA 4J8UD 4KGCD 1M1AB 4Z66A 5E5AB 5AV8C 3LZ1A 5B33D 2RIQA 4HGAB 1M19C 5GT3A 5B2IB 3O62B 4H9SC 3REIB 1ID3D 4YM6C 3AV2B 1M18C 3AZNA 3AN2A 4CSRA 1U35B 4WU9B 2Y2GA 4ZBJC 3NQJB 1P3KC 1JFIB 3X1TC 1ZLAB 1P3IC 4ZUXA 5CPJB 1KX3C 3WTPD 5GXQD 3AZJD 5B1LD 3REHB 4WV4B 2W8SA 5CHLB 3UT9A 3A6ND 3X1UD 1WWSA 3C1BB 3AN2D 1M19A 3W97B 3REKD 3B6FA 3MVDC 1U35D 3MGQC 4J8UB 2F8NB 3WKJD 4J8WA 3WAAA 3C1CB 2YFVB 1P3BB 5B31C 4XZQA 5B0YA 4G91B 4LD9B 4EO5B 5B0ZB 5B0ZA 5JRGC 4J8XC 4XZQB 4LD9A 2FJ7A 2YFVA 1P3BA 4J8WB 1P3MC 3WAAB 4JJNA 1P3OB 3UTAC 1A7WA 3W97A 4WU8D 1BH9A 3C1BA 1M19B 1B67A 3WA9A 4KUDA 3REIC 3UTAB 4E44A 4NE5A 3UT9B 1P34C 1BFMA 1P34B 3AFAC 5GXQB 3VH6T 2JSSA 5CPJA 4ZUXB 4H9NA 5G49A 1JFIA 1ZLAA 5BT1D 4WU9A 5B32G 1U35A 3W97D 3AN2B 1EQZA 3AZNB 3VH6A 3AV2A 5BS7A 5GT3B 3O62A 3C1BC 3AN2C 2Y2LA 2G5HC 5GT0D 3KXBC 2J8PA 2IO5C 3IP4C 3A6NC 5E5AA 5JA4B 4Z66B 4G92C 5B1MC 5CPKD 3H0LC 5B32A 3A6NB 5DNMC 4Z5TC 4ZUXD 3AZGC 2PYOD 2ZY3A 3P5JB 3MGRD 2Y2HA 3RELC 4H9OB 3MGPA 3AZGB 4H9RB 3X1VB 4UUZB 3X1TD 4YM6B 1M18B 4JJND 1H3OA 5AVCB 5BNVA 3AZHB 2G5IC 4WU9C 3AYWA 4J8VB 1KX5D 5B1MA 1F66C 4DRBA 5CP6A 3LJAA 3LJAD 4J8WD 3WAAD 3AZID 3W98A 5AV9B 5AV6C 3W98D 1P3FD 3MNND 5AV6B 5AV9C 3B0CW 3MGPC 3LELA 1P3GA 3W97C 3AZJA 1N1JB 1S32C 5CPKA 2PYOA 5GT3C 3C1CC 1AOIB 1P3LB 4KHAA 5KDMB 3REJD 5B0ZC 3VH6W 4G92B 4WJ3C 3X1VD 1KX3B 5B40A 4X23A 3EPHA 5AV5B 3V9RA 5B32D 2CV5A 3AZHD 1KX4B 2Y2QA 5B33A 1P3AB 3AZLD 1T3UA 1HQ3C 3O62D 3MGRB 3NQUB 5CPIC 5DNNA 3W96B 3AZKD 3X1SB 2RVQC 3REKA 3B6FD 3KUYB 4KGCB 3EPKA 3C1BD 3MNNB 5GT0C 3KXBD 3UTBA 5BNXA 5GSUA 5F99D 3MNNC 1P3MA 5B1LA 4R8PC 4YS3D 1B6WA 2BYMA 4XUJD 1P3PB 2AROA 5JRGB 4J8XB 2F8NK 1P3FB 3AFAB 1HQ3A 4UPKA 4WZSB 4Z5TB 1TZYC 5DNMB 3B0DB 3H0MC 3LZ1C 3REJA 5AY8B 3X1VC 5B2JC 3TU4B 2BG1A 3WTPB 3AZIA 5B0ZD 2NQBA 5B2JB 3AYWC 5FUGA 2HIOB 5AV8A 4Z66D 2BYKA 1P3PD 3AZEA 3AZFA 3R45A 4HGAC 4Z5TD 5DNMD 1S32A 3MGPD 3W98C 3MGSC 3W99D 1Z2CB 3AZND 3KWQB 5CP6D 4H9PA 5E5AC 2UWXA 2YFWB 4XUJA 3AZKC 3LZ0A 4ZBJB 4CAYB 5GT0B 5B24A 3AZJC 3EPJA 3AZEC 5C3IC 5B2IC 2NZDA 3UTBD 3X1TA 1P3PC 3KUYD 2DF4C 4QLCB 3B0CT 5CPIA 4DRAA 3RELA 3AV1B 1TZYB 5B32C 2LY8A 5AVCC 3AV1C 5F99A 3B6GA 4YS3B 5B31A 1TAFA 1F66B 1ID3B 3AV2D 1PZRA 5B2ID 3REID 4G91C 2ZY2A 5DNNC 4XZQC 3MVDB 1P3LC 2AROD 1M1AD 1BH8A 3MGQB 4J8UC 3KWQD 3W99B 3WTPE 4WNNB 5GSUD 1P3IA 3REHD 4R8PB 4X23C 3AV2C 3AZMD 1P3KA 5B40D 3WKJA 4WU8A 1KX5C 2ZM5A 4NE6A 4WU8B 1P3KB 2F8NG 1Q9CA 1P34D 1P3IB 5GXQC 3AZLA 5BO0B 4WNNA 1KX4D 4ZUXC 3KUYC 3RELD 5B1MD 4Z2MH 1KX5A 4M6BA 3VH5A 1P3OD 1BH8B 3A1IA 3MGQA 4R8PD 3X1SD 3MVDD 3VH5W 5B0YC 4AWLC 2NZDD 5CP6C 1ID3A 3KXBB 5B31B 3MGSD 2IO5B 3MGSA 4YS3A 5AV8D 2HUEC 5E5AD 3B6GB 3LELD 1P3GD 3AZKB 2HUEB 2Y2NA 1HTAA 1TZYA 3W96D 4H9QB 5B24C 3AV1A 3RELB 4J8VC 3B6GC 5AVBA 2HIOC 2Y2IA 3X1TB 2NQBC 3AZMA 1P3KD 4CAYA 5GT0A 3REJC 3TU4C 3LZ0B 3KSYA 3AZMB 1EQZC 1S32B 2AROC 3FDDA 2Y2PA 5AVBB 1AOIC 4H9QA 3AZFB 1R4VA 3AZEB 2BYKB 4XUJC 3AZKA 4NE3A 5AV6D 5AV8B 2HIOA 5FUGB 5B31D 3MGSB 3AZIC 2CV5C 3KXBA 5B0YD 3AZIB 2RVQD 3WA9C 3TU4A 4KUDC 5AY8A 1P3AC 5CPID 4JJNC 1HQ3B 3AFAA 1ZLAD 4J8VD 1KX5B 5B1LC 1KX4C 3B6GD 2Y2KA 5BO0A 1ULYA 2Y2JA 3AZLB 5B1LB 5B24D 5GSUB 4NFTA 5BNXB 3UTBB 2Y2MA 3W99C 4YS3C 5CPJC 1W2EA 1M19D 3WA9D 4KUDD 2NZDC 5GSUC 2F8ND 3WKJB 4QLCD 3X1SA 3REHC 4R8PA 3AZED 5DNNB 3EG5B 3NQUA 1AOID 5GT3D 1F1EA 4LD9D 3B6FC 2ZY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A A;  3W99 A;  5B33 B;  2L5A A;  3AYW D;  2CV5 B;  3MVD A;  3V9R B;  5AV5 A;  3AZF D;  3AFA D;  5AV5 D;  3AV1 D;  4X23 B;  3UT9 C;  5B40 B;  3AZH C;  1F66 A;  1TAF B;  5AY8 D;  1P3A D;  2FJ7 C;  3TU4 D;  2NQB D;  3LZ1 D;  5F99 B;  1AOI A;  1P3M D;  1N1J A;  3VH5 T;  5JRG D;  5B2J D;  4J8X D;  3LZ0 C;  5CPI B;  3LEL B;  1P3G B;  4QLC A;  4E45 A;  3KWQ C;  3UTB C;  3AZG D;  3LEL C;  1P3G C;  3W98 B;  2NZD B;  5CPK C;  2PYO C;  5B24 B;  3X1U C;  4XUJ B;  2YFW A;  3LJA B;  5BS7 C;  5CP6 B;  3AZN C;  4H9P B;  5CPJ D;  4QLC C;  3KWQ A;  5B1M B;  4J8V A;  3AZH A;  1H3O B;  3R45 B;  5BNV B;  4WU9 D;  1ZLA C;  4YM6 A;  1M18 A;  4UUZ A;  3B0D C;  2CWE A;  3AZG A;  4H9O A;  5B31 G;  5B32 B;  5B2J A;  5JA4 A;  2NQB B;  2FJ7 D;  3WTP A;  3MGR C;  3AZF C;  3REJ B;  4X23 D;  5AV9 D;  3AZM C;  5DNM A;  4Z5T A;  4Z2M G;  1S32 D;  1EQZ B;  1P3F A;  4KGC C;  3C1C D;  5JRG A;  2ARO B;  5AVB C;  4J8X A;  4LD9 C;  2BYM B;  1P3P A;  3LZ0 D;  5G49 B;  3WAA C;  4J8W C;  1KU5 A;  4H9N B;  4XZQ D;  1P3M B;  2F8N H;  1P3L D;  1F66 D;  5GXQ A;  3REK C;  3MNN A;  1P34 A;  1U35 C;  3LJA C;  1P3B C;  1P3F C;  3KUY A;  4KGC A;  3REK B;  3B0B A;  3UTA A;  4H9S A;  3UT9 D;  3AZL C;  3WA9 B;  1TZY D;  3W96 A;  4KUD B;  1BH9 B;  5AV5 C;  5AY8 C;  1HQ3 D;  1P3O A;  3WTP C;  3MGR A;  4JJN B;  5B40 C;  5AVC D;  1P3I D;  2FJ7 B;  1KX4 A;  5B0Y B;  4AWL B;  5F99 C;  3C1C A;  2F8N A;  3W96 C;  4J8U A;  3B6F B;  3MGQ D;  1KX3 A;  1M1A C;  4YM6 D;  1M18 D;  5B33 C;  4EO5 C;  5KDM A;  3WKJ C;  4KHA B;  1P3L A;  3O62 C;  3REH A;  3X1S C;  5CPK B;  5BT1 C;  2PYO B;  1P3O C;  3AZJ B;  5C3I B;  5AV6 A;  1EQZ D;  3NQJ A;  5AV9 A;  4Z66 C;  1KX3 D;  4CSR B;  4WU8 C;  3REI A;  5B2I A;  1WWI A;  2HIO D;  1P3B D;  3AYW B;  2CV5 D;  3LZ1 B;  1ID3 C;  1M1A A;  5AVC A;  3X1U B;  3X1V A;  4H9R A;  3MGP B;  3UTA D;  5DNN D;  5AVB D;  3X1U A;  3A6N A;  4KGC D;  4J8U D;  1M1A B;  4Z66 A;  5E5A B;  5AV8 C;  3LZ1 A;  5B33 D;  4HGA B;  1M19 C;  5GT3 A;  5B2I B;  3O62 B;  4H9S C;  3REI B;  1ID3 D;  4YM6 C;  3AV2 B;  1M18 C;  3AZN A;  3AN2 A;  4CSR A;  1U35 B;  4WU9 B;  4ZBJ C;  3NQJ B;  1P3K C;  1JFI B;  3X1T C;  1ZLA B;  1P3I C;  4ZUX A;  5CPJ B;  1KX3 C;  3WTP D;  5GXQ D;  3AZJ D;  5B1L D;  3REH B;  4WV4 B;  5CHL B;  3UT9 A;  3A6N D;  3X1U D;  1WWS A;  3C1B B;  3AN2 D;  1M19 A;  3W97 B;  3REK D;  3B6F A;  3MVD C;  1U35 D;  3MGQ C;  4J8U B;  2F8N B;  3WKJ D;  4J8W A;  3WAA A;  3C1C B;  2YFV B;  1P3B B;  5B31 C;  4XZQ A;  4G91 B;  5B0Y A;  4LD9 B;  4EO5 B;  5B0Z B;  5B0Z A;  5JRG C;  4J8X C;  4XZQ B;  4LD9 A;  2FJ7 A;  2YFV A;  1P3B A;  4J8W B;  1P3M C;  3WAA B;  4JJN A;  1P3O B;  3UTA C;  1A7W A;  3W97 A;  4WU8 D;  1BH9 A;  3C1B A;  1M19 B;  1B67 A;  3WA9 A;  4KUD A;  3REI C;  3UTA B;  4E44 A;  4NE5 A;  3UT9 B;  1P34 C;  1BFM A;  1P34 B;  3AFA C;  5GXQ B;  3VH6 T;  2JSS A;  5CPJ A;  4ZUX B;  4H9N A;  5G49 A;  1JFI A;  1ZLA A;  5BT1 D;  4WU9 A;  5B32 G;  1U35 A;  3W97 D;  3AN2 B;  1EQZ A;  3AZN B;  3VH6 A;  3AV2 A;  5BS7 A;  5GT3 B;  3O62 A;  3C1B C;  3AN2 C;  5GT0 D;  3KXB C;  2IO5 C;  3A6N C;  5E5A A;  5JA4 B;  4Z66 B;  4G92 C;  5B1M C;  5CPK D;  5B32 A;  3A6N B;  3AZG C;  4Z5T C;  5DNM C;  4ZUX D;  2PYO D;  3MGR D;  3REL C;  4H9O B;  3MGP A;  3AZG B;  4H9R B;  3X1V B;  4UUZ B;  3X1T D;  4YM6 B;  1M18 B;  4JJN D;  1H3O A;  5AVC B;  5BNV A;  3AZH B;  4WU9 C;  3AYW A;  4J8V B;  1KX5 D;  5B1M A;  1F66 C;  4DRB A;  5CP6 A;  3LJA A;  3LJA D;  4J8W D;  3WAA D;  3AZI D;  3W98 A;  5AV9 B;  5AV6 C;  3W98 D;  1P3F D;  3MNN D;  5AV6 B;  5AV9 C;  3B0C W;  3MGP C;  3LEL A;  1P3G A;  3W97 C;  3AZJ A;  1N1J B;  1S32 C;  5CPK A;  2PYO A;  5GT3 C;  3C1C C;  1AOI B;  1P3L B;  4KHA A;  5KDM B;  3REJ D;  5B0Z C;  3VH6 W;  4G92 B;  3X1V D;  1KX3 B;  5B40 A;  4X23 A;  5AV5 B;  3V9R A;  5B32 D;  2CV5 A;  3AZH D;  1KX4 B;  5B33 A;  1P3A B;  3AZL D;  1HQ3 C;  3O62 D;  3MGR B;  3NQU B;  5CPI C;  5DNN A;  3W96 B;  3AZK D;  3X1S B;  2RVQ C;  3REK A;  3B6F D;  3KUY B;  4KGC B;  3C1B D;  3MNN B;  5GT0 C;  3KXB D;  3UTB A;  5BNX A;  5GSU A;  5F99 D;  3MNN C;  1P3M A;  5B1L A;  4R8P C;  4YS3 D;  1B6W A;  2BYM A;  4XUJ D;  1P3P B;  2ARO A;  5JRG B;  4J8X B;  2F8N K;  1P3F B;  3AFA B;  1HQ3 A;  4WZS B;  4Z5T B;  1TZY C;  5DNM B;  3B0D B;  3LZ1 C;  3REJ A;  5AY8 B;  3X1V C;  5B2J C;  3TU4 B;  3WTP B;  3AZI A;  5B0Z D;  2NQB A;  5B2J B;  3AYW C;  5FUG A;  2HIO B;  5AV8 A;  4Z66 D;  2BYK A;  1P3P D;  3AZE A;  3AZF A;  3R45 A;  4HGA C;  4Z5T D;  5DNM D;  1S32 A;  3MGP D;  3W98 C;  3MGS C;  3W99 D;  3AZN D;  3KWQ B;  5CP6 D;  4H9P A;  5E5A C;  2YFW B;  4XUJ A;  3AZK C;  3LZ0 A;  4ZBJ B;  4CAY B;  5GT0 B;  5B24 A;  3AZJ C;  3AZE C;  5C3I C;  5B2I C;  2NZD A;  3UTB D;  3X1T A;  1P3P C;  3KUY D;  4QLC B;  3B0C T;  5CPI A;  4DRA A;  3REL A;  3AV1 B;  1TZY B;  5B32 C;  2LY8 A;  5AVC C;  3AV1 C;  5F99 A;  3B6G A;  4YS3 B;  5B31 A;  1TAF A;  1F66 B;  1ID3 B;  3AV2 D;  5B2I D;  3REI D;  4G91 C;  5DNN C;  4XZQ C;  3MVD B;  1P3L C;  2ARO D;  1M1A D;  1BH8 A;  3MGQ B;  4J8U C;  3KWQ D;  3W99 B;  3WTP E;  4WNN B;  5GSU D;  1P3I A;  3REH D;  4R8P B;  4X23 C;  3AV2 C;  3AZM D;  1P3K A;  5B40 D;  3WKJ A;  4WU8 A;  1KX5 C;  4NE6 A;  4WU8 B;  1P3K B;  2F8N G;  1Q9C A;  1P34 D;  1P3I B;  5GXQ C;  3AZL A;  5BO0 B;  4WNN A;  1KX4 D;  4ZUX C;  3KUY C;  3REL D;  5B1M D;  4Z2M H;  1KX5 A;  4M6B A;  3VH5 A;  1P3O D;  1BH8 B;  3MGQ A;  4R8P D;  3X1S D;  3MVD D;  3VH5 W;  5B0Y C;  4AWL C;  2NZD D;  5CP6 C;  1ID3 A;  3KXB B;  5B31 B;  3MGS D;  2IO5 B;  3MGS A;  4YS3 A;  5AV8 D;  2HUE C;  5E5A D;  3B6G B;  3LEL D;  1P3G D;  3AZK B;  2HUE B;  1HTA A;  1TZY A;  3W96 D;  4H9Q B;  5B24 C;  3AV1 A;  3REL B;  4J8V C;  3B6G C;  5AVB A;  2HIO C;  3X1T B;  2NQB C;  3AZM A;  1P3K D;  4CAY A;  5GT0 A;  3REJ C;  3TU4 C;  3LZ0 B;  3KSY A;  3AZM B;  1EQZ C;  1S32 B;  2ARO C;  5AVB B;  1AOI C;  4H9Q A;  3AZF B;  1R4V A;  3AZE B;  2BYK B;  4XUJ C;  3AZK A;  4NE3 A;  5AV6 D;  5AV8 B;  2HIO A;  5FUG B;  5B31 D;  3MGS B;  3AZI C;  2CV5 C;  3KXB A;  5B0Y D;  3AZI B;  2RVQ D;  3WA9 C;  3TU4 A;  4KUD C;  5AY8 A;  1P3A C;  5CPI D;  4JJN C;  1HQ3 B;  3AFA A;  1ZLA D;  4J8V D;  1KX5 B;  5B1L C;  1KX4 C;  3B6G D;  5BO0 A;  1ULY A;  3AZL B;  5B1L B;  5B24 D;  4NFT A;  5BNX B;  5GSU B;  3UTB B;  3W99 C;  4YS3 C;  5CPJ C;  1M19 D;  3WA9 D;  4KUD D;  2NZD C;  5GSU C;  2F8N D;  3WKJ B;  4QLC D;  3X1S A;  3REH C;  4R8P A;  3AZE D;  5DNN B;  3NQU A;  1AOI D;  5GT3 D;  1F1E A;  4LD9 D;  3B6F C; 
#chains in the Genus database with same CATH topology
 1P3A A;  3W99 A;  5B33 B;  2L5A A;  3AYW D;  2CV5 B;  3MVD A;  3V9R B;  5AV5 A;  3AZF D;  3AFA D;  5AV5 D;  2JE5 A;  3AL0 C;  2ZY5 A;  3AV1 D;  4X23 B;  2VQR A;  3UT9 C;  5B40 B;  3F6T A;  3AZH C;  1F66 A;  1TAF B;  5AY8 D;  1P3A D;  2FJ7 C;  3TU4 D;  2NQB D;  3LZ1 D;  5F99 B;  1AOI A;  3KFU G;  1P3M D;  1N1J A;  3VH5 T;  5JRG D;  5B2J D;  2FFF B;  4J8X D;  3LZ0 C;  5CPI B;  3LEL B;  1P3G B;  4QLC A;  4E45 A;  3KWQ C;  4DQY B;  3UTB C;  3AZG D;  3LEL C;  1P3G C;  3W98 B;  2NZD B;  2DQN C;  5CPK C;  2PYO C;  2F2A C;  5B24 B;  3X1U C;  4XUJ B;  2YFW A;  3LJA B;  5BS7 C;  5CP6 B;  3EPL A;  4H9P B;  5CPJ D;  3AZN C;  4QLC C;  3KWQ A;  5B1M B;  4J8V A;  3AZH A;  1H3O B;  3R45 B;  5BNV B;  4WU9 D;  1ZLA C;  4YM6 A;  1M18 A;  4UUZ A;  3B0D C;  2CWE A;  3AZG A;  4H9O A;  5B31 G;  5B32 B;  5B2J A;  5JA4 A;  2NQB B;  2FJ7 D;  3WTP A;  3MGR C;  3AZF C;  3REJ B;  4X23 D;  5AV9 D;  3AZM C;  5DNM A;  4Z5T A;  4Z2M G;  1S32 D;  1EQZ B;  1P3F A;  4KGC C;  3C1C D;  5JRG A;  2ARO B;  5AVB C;  4J8X A;  4LD9 C;  2BYM B;  1P3P A;  3LZ0 D;  5G49 B;  3WAA C;  4J8W C;  1KU5 A;  4H9N B;  4XZQ D;  1P3M B;  2F8N H;  1P3L D;  1F66 D;  5GXQ A;  3REK C;  3MNN A;  1P34 A;  1U35 C;  3LJA C;  1P3B C;  1P3F C;  3KUY A;  4KGC A;  3REK B;  3B0B A;  3UTA A;  4H9S A;  3UT9 D;  3AZL C;  3WA9 B;  1TZY D;  3W96 A;  4KUD B;  1BH9 B;  5AV5 C;  5AY8 C;  1HQ3 D;  1P3O A;  3WTP C;  3A1K A;  3MGR A;  4JJN B;  5B40 C;  5AVC D;  1P3I D;  2FJ7 B;  1KX4 A;  5B0Y B;  4AWL B;  5F99 C;  3C1C A;  2F8N A;  3W96 C;  4J8U A;  3H0R C;  3B6F B;  3MGQ D;  1KX3 A;  1M1A C;  4YM6 D;  1M18 D;  5B33 C;  4EO5 C;  5KDM A;  3WKJ C;  4KHA B;  1P3L A;  3O62 C;  3REH A;  3X1S C;  5CPK B;  5BT1 C;  2PYO B;  1P3O C;  3AZJ B;  5C3I B;  2JCH A;  5AV6 A;  1EQZ D;  3NQJ A;  5AV9 A;  4Z66 C;  1KX3 D;  4CSR B;  4WU8 C;  2XD5 A;  3REI A;  5B2I A;  1WWI A;  2HIO D;  1P3B D;  3AYW B;  2CV5 D;  3LZ1 B;  2XD1 A;  1ID3 C;  1M1A A;  5AVC A;  3X1U B;  3X1V A;  4H9R A;  3MGP B;  3UTA D;  5DNN D;  5AVB D;  3X1U A;  3A6N A;  2Y2O A;  4J8U D;  4KGC D;  1M1A B;  4Z66 A;  5E5A B;  5AV8 C;  3LZ1 A;  5B33 D;  2RIQ A;  4HGA B;  1M19 C;  5GT3 A;  5B2I B;  3O62 B;  4H9S C;  3REI B;  1ID3 D;  4YM6 C;  3AV2 B;  1M18 C;  3AZN A;  3AN2 A;  4CSR A;  1U35 B;  4WU9 B;  2Y2G A;  4ZBJ C;  3NQJ B;  1P3K C;  1JFI B;  3X1T C;  1ZLA B;  1P3I C;  4ZUX A;  5CPJ B;  1KX3 C;  3WTP D;  5GXQ D;  3AZJ D;  5B1L D;  3REH B;  4WV4 B;  2W8S A;  5CHL B;  3UT9 A;  3A6N D;  3X1U D;  1WWS A;  3C1B B;  3AN2 D;  1M19 A;  3W97 B;  3REK D;  3B6F A;  3MVD C;  1U35 D;  3MGQ C;  4J8U B;  2F8N B;  3WKJ D;  4J8W A;  3WAA A;  3C1C B;  2YFV B;  1P3B B;  5B31 C;  4XZQ A;  5B0Y A;  4G91 B;  4LD9 B;  4EO5 B;  5B0Z B;  5B0Z A;  5JRG C;  4J8X C;  4XZQ B;  4LD9 A;  2FJ7 A;  2YFV A;  1P3B A;  4J8W B;  1P3M C;  3WAA B;  4JJN A;  1P3O B;  3UTA C;  1A7W A;  3W97 A;  4WU8 D;  1BH9 A;  3C1B A;  1M19 B;  1B67 A;  3WA9 A;  4KUD A;  3REI C;  3UTA B;  4E44 A;  4NE5 A;  3UT9 B;  1P34 C;  1BFM A;  1P34 B;  3AFA C;  5GXQ B;  3VH6 T;  2JSS A;  5CPJ A;  4ZUX B;  4H9N A;  5G49 A;  1JFI A;  1ZLA A;  5BT1 D;  4WU9 A;  5B32 G;  1U35 A;  3W97 D;  3AN2 B;  1EQZ A;  3AZN B;  3VH6 A;  3AV2 A;  5BS7 A;  5GT3 B;  3O62 A;  3C1B C;  3AN2 C;  2Y2L A;  2G5H C;  5GT0 D;  3KXB C;  2J8P A;  2IO5 C;  3IP4 C;  3A6N C;  5E5A A;  5JA4 B;  4Z66 B;  4G92 C;  5B1M C;  5CPK D;  3H0L C;  5B32 A;  3A6N B;  5DNM C;  4Z5T C;  4ZUX D;  3AZG C;  2PYO D;  2ZY3 A;  3P5J B;  3MGR D;  2Y2H A;  3REL C;  4H9O B;  3MGP A;  3AZG B;  4H9R B;  3X1V B;  4UUZ B;  3X1T D;  4YM6 B;  1M18 B;  4JJN D;  1H3O A;  5AVC B;  5BNV A;  3AZH B;  2G5I C;  4WU9 C;  3AYW A;  4J8V B;  1KX5 D;  5B1M A;  1F66 C;  4DRB A;  5CP6 A;  3LJA A;  3LJA D;  4J8W D;  3WAA D;  3AZI D;  3W98 A;  5AV9 B;  5AV6 C;  3W98 D;  1P3F D;  3MNN D;  5AV6 B;  5AV9 C;  3B0C W;  3MGP C;  3LEL A;  1P3G A;  3W97 C;  3AZJ A;  1N1J B;  1S32 C;  5CPK A;  2PYO A;  5GT3 C;  3C1C C;  1AOI B;  1P3L B;  4KHA A;  5KDM B;  3REJ D;  5B0Z C;  3VH6 W;  4G92 B;  4WJ3 C;  3X1V D;  1KX3 B;  5B40 A;  4X23 A;  3EPH A;  5AV5 B;  3V9R A;  5B32 D;  2CV5 A;  3AZH D;  1KX4 B;  2Y2Q A;  5B33 A;  1P3A B;  3AZL D;  1T3U A;  1HQ3 C;  3O62 D;  3MGR B;  3NQU B;  5CPI C;  5DNN A;  3W96 B;  3AZK D;  3X1S B;  2RVQ C;  3REK A;  3B6F D;  3KUY B;  4KGC B;  3EPK A;  3C1B D;  3MNN B;  5GT0 C;  3KXB D;  3UTB A;  5BNX A;  5GSU A;  5F99 D;  3MNN C;  1P3M A;  5B1L A;  4R8P C;  4YS3 D;  1B6W A;  2BYM A;  4XUJ D;  1P3P B;  2ARO A;  5JRG B;  4J8X B;  2F8N K;  1P3F B;  3AFA B;  1HQ3 A;  4UPK A;  4WZS B;  4Z5T B;  1TZY C;  5DNM B;  3B0D B;  3H0M C;  3LZ1 C;  3REJ A;  5AY8 B;  3X1V C;  5B2J C;  3TU4 B;  2BG1 A;  3WTP B;  3AZI A;  5B0Z D;  2NQB A;  5B2J B;  3AYW C;  5FUG A;  2HIO B;  5AV8 A;  4Z66 D;  2BYK A;  1P3P D;  3AZE A;  3AZF A;  3R45 A;  4HGA C;  4Z5T D;  5DNM D;  1S32 A;  3MGP D;  3W98 C;  3MGS C;  3W99 D;  1Z2C B;  3AZN D;  3KWQ B;  5CP6 D;  4H9P A;  5E5A C;  2UWX A;  2YFW B;  4XUJ A;  3AZK C;  3LZ0 A;  4ZBJ B;  4CAY B;  5GT0 B;  5B24 A;  3AZJ C;  3EPJ A;  3AZE C;  5C3I C;  5B2I C;  2NZD A;  3UTB D;  3X1T A;  1P3P C;  3KUY D;  2DF4 C;  4QLC B;  3B0C T;  5CPI A;  4DRA A;  3REL A;  3AV1 B;  1TZY B;  5B32 C;  2LY8 A;  5AVC C;  3AV1 C;  5F99 A;  3B6G A;  4YS3 B;  5B31 A;  1TAF A;  1F66 B;  1ID3 B;  3AV2 D;  1PZR A;  5B2I D;  3REI D;  4G91 C;  2ZY2 A;  5DNN C;  4XZQ C;  3MVD B;  1P3L C;  2ARO D;  1M1A D;  1BH8 A;  3MGQ B;  4J8U C;  3KWQ D;  3W99 B;  3WTP E;  4WNN B;  5GSU D;  1P3I A;  3REH D;  4R8P B;  4X23 C;  3AV2 C;  3AZM D;  1P3K A;  5B40 D;  3WKJ A;  4WU8 A;  1KX5 C;  2ZM5 A;  4NE6 A;  4WU8 B;  1P3K B;  2F8N G;  1Q9C A;  1P34 D;  1P3I B;  5GXQ C;  3AZL A;  5BO0 B;  4WNN A;  1KX4 D;  4ZUX C;  3KUY C;  3REL D;  5B1M D;  4Z2M H;  1KX5 A;  4M6B A;  3VH5 A;  1P3O D;  1BH8 B;  3A1I A;  3MGQ A;  4R8P D;  3X1S D;  3MVD D;  3VH5 W;  5B0Y C;  4AWL C;  2NZD D;  5CP6 C;  1ID3 A;  3KXB B;  5B31 B;  3MGS D;  2IO5 B;  3MGS A;  4YS3 A;  5AV8 D;  2HUE C;  5E5A D;  3B6G B;  3LEL D;  1P3G D;  3AZK B;  2HUE B;  2Y2N A;  1HTA A;  1TZY A;  3W96 D;  4H9Q B;  5B24 C;  3AV1 A;  3REL B;  4J8V C;  3B6G C;  5AVB A;  2HIO C;  2Y2I A;  3X1T B;  2NQB C;  3AZM A;  1P3K D;  4CAY A;  5GT0 A;  3REJ C;  3TU4 C;  3LZ0 B;  3KSY A;  3AZM B;  1EQZ C;  1S32 B;  2ARO C;  3FDD A;  2Y2P A;  5AVB B;  1AOI C;  4H9Q A;  3AZF B;  1R4V A;  3AZE B;  2BYK B;  4XUJ C;  3AZK A;  4NE3 A;  5AV6 D;  5AV8 B;  2HIO A;  5FUG B;  5B31 D;  3MGS B;  3AZI C;  2CV5 C;  3KXB A;  5B0Y D;  3AZI B;  2RVQ D;  3WA9 C;  3TU4 A;  4KUD C;  5AY8 A;  1P3A C;  5CPI D;  4JJN C;  1HQ3 B;  3AFA A;  1ZLA D;  4J8V D;  1KX5 B;  5B1L C;  1KX4 C;  3B6G D;  2Y2K A;  5BO0 A;  1ULY A;  2Y2J A;  3AZL B;  5B1L B;  5B24 D;  5GSU B;  4NFT A;  5BNX B;  3UTB B;  2Y2M A;  3W99 C;  4YS3 C;  5CPJ C;  1W2E A;  1M19 D;  3WA9 D;  4KUD D;  2NZD C;  5GSU C;  2F8N D;  3WKJ B;  4QLC D;  3X1S A;  3REH C;  4R8P A;  3AZE D;  5DNN B;  3EG5 B;  3NQU A;  1AOI D;  5GT3 D;  1F1E A;  4LD9 D;  3B6F C;  2ZY4 A; 
#chains in the Genus database with same CATH homology
 1P3A A;  3W99 A;  5B33 B;  2L5A A;  3AYW D;  2CV5 B;  3MVD A;  3V9R B;  5AV5 A;  3AZF D;  3AFA D;  5AV5 D;  2JE5 A;  3AL0 C;  2ZY5 A;  3AV1 D;  4X23 B;  2VQR A;  3UT9 C;  5B40 B;  3F6T A;  3AZH C;  1F66 A;  1TAF B;  5AY8 D;  1P3A D;  2FJ7 C;  3TU4 D;  2NQB D;  3LZ1 D;  5F99 B;  1AOI A;  3KFU G;  1P3M D;  1N1J A;  3VH5 T;  5JRG D;  5B2J D;  2FFF B;  4J8X D;  3LZ0 C;  5CPI B;  3LEL B;  1P3G B;  4QLC A;  4E45 A;  3KWQ C;  4DQY B;  3UTB C;  3AZG D;  3LEL C;  1P3G C;  3W98 B;  2NZD B;  2DQN C;  5CPK C;  2PYO C;  2F2A C;  5B24 B;  3X1U C;  4XUJ B;  2YFW A;  3LJA B;  5BS7 C;  5CP6 B;  3EPL A;  4H9P B;  5CPJ D;  3AZN C;  4QLC C;  3KWQ A;  5B1M B;  4J8V A;  3AZH A;  1H3O B;  3R45 B;  5BNV B;  4WU9 D;  1ZLA C;  4YM6 A;  1M18 A;  4UUZ A;  3B0D C;  2CWE A;  3AZG A;  4H9O A;  5B31 G;  5B32 B;  5B2J A;  5JA4 A;  2NQB B;  2FJ7 D;  3WTP A;  3MGR C;  3AZF C;  3REJ B;  4X23 D;  5AV9 D;  3AZM C;  5DNM A;  4Z5T A;  4Z2M G;  1S32 D;  1EQZ B;  1P3F A;  4KGC C;  3C1C D;  5JRG A;  2ARO B;  5AVB C;  4J8X A;  4LD9 C;  2BYM B;  1P3P A;  3LZ0 D;  5G49 B;  3WAA C;  4J8W C;  1KU5 A;  4H9N B;  4XZQ D;  1P3M B;  2F8N H;  1P3L D;  1F66 D;  5GXQ A;  3REK C;  3MNN A;  1P34 A;  1U35 C;  3LJA C;  1P3B C;  1P3F C;  3KUY A;  4KGC A;  3REK B;  3B0B A;  3UTA A;  4H9S A;  3UT9 D;  3AZL C;  3WA9 B;  1TZY D;  3W96 A;  4KUD B;  1BH9 B;  5AV5 C;  5AY8 C;  1HQ3 D;  1P3O A;  3WTP C;  3A1K A;  3MGR A;  4JJN B;  5B40 C;  5AVC D;  1P3I D;  2FJ7 B;  1KX4 A;  5B0Y B;  4AWL B;  5F99 C;  3C1C A;  2F8N A;  3W96 C;  4J8U A;  3H0R C;  3B6F B;  3MGQ D;  1KX3 A;  1M1A C;  4YM6 D;  1M18 D;  5B33 C;  4EO5 C;  5KDM A;  3WKJ C;  4KHA B;  1P3L A;  3O62 C;  3REH A;  3X1S C;  5CPK B;  5BT1 C;  2PYO B;  1P3O C;  3AZJ B;  5C3I B;  2JCH A;  5AV6 A;  1EQZ D;  3NQJ A;  5AV9 A;  4Z66 C;  1KX3 D;  4CSR B;  4WU8 C;  2XD5 A;  3REI A;  5B2I A;  1WWI A;  2HIO D;  1P3B D;  3AYW B;  2CV5 D;  3LZ1 B;  2XD1 A;  1ID3 C;  1M1A A;  5AVC A;  3X1U B;  3X1V A;  4H9R A;  3MGP B;  3UTA D;  5DNN D;  5AVB D;  3X1U A;  3A6N A;  2Y2O A;  4J8U D;  4KGC D;  1M1A B;  4Z66 A;  5E5A B;  5AV8 C;  3LZ1 A;  5B33 D;  2RIQ A;  4HGA B;  1M19 C;  5GT3 A;  5B2I B;  3O62 B;  4H9S C;  3REI B;  1ID3 D;  4YM6 C;  3AV2 B;  1M18 C;  3AZN A;  3AN2 A;  4CSR A;  1U35 B;  4WU9 B;  2Y2G A;  4ZBJ C;  3NQJ B;  1P3K C;  1JFI B;  3X1T C;  1ZLA B;  1P3I C;  4ZUX A;  5CPJ B;  1KX3 C;  3WTP D;  5GXQ D;  3AZJ D;  5B1L D;  3REH B;  4WV4 B;  2W8S A;  5CHL B;  3UT9 A;  3A6N D;  3X1U D;  1WWS A;  3C1B B;  3AN2 D;  1M19 A;  3W97 B;  3REK D;  3B6F A;  3MVD C;  1U35 D;  3MGQ C;  4J8U B;  2F8N B;  3WKJ D;  4J8W A;  3WAA A;  3C1C B;  2YFV B;  1P3B B;  5B31 C;  4XZQ A;  5B0Y A;  4G91 B;  4LD9 B;  4EO5 B;  5B0Z B;  5B0Z A;  5JRG C;  4J8X C;  4XZQ B;  4LD9 A;  2FJ7 A;  2YFV A;  1P3B A;  4J8W B;  1P3M C;  3WAA B;  4JJN A;  1P3O B;  3UTA C;  1A7W A;  3W97 A;  4WU8 D;  1BH9 A;  3C1B A;  1M19 B;  1B67 A;  3WA9 A;  4KUD A;  3REI C;  3UTA B;  4E44 A;  4NE5 A;  3UT9 B;  1P34 C;  1BFM A;  1P34 B;  3AFA C;  5GXQ B;  3VH6 T;  2JSS A;  5CPJ A;  4ZUX B;  4H9N A;  5G49 A;  1JFI A;  1ZLA A;  5BT1 D;  4WU9 A;  5B32 G;  1U35 A;  3W97 D;  3AN2 B;  1EQZ A;  3AZN B;  3VH6 A;  3AV2 A;  5BS7 A;  5GT3 B;  3O62 A;  3C1B C;  3AN2 C;  2Y2L A;  2G5H C;  5GT0 D;  3KXB C;  2J8P A;  2IO5 C;  3IP4 C;  3A6N C;  5E5A A;  5JA4 B;  4Z66 B;  4G92 C;  5B1M C;  5CPK D;  3H0L C;  5B32 A;  3A6N B;  5DNM C;  4Z5T C;  4ZUX D;  3AZG C;  2PYO D;  2ZY3 A;  3P5J B;  3MGR D;  2Y2H A;  3REL C;  4H9O B;  3MGP A;  3AZG B;  4H9R B;  3X1V B;  4UUZ B;  3X1T D;  4YM6 B;  1M18 B;  4JJN D;  1H3O A;  5AVC B;  5BNV A;  3AZH B;  2G5I C;  4WU9 C;  3AYW A;  4J8V B;  1KX5 D;  5B1M A;  1F66 C;  4DRB A;  5CP6 A;  3LJA A;  3LJA D;  4J8W D;  3WAA D;  3AZI D;  3W98 A;  5AV9 B;  5AV6 C;  3W98 D;  1P3F D;  3MNN D;  5AV6 B;  5AV9 C;  3B0C W;  3MGP C;  3LEL A;  1P3G A;  3W97 C;  3AZJ A;  1N1J B;  1S32 C;  5CPK A;  2PYO A;  5GT3 C;  3C1C C;  1AOI B;  1P3L B;  4KHA A;  5KDM B;  3REJ D;  5B0Z C;  3VH6 W;  4G92 B;  4WJ3 C;  3X1V D;  1KX3 B;  5B40 A;  4X23 A;  3EPH A;  5AV5 B;  3V9R A;  5B32 D;  2CV5 A;  3AZH D;  1KX4 B;  2Y2Q A;  5B33 A;  1P3A B;  3AZL D;  1T3U A;  1HQ3 C;  3O62 D;  3MGR B;  3NQU B;  5CPI C;  5DNN A;  3W96 B;  3AZK D;  3X1S B;  2RVQ C;  3REK A;  3B6F D;  3KUY B;  4KGC B;  3EPK A;  3C1B D;  3MNN B;  5GT0 C;  3KXB D;  3UTB A;  5BNX A;  5GSU A;  5F99 D;  3MNN C;  1P3M A;  5B1L A;  4R8P C;  4YS3 D;  1B6W A;  2BYM A;  4XUJ D;  1P3P B;  2ARO A;  5JRG B;  4J8X B;  2F8N K;  1P3F B;  3AFA B;  1HQ3 A;  4UPK A;  4WZS B;  4Z5T B;  1TZY C;  5DNM B;  3B0D B;  3H0M C;  3LZ1 C;  3REJ A;  5AY8 B;  3X1V C;  5B2J C;  3TU4 B;  2BG1 A;  3WTP B;  3AZI A;  5B0Z D;  2NQB A;  5B2J B;  3AYW C;  5FUG A;  2HIO B;  5AV8 A;  4Z66 D;  2BYK A;  1P3P D;  3AZE A;  3AZF A;  3R45 A;  4HGA C;  4Z5T D;  5DNM D;  1S32 A;  3MGP D;  3W98 C;  3MGS C;  3W99 D;  1Z2C B;  3AZN D;  3KWQ B;  5CP6 D;  4H9P A;  5E5A C;  2UWX A;  2YFW B;  4XUJ A;  3AZK C;  3LZ0 A;  4ZBJ B;  4CAY B;  5GT0 B;  5B24 A;  3AZJ C;  3EPJ A;  3AZE C;  5C3I C;  5B2I C;  2NZD A;  3UTB D;  3X1T A;  1P3P C;  3KUY D;  2DF4 C;  4QLC B;  3B0C T;  5CPI A;  4DRA A;  3REL A;  3AV1 B;  1TZY B;  5B32 C;  2LY8 A;  5AVC C;  3AV1 C;  5F99 A;  3B6G A;  4YS3 B;  5B31 A;  1TAF A;  1F66 B;  1ID3 B;  3AV2 D;  1PZR A;  5B2I D;  3REI D;  4G91 C;  2ZY2 A;  5DNN C;  4XZQ C;  3MVD B;  1P3L C;  2ARO D;  1M1A D;  1BH8 A;  3MGQ B;  4J8U C;  3KWQ D;  3W99 B;  3WTP E;  4WNN B;  5GSU D;  1P3I A;  3REH D;  4R8P B;  4X23 C;  3AV2 C;  3AZM D;  1P3K A;  5B40 D;  3WKJ A;  4WU8 A;  1KX5 C;  2ZM5 A;  4NE6 A;  4WU8 B;  1P3K B;  2F8N G;  1Q9C A;  1P34 D;  1P3I B;  5GXQ C;  3AZL A;  5BO0 B;  4WNN A;  1KX4 D;  4ZUX C;  3KUY C;  3REL D;  5B1M D;  4Z2M H;  1KX5 A;  4M6B A;  3VH5 A;  1P3O D;  1BH8 B;  3A1I A;  3MGQ A;  4R8P D;  3X1S D;  3MVD D;  3VH5 W;  5B0Y C;  4AWL C;  2NZD D;  5CP6 C;  1ID3 A;  3KXB B;  5B31 B;  3MGS D;  2IO5 B;  3MGS A;  4YS3 A;  5AV8 D;  2HUE C;  5E5A D;  3B6G B;  3LEL D;  1P3G D;  3AZK B;  2HUE B;  2Y2N A;  1HTA A;  1TZY A;  3W96 D;  4H9Q B;  5B24 C;  3AV1 A;  3REL B;  4J8V C;  3B6G C;  5AVB A;  2HIO C;  2Y2I A;  3X1T B;  2NQB C;  3AZM A;  1P3K D;  4CAY A;  5GT0 A;  3REJ C;  3TU4 C;  3LZ0 B;  3KSY A;  3AZM B;  1EQZ C;  1S32 B;  2ARO C;  3FDD A;  2Y2P A;  5AVB B;  1AOI C;  4H9Q A;  3AZF B;  1R4V A;  3AZE B;  2BYK B;  4XUJ C;  3AZK A;  4NE3 A;  5AV6 D;  5AV8 B;  2HIO A;  5FUG B;  5B31 D;  3MGS B;  3AZI C;  2CV5 C;  3KXB A;  5B0Y D;  3AZI B;  2RVQ D;  3WA9 C;  3TU4 A;  4KUD C;  5AY8 A;  1P3A C;  5CPI D;  4JJN C;  1HQ3 B;  3AFA A;  1ZLA D;  4J8V D;  1KX5 B;  5B1L C;  1KX4 C;  3B6G D;  2Y2K A;  5BO0 A;  1ULY A;  2Y2J A;  3AZL B;  5B1L B;  5B24 D;  5GSU B;  4NFT A;  5BNX B;  3UTB B;  2Y2M A;  3W99 C;  4YS3 C;  5CPJ C;  1W2E A;  1M19 D;  3WA9 D;  4KUD D;  2NZD C;  5GSU C;  2F8N D;  3WKJ B;  4QLC D;  3X1S A;  3REH C;  4R8P A;  3AZE D;  5DNN B;  3EG5 B;  3NQU A;  1AOI D;  5GT3 D;  1F1E A;  4LD9 D;  3B6F C;  2ZY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...