2NZDB

Nucleosome core particle containing 145 bp of dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdB00
2FJ7D 3W96A 5DNNC 3MGRC 5AV5B 1KX5C 1P34A 2HIOC 1KX4D 3WAAA 1P3GB 5GXQB 3X1TB 3O62D 4H9QA 4M6BA 3NQJA 4CSRB 3REIC 3UTBA 2RVQD 4H9NB 4YM6A 3AZKC 2AROA 3RELA 2FJ7C 3KXBD 3AZEA 1P3OD 4G91C 1M19A 5CPJB 1KX4C 3TU4B 1BH9A 1EQZD 1Q9CA 3AZGD 4HGAB 3O62C 3AZLB 1KX3A 3B6GA 5JRGB 5GT0B 4LD9A 3LJAA 2RVQC 1ZLAA 4WU9B 1P3PB 1F66A 5AVCA 3LELD 2CWEA 5AV9D 5BS7C 4J8VD 3KXBC 5B1MB 3AV1A 1P3OC 4WU8B 3W98D 4JJND 1EQZC 3AZGC 3X1SA 1JFIA 3MNNA 3AN2D 4X23A 1M1AD 3LELC 1BH8A 5AV9C 3LZ0A 4NE6A 5AV6D 4J8VC 3KUYB 1M18A 5B2ID 2F8NA 2PYOA 3MGRB 3W98C 3AFAA 3LZ1D 3AZJA 3AZNB 1P3MB 3AV2B 1KX5B 3B6FA 2HIOB 4JJNC 5KDMA 5AV8A 3REJD 5GSUB 4QLCB 3AN2C 1M1AC 3B0DC 4ZUXA 4UUZB 5AV6C 3AZHD 1P3FA 5B1LA 5B2IC 2FJ7B 4WV4B 4KGCA 3LZ1C 3KWQA 1P3BB 4G91B 1KX4B 4WNNA 1P3AA 5G49B 1HTAA 3C1BA 3REJC 5AY8B 1P3KB 1ID3A 3MGSD 5AVBA 5B24A 3AYWA 5GXQD 3X1TD 2YFVA 3AZHC 3AZMA 3R45A 3UT9A 4Z2MH 5B32G 1P3OB 5B2JB 3KSYA 5BNXA 5F99B 1EQZB 3MGPA 3MGSC 3AZFD 5GXQC 3X1TC 5GT3D 3X1UA 4J8WD 5JRGD 5E5AA 1HQ3A 4WU9D 5CPID 4Z2MG 1P3PD 3WKJD 3W98B 4H9RA 1TZYA 4JJNB 5BNVA 5B1MD 4WU8D 4Z5TA 5B32D 3AZFC 4HGAC 3W99D 5GT3C 1M1AB 4J8WC 5JRGC 1A7WA 5CP6A 3B0BA 4WU9C 5CPIC 1P3PC 3WKJC 3REHB 4DRAA 4NE5A 4R8PB 1KU5A 5B1MC 4Z66A 4WU8C 5FUGB 3AZND 5B32C 1P3MD 4KHAB 4YS3A 3W99C 1P3LA 5GSUD 4QLCD 1TAFA 5B40D 3REKA 4WZSB 2NQBA 4KUDB 4J8UA 5B31A 3AZNC 5AV5A 3AV2C 1S32A 1P3BD 1P3MC 3WA9D 3MGQD 2NZDD 3MGSB 3UTAA 5AY8D 2CV5B 1P3KD 1P3GA 4XZQB 4QLCC 5GSUC 5B40C 4CSRA 5AV8D 5BT1D 4H9NA 4XUJB 4J8XA 4H9OB 1P3IA 1P3BC 3WA9C 5B1LD 5B2JD 5F99D 3MGQC 2NZDC 3AZFB 5CPJA 3TU4A 5AY8C 1P3KC 5GT3B 1P34B 4J8WB 3WAAB 3AZLA 1BFMA 3WTPD 5GT0A 5B33A 5CPIB 3WKJB 4H9QB 3NQJB 3UTBB 3MVDA 4YM6B 2AROB 3NQUA 5B2JC 3RELB 5F99C 5B32B 3W99B 1BH9B 4ZBJB 3WTPC 3X1VD 5B0ZD 4H9SA 3A6NA 3KUYA 2JSSA 3C1CA 3REHD 5DNNA 3MGRA 4R8PD 1KX5A 2HIOA 5B40B 3WTPE 3X1VC 5B0ZC 1JFIB 3REIA 3AZKA 4UUZA 5CPKD 1U35D 5DNMD 2IO5C 4X23B 4G92C 2FJ7A 3REHC 4KUDD 3WA9B 1M18B 4R8PC 3MGQB 2NZDB 5B0YD 1KX4A 3AFAB 5G49A 3AZJB 1R4VA 5KDMB 3O62A 2BYKA 3AZID 5AV8B 2CV5D 4XZQD 2BYMB 4YS3D 1AOID 5CPKC 1WWIA 5DNMC 1U35C 5BS7A 3V9RA 4KUDC 4ZUXB 3KXBA 1P3FB 5B1LB 4XUJD 5B0YC 4KGCB 3VH6T 3W97D 2YFWA 1EQZA 3AZGA 4WNNB 3W96D 3AZIC 3WTPB 2CV5C 1ULYA 4XZQC 1P34D 4YS3C 1ID3B 3WAAD 1AOIC 3LELA 5AV9A 4J8VA 4DRBA 4CAYA 5JA4B 2F8NH 1N1JB 4XUJC 3UT9B 3W98A 3UTBD 3W97C 4YM6D 4JJNA 2AROD 3RELD 5BNXB 3W96C 3MGPB 3AZED 3X1VB 5B0ZB 1P34C 1M19D 3AN2A 3WAAC 5AV6A 1KX3D 2IO5B 3X1UB 5B2IA 4G92B 3B6GD 2F8NG 4NFTA 4LD9D 3LZ1A 3UTBC 3LJAD 1ZLAD 4YM6C 1F66D 2AROC 5AVCD 4H9RB 3RELC 4H9PA 3REJA 5BNVB 3AZEC 3AV1D 1M19C 5BO0B 4E44A 4ZBJC 3X1SD 3AZHA 5CPKB 1U35B 5DNMB 1KX3C 3B6GC 5CP6B 4LD9C 3LJAC 3MNND 5B0YB 1ZLAC 4X23D 1F66C 5AVCC 3LZ0D 1H3OB 2F8NK 1M18D 2F8ND 2PYOD 3AZIB 3AV1C 4Z66B 3MGSA 3AFAD 3AZJD 4E45A 3B6FD 5C3IC 5GXQA 3X1TA 4YS3B 3X1SC 1AOIB 1B67A 1P3LB 4EO5C 3MNNC 4X23C 3W97B 3LZ0C 2NQBB 4ZUXD 4H9OA 1P3FD 2PYOC 1M18C 3W96B 4KGCD 3AZFA 3AFAC 5B31B 3KWQD 3AZJC 3B6FC 1S32B 5GT3A 3UTAB 4J8WA 1P3AD 3VH6W 5AV8C 3C1BD 5JRGA 3VH5T 5BT1C 1ID3D 4WU9A 5CPIA 1P3PA 5AVBD 3WKJA 5B24D 3AYWD 3C1CC 4ZUXC 1P3FC 3AZMD 5B1LC 5B1MA 3UT9D 4WU8A 4KGCC 4J8XB 5B32A 1P3IB 3AZEB 3KWQC 2HUEC 1M19B 3W99A 4AWLC 1P3AC 3C1BC 3MGPD 1KX3B 3B6GB 1ID3C 5AVBC 5B24C 4LD9B 3AYWC 3LJAB 5B33B 1ZLAB 3X1UD 1F66B 5AVCB 3AZMC 3UT9C 5E5AD 3AZNA 1P3MA 3MVDB 1HQ3D 3AV2A 3AV1B 3NQUB 1TZYD 5C3IB 5GSUA 4QLCA 3X1SB 3MGPC 5B40A 4Z5TD 4EO5B 3MNNB 3VH6A 3X1UC 1BH8B 3LZ0B 5CP6D 3A6NB 5E5AC 2PYOB 2F8NB 1P3BA 3WA9A 1HQ3C 5B31G 3C1CB 3MGQA 2NZDA 1TZYC 5DNNB 3B6FB 5AY8A 1P3KA 4Z66D 4Z5TC 2BYMA 4NE3A 3REIB 1F1EA 1P3LD 5CP6C 3AZKB 1P3OA 5B2JA 3REKD 5F99A 2NQBD 3KWQB 2HUEB 3B0CW 4AWLB 4J8UD 1P3AB 4Z66C 3C1BB 5B31D 3WTPA 5AV5D 1S32D 3O62B 3UTAD 5AVBB 2BYKB 5B24B 3AYWB 1P3GD 1P3LC 2YFVB 3AZMB 3R45B 5JA4A 1N1JA 3REKC 3V9RB 2NQBC 3VH5W 3KXBB 2LY8A 4J8XD 4J8UC 2YFWB 1P3ID 5B31C 5AV5C 3AZGB 1S32C 3X1VA 5B0ZA 3UTAC 1M1AA 5CPJD 3TU4D 1B6WA 1P3GC 3AZLD 3LELB 3REHA 5E5AB 5AV9B 5GT0D 5B33D 1HQ3B 4J8VB 4CAYB 4R8PA 1TZYB 4J8XC 5FUGA 3MVDD 1P3IC 4KHAA 4Z5TB 5BO0A 5CPJC 3TU4C 5CPKA 1U35A 5DNMA 3AN2B 3AZLC 3B0DB 4KUDA 5GT0C 5AV6B 5B33C 5B2IB 5B0YA 3A6ND 3LZ1B 3MVDC 1H3OA 3KUYD 3C1CD 1WWSA 3AZIA 5DNND 5CHLB 3MGRD 4H9PB 3VH5A 3REJB 2CV5A 3AV2D 4XZQA 1KX5D 2HIOD 1AOIA 1TAFB 3AZHB 3B0CT 4XUJA 3REKB 3REID 2L5AA 4H9SC 3W97A 3A6NC 3AZKD 3KUYC 4J8UB
chains in the Genus database with same CATH superfamily
2FJ7D 3W96A 5DNNC 3MGRC 5AV5B 2Y2HA 1KX5C 1P34A 2HIOC 1KX4D 3WAAA 1P3GB 5GXQB 3X1TB 3O62D 4H9QA 4M6BA 3NQJA 4CSRB 3REIC 3UTBA 2RVQD 4H9NB 4YM6A 3AZKC 2AROA 3RELA 2FJ7C 3KXBD 3AZEA 2Y2PA 1P3OD 4G91C 1M19A 5CPJB 1KX4C 3TU4B 1BH9A 1EQZD 1Q9CA 3AZGD 4HGAB 3O62C 3AZLB 1KX3A 3B6GA 5JRGB 5GT0B 4LD9A 3LJAA 2RVQC 1ZLAA 4WU9B 1P3PB 1F66A 5AVCA 3LELD 2CWEA 5AV9D 5BS7C 4J8VD 3KXBC 3EPLA 5B1MB 3AV1A 1P3OC 4WU8B 3W98D 4JJND 1EQZC 3AZGC 3X1SA 1JFIA 2FFFB 3MNNA 3AN2D 4X23A 1M1AD 3LELC 1BH8A 5AV9C 3LZ0A 4NE6A 5AV6D 4J8VC 3KUYB 1M18A 5B2ID 2F8NA 2PYOA 2DQNC 3MGRB 3W98C 3AFAA 3LZ1D 3AZJA 3AZNB 1P3MB 3AV2B 1KX5B 3B6FA 2HIOB 4JJNC 5KDMA 2G5HC 5AV8A 2ZY4A 3REJD 5GSUB 4QLCB 3H0LC 3EPHA 3AN2C 1M1AC 3B0DC 4ZUXA 4UUZB 5AV6C 3AZHD 1P3FA 5B1LA 5B2IC 2FJ7B 4WV4B 4KGCA 3LZ1C 3KWQA 1P3BB 4G91B 1KX4B 4WNNA 1P3AA 5G49B 1HTAA 3C1BA 3REJC 5AY8B 1P3KB 1ID3A 3MGSD 5AVBA 5B24A 3AYWA 5GXQD 3X1TD 2YFVA 3AZHC 3AZMA 3R45A 3UT9A 4Z2MH 5B32G 1P3OB 5B2JB 3KSYA 5BNXA 5F99B 1EQZB 3MGPA 1W2EA 3MGSC 3AZFD 5GXQC 3X1TC 5GT3D 3X1UA 4J8WD 4DQYB 5JRGD 5E5AA 1HQ3A 4WU9D 5CPID 4Z2MG 1P3PD 3WKJD 3W98B 3H0MC 4H9RA 1TZYA 2Y2OA 4JJNB 5BNVA 3EPJA 5B1MD 4WU8D 4Z5TA 5B32D 2ZM5A 3AZFC 4HGAC 3W99D 2ZY3A 5GT3C 3EG5B 1M1AB 4J8WC 5JRGC 1A7WA 5CP6A 3B0BA 4WU9C 5CPIC 1P3PC 3WKJC 3REHB 4DRAA 4NE5A 4R8PB 1KU5A 5B1MC 4Z66A 4WU8C 5FUGB 3AZND 5B32C 1P3MD 4KHAB 4YS3A 2ZY2A 3W99C 1P3LA 5GSUD 4QLCD 1TAFA 5B40D 3REKA 4WZSB 2NQBA 4KUDB 4J8UA 5B31A 3AZNC 5AV5A 3AV2C 1S32A 1P3BD 1P3MC 3WA9D 3MGQD 2NZDD 3MGSB 3UTAA 5AY8D 2CV5B 1P3KD 1P3GA 4XZQB 4QLCC 5GSUC 5B40C 4CSRA 5AV8D 5BT1D 4H9NA 4XUJB 4J8XA 4H9OB 1P3IA 1P3BC 3WA9C 5B1LD 5B2JD 5F99D 3MGQC 2NZDC 3AZFB 5CPJA 3TU4A 5AY8C 1P3KC 2UWXA 5GT3B 1P34B 4J8WB 3WAAB 3AZLA 1BFMA 3WTPD 5GT0A 5B33A 5CPIB 3WKJB 4H9QB 3NQJB 3UTBB 3MVDA 4YM6B 2AROB 3NQUA 5B2JC 3RELB 5F99C 5B32B 2G5IC 3W99B 1BH9B 4ZBJB 3WTPC 3IP4C 4WJ3C 3X1VD 5B0ZD 4H9SA 3A6NA 3KUYA 2JSSA 3C1CA 3REHD 5DNNA 3MGRA 4R8PD 1KX5A 2HIOA 5B40B 3WTPE 3X1VC 5B0ZC 1JFIB 3REIA 3AZKA 4UUZA 5CPKD 1U35D 5DNMD 2IO5C 4X23B 4G92C 2FJ7A 3REHC 4KUDD 3WA9B 1M18B 4R8PC 3MGQB 2NZDB 5B0YD 1KX4A 3AFAB 5G49A 3AZJB 1R4VA 5KDMB 3O62A 2BYKA 3AZID 5AV8B 2CV5D 4XZQD 2BYMB 4YS3D 1AOID 5CPKC 1WWIA 5DNMC 1U35C 5BS7A 2XD1A 3V9RA 4KUDC 4ZUXB 3KXBA 1P3FB 5B1LB 4XUJD 5B0YC 4KGCB 3VH6T 3W97D 2YFWA 1EQZA 3AZGA 4WNNB 2Y2NA 3AZIC 3W96D 3WTPB 2CV5C 1ULYA 4XZQC 1P34D 4YS3C 1ID3B 3WAAD 1AOIC 3LELA 5AV9A 4J8VA 4DRBA 4CAYA 5JA4B 2F8NH 1N1JB 3FDDA 4XUJC 2RIQA 3UT9B 3W98A 3UTBD 3W97C 4YM6D 4JJNA 2AROD 3RELD 5BNXB 3W96C 2JE5A 2Y2LA 3MGPB 3AZED 3X1VB 5B0ZB 1P34C 1M19D 3AN2A 3WAAC 3P5JB 5AV6A 1KX3D 2IO5B 3X1UB 5B2IA 4G92B 3B6GD 2F8NG 4NFTA 4LD9D 3LZ1A 3UTBC 3LJAD 1ZLAD 4YM6C 1F66D 2AROC 2Y2QA 2XD5A 4H9RB 5AVCD 3RELC 4H9PA 3REJA 5BNVB 3AZEC 3AV1D 1M19C 5BO0B 4E44A 4ZBJC 3X1SD 3AZHA 5CPKB 1T3UA 5DNMB 1U35B 1KX3C 3AL0C 3B6GC 5CP6B 4LD9C 3LJAC 3MNND 5B0YB 1ZLAC 4X23D 1F66C 5AVCC 2J8PA 3LZ0D 1H3OB 2F8NK 1M18D 2F8ND 2PYOD 3AZIB 3AV1C 4Z66B 3MGSA 3AFAD 3AZJD 4E45A 3B6FD 5C3IC 5GXQA 3X1TA 4YS3B 3X1SC 1AOIB 1B67A 3A1KA 1P3LB 4EO5C 3MNNC 4X23C 3W97B 3LZ0C 2NQBB 4ZUXD 4H9OA 1P3FD 2PYOC 1M18C 2Y2JA 3W96B 4KGCD 3AZFA 3AFAC 5B31B 3KWQD 3AZJC 3B6FC 1S32B 5GT3A 1Z2CB 3UTAB 4J8WA 1P3AD 3VH6W 5AV8C 3C1BD 5JRGA 3VH5T 5BT1C 1ID3D 4WU9A 5CPIA 1PZRA 5AVBD 1P3PA 5B24D 2DF4C 3WKJA 3AYWD 3C1CC 4ZUXC 1P3FC 3AZMD 2F2AC 5B1LC 5B1MA 3UT9D 4WU8A 4KGCC 4J8XB 5B32A 3A1IA 1P3IB 3AZEB 3KWQC 2HUEC 1M19B 3W99A 4AWLC 1P3AC 3C1BC 3MGPD 1KX3B 3B6GB 1ID3C 5AVBC 5B24C 4LD9B 3AYWC 3LJAB 5B33B 1ZLAB 3F6TA 3X1UD 1F66B 5AVCB 3AZMC 3UT9C 5E5AD 3AZNA 1P3MA 3MVDB 1HQ3D 3AV2A 3AV1B 3NQUB 1TZYD 5C3IB 5GSUA 4QLCA 3X1SB 3MGPC 5B40A 4Z5TD 4EO5B 3MNNB 3VH6A 3X1UC 1BH8B 3LZ0B 5CP6D 3A6NB 5E5AC 2PYOB 2F8NB 1P3BA 3WA9A 1HQ3C 5B31G 3C1CB 2Y2KA 3MGQA 2NZDA 1TZYC 5DNNB 3B6FB 5AY8A 1P3KA 4Z66D 4Z5TC 2BYMA 4NE3A 3REIB 1F1EA 1P3LD 5CP6C 2VQRA 3AZKB 1P3OA 5B2JA 3REKD 5F99A 2NQBD 3KWQB 2HUEB 3B0CW 4AWLB 4J8UD 1P3AB 4Z66C 3C1BB 5B31D 3WTPA 5AV5D 1S32D 3O62B 3UTAD 5AVBB 2BYKB 5B24B 2ZY5A 3AYWB 1P3GD 1P3LC 2YFVB 3AZMB 3R45B 5JA4A 1N1JA 3REKC 3V9RB 2NQBC 3VH5W 3KXBB 2LY8A 4J8XD 4J8UC 2YFWB 1P3ID 5B31C 5AV5C 3AZGB 1S32C 3X1VA 5B0ZA 3UTAC 1M1AA 5CPJD 3TU4D 1B6WA 1P3GC 3AZLD 3H0RC 3LELB 3REHA 5E5AB 5AV9B 5GT0D 5B33D 1HQ3B 4J8VB 4CAYB 4R8PA 1TZYB 4J8XC 5FUGA 3MVDD 2Y2IA 1P3IC 4KHAA 4Z5TB 2Y2GA 5BO0A 5CPJC 3TU4C 3KFUG 5CPKA 1U35A 5DNMA 3AN2B 3AZLC 3B0DB 4KUDA 5GT0C 5AV6B 5B33C 5B2IB 2Y2MA 5B0YA 3A6ND 3LZ1B 3MVDC 1H3OA 3KUYD 3C1CD 1WWSA 3AZIA 5DNND 5CHLB 3MGRD 4H9PB 3VH5A 3REJB 2CV5A 3AV2D 2W8SA 4XZQA 2HIOD 2JCHA 1KX5D 1AOIA 1TAFB 3AZHB 3B0CT 4XUJA 3EPKA 3REKB 3REID 2L5AA 4H9SC 3W97A 2BG1A 3A6NC 3AZKD 4UPKA 3KUYC 4J8UB
chains in the Genus database with same CATH topology
2FJ7D 3W96A 5DNNC 3MGRC 5AV5B 2Y2HA 1KX5C 1P34A 2HIOC 1KX4D 3WAAA 1P3GB 5GXQB 3X1TB 3O62D 4H9QA 4M6BA 3NQJA 4CSRB 3REIC 3UTBA 2RVQD 4H9NB 4YM6A 3AZKC 2AROA 3RELA 2FJ7C 3KXBD 3AZEA 2Y2PA 1P3OD 4G91C 1M19A 5CPJB 1KX4C 3TU4B 1BH9A 1EQZD 1Q9CA 3AZGD 4HGAB 3O62C 3AZLB 1KX3A 3B6GA 5JRGB 5GT0B 4LD9A 3LJAA 2RVQC 1ZLAA 4WU9B 1P3PB 1F66A 5AVCA 3LELD 2CWEA 5AV9D 5BS7C 4J8VD 3KXBC 3EPLA 5B1MB 3AV1A 1P3OC 4WU8B 3W98D 4JJND 1EQZC 3AZGC 3X1SA 1JFIA 2FFFB 3MNNA 3AN2D 4X23A 1M1AD 3LELC 1BH8A 5AV9C 3LZ0A 4NE6A 5AV6D 4J8VC 3KUYB 1M18A 5B2ID 2F8NA 2PYOA 2DQNC 3MGRB 3W98C 3AFAA 3LZ1D 3AZJA 3AZNB 1P3MB 3AV2B 1KX5B 3B6FA 2HIOB 4JJNC 5KDMA 2G5HC 5AV8A 2ZY4A 3REJD 5GSUB 4QLCB 3H0LC 3EPHA 3AN2C 1M1AC 3B0DC 4ZUXA 4UUZB 5AV6C 3AZHD 1P3FA 5B1LA 5B2IC 2FJ7B 4WV4B 4KGCA 3LZ1C 3KWQA 1P3BB 4G91B 1KX4B 4WNNA 1P3AA 5G49B 1HTAA 3C1BA 3REJC 5AY8B 1P3KB 1ID3A 3MGSD 5AVBA 5B24A 3AYWA 5GXQD 3X1TD 2YFVA 3AZHC 3AZMA 3R45A 3UT9A 4Z2MH 5B32G 1P3OB 5B2JB 3KSYA 5BNXA 5F99B 1EQZB 3MGPA 1W2EA 3MGSC 3AZFD 5GXQC 3X1TC 5GT3D 3X1UA 4J8WD 4DQYB 5JRGD 5E5AA 1HQ3A 4WU9D 5CPID 4Z2MG 1P3PD 3WKJD 3W98B 3H0MC 4H9RA 1TZYA 2Y2OA 4JJNB 5BNVA 3EPJA 5B1MD 4WU8D 4Z5TA 5B32D 2ZM5A 3AZFC 4HGAC 3W99D 2ZY3A 5GT3C 3EG5B 1M1AB 4J8WC 5JRGC 1A7WA 5CP6A 3B0BA 4WU9C 5CPIC 1P3PC 3WKJC 3REHB 4DRAA 4NE5A 4R8PB 1KU5A 5B1MC 4Z66A 4WU8C 5FUGB 3AZND 5B32C 1P3MD 4KHAB 4YS3A 2ZY2A 3W99C 1P3LA 5GSUD 4QLCD 1TAFA 5B40D 3REKA 4WZSB 2NQBA 4KUDB 4J8UA 5B31A 3AZNC 5AV5A 3AV2C 1S32A 1P3BD 1P3MC 3WA9D 3MGQD 2NZDD 3MGSB 3UTAA 5AY8D 2CV5B 1P3KD 1P3GA 4XZQB 4QLCC 5GSUC 5B40C 4CSRA 5AV8D 5BT1D 4H9NA 4XUJB 4J8XA 4H9OB 1P3IA 1P3BC 3WA9C 5B1LD 5B2JD 5F99D 3MGQC 2NZDC 3AZFB 5CPJA 3TU4A 5AY8C 1P3KC 2UWXA 5GT3B 1P34B 4J8WB 3WAAB 3AZLA 1BFMA 3WTPD 5GT0A 5B33A 5CPIB 3WKJB 4H9QB 3NQJB 3UTBB 3MVDA 4YM6B 2AROB 3NQUA 5B2JC 3RELB 5F99C 5B32B 2G5IC 3W99B 1BH9B 4ZBJB 3WTPC 3IP4C 4WJ3C 3X1VD 5B0ZD 4H9SA 3A6NA 3KUYA 2JSSA 3C1CA 3REHD 5DNNA 3MGRA 4R8PD 1KX5A 2HIOA 5B40B 3WTPE 3X1VC 5B0ZC 1JFIB 3REIA 3AZKA 4UUZA 5CPKD 1U35D 5DNMD 2IO5C 4X23B 4G92C 2FJ7A 3REHC 4KUDD 3WA9B 1M18B 4R8PC 3MGQB 2NZDB 5B0YD 1KX4A 3AFAB 5G49A 3AZJB 1R4VA 5KDMB 3O62A 2BYKA 3AZID 5AV8B 2CV5D 4XZQD 2BYMB 4YS3D 1AOID 5CPKC 1WWIA 5DNMC 1U35C 5BS7A 2XD1A 3V9RA 4KUDC 4ZUXB 3KXBA 1P3FB 5B1LB 4XUJD 5B0YC 4KGCB 3VH6T 3W97D 2YFWA 1EQZA 3AZGA 4WNNB 2Y2NA 3AZIC 3W96D 3WTPB 2CV5C 1ULYA 4XZQC 1P34D 4YS3C 1ID3B 3WAAD 1AOIC 3LELA 5AV9A 4J8VA 4DRBA 4CAYA 5JA4B 2F8NH 1N1JB 3FDDA 4XUJC 2RIQA 3UT9B 3W98A 3UTBD 3W97C 4YM6D 4JJNA 2AROD 3RELD 5BNXB 3W96C 2JE5A 2Y2LA 3MGPB 3AZED 3X1VB 5B0ZB 1P34C 1M19D 3AN2A 3WAAC 3P5JB 5AV6A 1KX3D 2IO5B 3X1UB 5B2IA 4G92B 3B6GD 2F8NG 4NFTA 4LD9D 3LZ1A 3UTBC 3LJAD 1ZLAD 4YM6C 1F66D 2AROC 2Y2QA 2XD5A 4H9RB 5AVCD 3RELC 4H9PA 3REJA 5BNVB 3AZEC 3AV1D 1M19C 5BO0B 4E44A 4ZBJC 3X1SD 3AZHA 5CPKB 1T3UA 5DNMB 1U35B 1KX3C 3AL0C 3B6GC 5CP6B 4LD9C 3LJAC 3MNND 5B0YB 1ZLAC 4X23D 1F66C 5AVCC 2J8PA 3LZ0D 1H3OB 2F8NK 1M18D 2F8ND 2PYOD 3AZIB 3AV1C 4Z66B 3MGSA 3AFAD 3AZJD 4E45A 3B6FD 5C3IC 5GXQA 3X1TA 4YS3B 3X1SC 1AOIB 1B67A 3A1KA 1P3LB 4EO5C 3MNNC 4X23C 3W97B 3LZ0C 2NQBB 4ZUXD 4H9OA 1P3FD 2PYOC 1M18C 2Y2JA 3W96B 4KGCD 3AZFA 3AFAC 5B31B 3KWQD 3AZJC 3B6FC 1S32B 5GT3A 1Z2CB 3UTAB 4J8WA 1P3AD 3VH6W 5AV8C 3C1BD 5JRGA 3VH5T 5BT1C 1ID3D 4WU9A 5CPIA 1PZRA 5AVBD 1P3PA 5B24D 2DF4C 3WKJA 3AYWD 3C1CC 4ZUXC 1P3FC 3AZMD 2F2AC 5B1LC 5B1MA 3UT9D 4WU8A 4KGCC 4J8XB 5B32A 3A1IA 1P3IB 3AZEB 3KWQC 2HUEC 1M19B 3W99A 4AWLC 1P3AC 3C1BC 3MGPD 1KX3B 3B6GB 1ID3C 5AVBC 5B24C 4LD9B 3AYWC 3LJAB 5B33B 1ZLAB 3F6TA 3X1UD 1F66B 5AVCB 3AZMC 3UT9C 5E5AD 3AZNA 1P3MA 3MVDB 1HQ3D 3AV2A 3AV1B 3NQUB 1TZYD 5C3IB 5GSUA 4QLCA 3X1SB 3MGPC 5B40A 4Z5TD 4EO5B 3MNNB 3VH6A 3X1UC 1BH8B 3LZ0B 5CP6D 3A6NB 5E5AC 2PYOB 2F8NB 1P3BA 3WA9A 1HQ3C 5B31G 3C1CB 2Y2KA 3MGQA 2NZDA 1TZYC 5DNNB 3B6FB 5AY8A 1P3KA 4Z66D 4Z5TC 2BYMA 4NE3A 3REIB 1F1EA 1P3LD 5CP6C 2VQRA 3AZKB 1P3OA 5B2JA 3REKD 5F99A 2NQBD 3KWQB 2HUEB 3B0CW 4AWLB 4J8UD 1P3AB 4Z66C 3C1BB 5B31D 3WTPA 5AV5D 1S32D 3O62B 3UTAD 5AVBB 2BYKB 5B24B 2ZY5A 3AYWB 1P3GD 1P3LC 2YFVB 3AZMB 3R45B 5JA4A 1N1JA 3REKC 3V9RB 2NQBC 3VH5W 3KXBB 2LY8A 4J8XD 4J8UC 2YFWB 1P3ID 5B31C 5AV5C 3AZGB 1S32C 3X1VA 5B0ZA 3UTAC 1M1AA 5CPJD 3TU4D 1B6WA 1P3GC 3AZLD 3H0RC 3LELB 3REHA 5E5AB 5AV9B 5GT0D 5B33D 1HQ3B 4J8VB 4CAYB 4R8PA 1TZYB 4J8XC 5FUGA 3MVDD 2Y2IA 1P3IC 4KHAA 4Z5TB 2Y2GA 5BO0A 5CPJC 3TU4C 3KFUG 5CPKA 1U35A 5DNMA 3AN2B 3AZLC 3B0DB 4KUDA 5GT0C 5AV6B 5B33C 5B2IB 2Y2MA 5B0YA 3A6ND 3LZ1B 3MVDC 1H3OA 3KUYD 3C1CD 1WWSA 3AZIA 5DNND 5CHLB 3MGRD 4H9PB 3VH5A 3REJB 2CV5A 3AV2D 2W8SA 4XZQA 2HIOD 2JCHA 1KX5D 1AOIA 1TAFB 3AZHB 3B0CT 4XUJA 3EPKA 3REKB 3REID 2L5AA 4H9SC 3W97A 2BG1A 3A6NC 3AZKD 4UPKA 3KUYC 4J8UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ7 D;  3W96 A;  5DNN C;  3MGR C;  5AV5 B;  1KX5 C;  1P34 A;  2HIO C;  1KX4 D;  3WAA A;  1P3G B;  5GXQ B;  3X1T B;  3O62 D;  4H9Q A;  4M6B A;  3NQJ A;  4CSR B;  3REI C;  3UTB A;  2RVQ D;  4H9N B;  4YM6 A;  3AZK C;  2ARO A;  3REL A;  2FJ7 C;  3KXB D;  3AZE A;  1P3O D;  4G91 C;  1M19 A;  5CPJ B;  1KX4 C;  3TU4 B;  1BH9 A;  1EQZ D;  1Q9C A;  3AZG D;  4HGA B;  3O62 C;  3AZL B;  1KX3 A;  3B6G A;  5JRG B;  5GT0 B;  4LD9 A;  3LJA A;  2RVQ C;  1ZLA A;  4WU9 B;  1P3P B;  1F66 A;  5AVC A;  3LEL D;  2CWE A;  5AV9 D;  5BS7 C;  4J8V D;  3KXB C;  5B1M B;  3AV1 A;  1P3O C;  4WU8 B;  3W98 D;  4JJN D;  1EQZ C;  3AZG C;  3X1S A;  1JFI A;  3MNN A;  3AN2 D;  4X23 A;  1M1A D;  3LEL C;  1BH8 A;  5AV9 C;  3LZ0 A;  4NE6 A;  5AV6 D;  4J8V C;  3KUY B;  1M18 A;  5B2I D;  2F8N A;  2PYO A;  3MGR B;  3W98 C;  3AFA A;  3LZ1 D;  3AZJ A;  3AZN B;  1P3M B;  3AV2 B;  1KX5 B;  3B6F A;  2HIO B;  4JJN C;  5KDM A;  5AV8 A;  3REJ D;  5GSU B;  4QLC B;  3AN2 C;  1M1A C;  3B0D C;  4ZUX A;  4UUZ B;  5AV6 C;  3AZH D;  1P3F A;  5B1L A;  5B2I C;  2FJ7 B;  4WV4 B;  4KGC A;  3LZ1 C;  3KWQ A;  1P3B B;  4G91 B;  1KX4 B;  4WNN A;  1P3A A;  5G49 B;  1HTA A;  3C1B A;  3REJ C;  5AY8 B;  1P3K B;  1ID3 A;  3MGS D;  5AVB A;  5B24 A;  3AYW A;  5GXQ D;  3X1T D;  2YFV A;  3AZH C;  3AZM A;  3R45 A;  3UT9 A;  4Z2M H;  5B32 G;  1P3O B;  5B2J B;  3KSY A;  5BNX A;  5F99 B;  1EQZ B;  3MGP A;  3MGS C;  3AZF D;  5GXQ C;  3X1T C;  5GT3 D;  3X1U A;  4J8W D;  5JRG D;  5E5A A;  1HQ3 A;  4WU9 D;  5CPI D;  4Z2M G;  1P3P D;  3WKJ D;  3W98 B;  4H9R A;  1TZY A;  4JJN B;  5BNV A;  5B1M D;  4WU8 D;  4Z5T A;  5B32 D;  3AZF C;  4HGA C;  3W99 D;  5GT3 C;  1M1A B;  4J8W C;  5JRG C;  1A7W A;  5CP6 A;  3B0B A;  4WU9 C;  5CPI C;  1P3P C;  3WKJ C;  3REH B;  4DRA A;  4NE5 A;  4R8P B;  1KU5 A;  5B1M C;  4Z66 A;  4WU8 C;  5FUG B;  3AZN D;  5B32 C;  1P3M D;  4KHA B;  4YS3 A;  3W99 C;  1P3L A;  5GSU D;  4QLC D;  1TAF A;  5B40 D;  3REK A;  4WZS B;  2NQB A;  4KUD B;  4J8U A;  5B31 A;  3AZN C;  5AV5 A;  3AV2 C;  1S32 A;  1P3B D;  1P3M C;  3WA9 D;  3MGQ D;  2NZD D;  3MGS B;  3UTA A;  5AY8 D;  2CV5 B;  1P3K D;  1P3G A;  4XZQ B;  4QLC C;  5GSU C;  5B40 C;  4CSR A;  5AV8 D;  5BT1 D;  4H9N A;  4XUJ B;  4J8X A;  4H9O B;  1P3I A;  1P3B C;  3WA9 C;  5B1L D;  5B2J D;  5F99 D;  3MGQ C;  2NZD C;  3AZF B;  5CPJ A;  3TU4 A;  5AY8 C;  1P3K C;  5GT3 B;  1P34 B;  4J8W B;  3WAA B;  3AZL A;  1BFM A;  3WTP D;  5GT0 A;  5B33 A;  5CPI B;  3WKJ B;  4H9Q B;  3NQJ B;  3UTB B;  3MVD A;  4YM6 B;  2ARO B;  3NQU A;  5B2J C;  3REL B;  5F99 C;  5B32 B;  3W99 B;  1BH9 B;  4ZBJ B;  3WTP C;  3X1V D;  5B0Z D;  4H9S A;  3A6N A;  3KUY A;  2JSS A;  3C1C A;  3REH D;  5DNN A;  3MGR A;  4R8P D;  1KX5 A;  2HIO A;  5B40 B;  3WTP E;  3X1V C;  5B0Z C;  1JFI B;  3REI A;  3AZK A;  4UUZ A;  5CPK D;  1U35 D;  5DNM D;  2IO5 C;  4X23 B;  4G92 C;  2FJ7 A;  3REH C;  4KUD D;  3WA9 B;  1M18 B;  4R8P C;  3MGQ B;  2NZD B;  5B0Y D;  1KX4 A;  3AFA B;  5G49 A;  3AZJ B;  1R4V A;  5KDM B;  3O62 A;  2BYK A;  3AZI D;  5AV8 B;  2CV5 D;  4XZQ D;  2BYM B;  4YS3 D;  1AOI D;  5CPK C;  1WWI A;  5DNM C;  1U35 C;  5BS7 A;  3V9R A;  4KUD C;  4ZUX B;  3KXB A;  1P3F B;  5B1L B;  4XUJ D;  5B0Y C;  4KGC B;  3VH6 T;  3W97 D;  2YFW A;  1EQZ A;  3AZG A;  4WNN B;  3W96 D;  3AZI C;  3WTP B;  2CV5 C;  1ULY A;  4XZQ C;  1P34 D;  4YS3 C;  1ID3 B;  3WAA D;  1AOI C;  3LEL A;  5AV9 A;  4J8V A;  4DRB A;  4CAY A;  5JA4 B;  2F8N H;  1N1J B;  4XUJ C;  3UT9 B;  3W98 A;  3UTB D;  3W97 C;  4YM6 D;  4JJN A;  2ARO D;  3REL D;  5BNX B;  3W96 C;  3MGP B;  3AZE D;  3X1V B;  5B0Z B;  1P34 C;  1M19 D;  3AN2 A;  3WAA C;  5AV6 A;  1KX3 D;  2IO5 B;  3X1U B;  5B2I A;  4G92 B;  3B6G D;  2F8N G;  4NFT A;  4LD9 D;  3LZ1 A;  3UTB C;  3LJA D;  1ZLA D;  4YM6 C;  1F66 D;  2ARO C;  5AVC D;  4H9R B;  3REL C;  4H9P A;  3REJ A;  5BNV B;  3AZE C;  3AV1 D;  1M19 C;  5BO0 B;  4E44 A;  4ZBJ C;  3X1S D;  3AZH A;  5CPK B;  1U35 B;  5DNM B;  1KX3 C;  3B6G C;  5CP6 B;  4LD9 C;  3LJA C;  3MNN D;  5B0Y B;  1ZLA C;  4X23 D;  1F66 C;  5AVC C;  3LZ0 D;  1H3O B;  2F8N K;  1M18 D;  2F8N D;  2PYO D;  3AZI B;  3AV1 C;  4Z66 B;  3MGS A;  3AFA D;  3AZJ D;  4E45 A;  3B6F D;  5C3I C;  5GXQ A;  3X1T A;  4YS3 B;  3X1S C;  1AOI B;  1B67 A;  1P3L B;  4EO5 C;  3MNN C;  4X23 C;  3W97 B;  3LZ0 C;  2NQB B;  4ZUX D;  4H9O A;  1P3F D;  2PYO C;  1M18 C;  3W96 B;  4KGC D;  3AZF A;  3AFA C;  5B31 B;  3KWQ D;  3AZJ C;  3B6F C;  1S32 B;  5GT3 A;  3UTA B;  4J8W A;  1P3A D;  3VH6 W;  5AV8 C;  3C1B D;  5JRG A;  3VH5 T;  5BT1 C;  1ID3 D;  4WU9 A;  5CPI A;  1P3P A;  5AVB D;  3WKJ A;  5B24 D;  3AYW D;  3C1C C;  4ZUX C;  1P3F C;  3AZM D;  5B1L C;  5B1M A;  3UT9 D;  4WU8 A;  4KGC C;  4J8X B;  5B32 A;  1P3I B;  3AZE B;  3KWQ C;  2HUE C;  1M19 B;  3W99 A;  4AWL C;  1P3A C;  3C1B C;  3MGP D;  1KX3 B;  3B6G B;  1ID3 C;  5AVB C;  5B24 C;  4LD9 B;  3AYW C;  3LJA B;  5B33 B;  1ZLA B;  3X1U D;  1F66 B;  5AVC B;  3AZM C;  3UT9 C;  5E5A D;  3AZN A;  1P3M A;  3MVD B;  1HQ3 D;  3AV2 A;  3AV1 B;  3NQU B;  1TZY D;  5C3I B;  5GSU A;  4QLC A;  3X1S B;  3MGP C;  5B40 A;  4Z5T D;  4EO5 B;  3MNN B;  3VH6 A;  3X1U C;  1BH8 B;  3LZ0 B;  5CP6 D;  3A6N B;  5E5A C;  2PYO B;  2F8N B;  1P3B A;  3WA9 A;  1HQ3 C;  5B31 G;  3C1C B;  3MGQ A;  2NZD A;  1TZY C;  5DNN B;  3B6F B;  5AY8 A;  1P3K A;  4Z66 D;  4Z5T C;  2BYM A;  4NE3 A;  3REI B;  1F1E A;  1P3L D;  5CP6 C;  3AZK B;  1P3O A;  5B2J A;  3REK D;  5F99 A;  2NQB D;  3KWQ B;  2HUE B;  3B0C W;  4AWL B;  4J8U D;  1P3A B;  4Z66 C;  3C1B B;  5B31 D;  3WTP A;  5AV5 D;  1S32 D;  3O62 B;  3UTA D;  5AVB B;  2BYK B;  5B24 B;  3AYW B;  1P3G D;  1P3L C;  2YFV B;  3AZM B;  3R45 B;  5JA4 A;  1N1J A;  3REK C;  3V9R B;  2NQB C;  3VH5 W;  3KXB B;  2LY8 A;  4J8X D;  4J8U C;  2YFW B;  1P3I D;  5B31 C;  5AV5 C;  3AZG B;  1S32 C;  3X1V A;  5B0Z A;  3UTA C;  1M1A A;  5CPJ D;  3TU4 D;  1B6W A;  1P3G C;  3AZL D;  3LEL B;  3REH A;  5E5A B;  5AV9 B;  5GT0 D;  5B33 D;  1HQ3 B;  4J8V B;  4CAY B;  4R8P A;  1TZY B;  4J8X C;  5FUG A;  3MVD D;  1P3I C;  4KHA A;  4Z5T B;  5BO0 A;  5CPJ C;  3TU4 C;  5CPK A;  1U35 A;  5DNM A;  3AN2 B;  3AZL C;  3B0D B;  4KUD A;  5GT0 C;  5AV6 B;  5B33 C;  5B2I B;  5B0Y A;  3A6N D;  3LZ1 B;  3MVD C;  1H3O A;  3KUY D;  3C1C D;  1WWS A;  3AZI A;  5DNN D;  5CHL B;  3MGR D;  4H9P B;  3VH5 A;  3REJ B;  2CV5 A;  3AV2 D;  4XZQ A;  1KX5 D;  2HIO D;  1AOI A;  1TAF B;  3AZH B;  3B0C T;  4XUJ A;  3REK B;  3REI D;  2L5A A;  4H9S C;  3W97 A;  3A6N C;  3AZK D;  3KUY C;  4J8U B; 
#chains in the Genus database with same CATH topology
 2FJ7 D;  3W96 A;  5DNN C;  3MGR C;  5AV5 B;  2Y2H A;  1KX5 C;  1P34 A;  2HIO C;  1KX4 D;  3WAA A;  1P3G B;  5GXQ B;  3X1T B;  3O62 D;  4H9Q A;  4M6B A;  3NQJ A;  4CSR B;  3REI C;  3UTB A;  2RVQ D;  4H9N B;  4YM6 A;  3AZK C;  2ARO A;  3REL A;  2FJ7 C;  3KXB D;  3AZE A;  2Y2P A;  1P3O D;  4G91 C;  1M19 A;  5CPJ B;  1KX4 C;  3TU4 B;  1BH9 A;  1EQZ D;  1Q9C A;  3AZG D;  4HGA B;  3O62 C;  3AZL B;  1KX3 A;  3B6G A;  5JRG B;  5GT0 B;  4LD9 A;  3LJA A;  2RVQ C;  1ZLA A;  4WU9 B;  1P3P B;  1F66 A;  5AVC A;  3LEL D;  2CWE A;  5AV9 D;  5BS7 C;  4J8V D;  3KXB C;  3EPL A;  5B1M B;  3AV1 A;  1P3O C;  4WU8 B;  3W98 D;  4JJN D;  1EQZ C;  3AZG C;  3X1S A;  1JFI A;  2FFF B;  3MNN A;  3AN2 D;  4X23 A;  1M1A D;  3LEL C;  1BH8 A;  5AV9 C;  3LZ0 A;  4NE6 A;  5AV6 D;  4J8V C;  3KUY B;  1M18 A;  5B2I D;  2F8N A;  2PYO A;  2DQN C;  3MGR B;  3W98 C;  3AFA A;  3LZ1 D;  3AZJ A;  3AZN B;  1P3M B;  3AV2 B;  1KX5 B;  3B6F A;  2HIO B;  4JJN C;  5KDM A;  2G5H C;  5AV8 A;  2ZY4 A;  3REJ D;  5GSU B;  4QLC B;  3H0L C;  3EPH A;  3AN2 C;  1M1A C;  3B0D C;  4ZUX A;  4UUZ B;  5AV6 C;  3AZH D;  1P3F A;  5B1L A;  5B2I C;  2FJ7 B;  4WV4 B;  4KGC A;  3LZ1 C;  3KWQ A;  1P3B B;  4G91 B;  1KX4 B;  4WNN A;  1P3A A;  5G49 B;  1HTA A;  3C1B A;  3REJ C;  5AY8 B;  1P3K B;  1ID3 A;  3MGS D;  5AVB A;  5B24 A;  3AYW A;  5GXQ D;  3X1T D;  2YFV A;  3AZH C;  3AZM A;  3R45 A;  3UT9 A;  4Z2M H;  5B32 G;  1P3O B;  5B2J B;  3KSY A;  5BNX A;  5F99 B;  1EQZ B;  3MGP A;  1W2E A;  3MGS C;  3AZF D;  5GXQ C;  3X1T C;  5GT3 D;  3X1U A;  4J8W D;  4DQY B;  5JRG D;  5E5A A;  1HQ3 A;  4WU9 D;  5CPI D;  4Z2M G;  1P3P D;  3WKJ D;  3W98 B;  3H0M C;  4H9R A;  1TZY A;  2Y2O A;  4JJN B;  5BNV A;  3EPJ A;  5B1M D;  4WU8 D;  4Z5T A;  5B32 D;  2ZM5 A;  3AZF C;  4HGA C;  3W99 D;  2ZY3 A;  5GT3 C;  3EG5 B;  1M1A B;  4J8W C;  5JRG C;  1A7W A;  5CP6 A;  3B0B A;  4WU9 C;  5CPI C;  1P3P C;  3WKJ C;  3REH B;  4DRA A;  4NE5 A;  4R8P B;  1KU5 A;  5B1M C;  4Z66 A;  4WU8 C;  5FUG B;  3AZN D;  5B32 C;  1P3M D;  4KHA B;  4YS3 A;  2ZY2 A;  3W99 C;  1P3L A;  5GSU D;  4QLC D;  1TAF A;  5B40 D;  3REK A;  4WZS B;  2NQB A;  4KUD B;  4J8U A;  5B31 A;  3AZN C;  5AV5 A;  3AV2 C;  1S32 A;  1P3B D;  1P3M C;  3WA9 D;  3MGQ D;  2NZD D;  3MGS B;  3UTA A;  5AY8 D;  2CV5 B;  1P3K D;  1P3G A;  4XZQ B;  4QLC C;  5GSU C;  5B40 C;  4CSR A;  5AV8 D;  5BT1 D;  4H9N A;  4XUJ B;  4J8X A;  4H9O B;  1P3I A;  1P3B C;  3WA9 C;  5B1L D;  5B2J D;  5F99 D;  3MGQ C;  2NZD C;  3AZF B;  5CPJ A;  3TU4 A;  5AY8 C;  1P3K C;  2UWX A;  5GT3 B;  1P34 B;  4J8W B;  3WAA B;  3AZL A;  1BFM A;  3WTP D;  5GT0 A;  5B33 A;  5CPI B;  3WKJ B;  4H9Q B;  3NQJ B;  3UTB B;  3MVD A;  4YM6 B;  2ARO B;  3NQU A;  5B2J C;  3REL B;  5F99 C;  5B32 B;  2G5I C;  3W99 B;  1BH9 B;  4ZBJ B;  3WTP C;  3IP4 C;  4WJ3 C;  3X1V D;  5B0Z D;  4H9S A;  3A6N A;  3KUY A;  2JSS A;  3C1C A;  3REH D;  5DNN A;  3MGR A;  4R8P D;  1KX5 A;  2HIO A;  5B40 B;  3WTP E;  3X1V C;  5B0Z C;  1JFI B;  3REI A;  3AZK A;  4UUZ A;  5CPK D;  1U35 D;  5DNM D;  2IO5 C;  4X23 B;  4G92 C;  2FJ7 A;  3REH C;  4KUD D;  3WA9 B;  1M18 B;  4R8P C;  3MGQ B;  2NZD B;  5B0Y D;  1KX4 A;  3AFA B;  5G49 A;  3AZJ B;  1R4V A;  5KDM B;  3O62 A;  2BYK A;  3AZI D;  5AV8 B;  2CV5 D;  4XZQ D;  2BYM B;  4YS3 D;  1AOI D;  5CPK C;  1WWI A;  5DNM C;  1U35 C;  5BS7 A;  2XD1 A;  3V9R A;  4KUD C;  4ZUX B;  3KXB A;  1P3F B;  5B1L B;  4XUJ D;  5B0Y C;  4KGC B;  3VH6 T;  3W97 D;  2YFW A;  1EQZ A;  3AZG A;  4WNN B;  2Y2N A;  3AZI C;  3W96 D;  3WTP B;  2CV5 C;  1ULY A;  4XZQ C;  1P34 D;  4YS3 C;  1ID3 B;  3WAA D;  1AOI C;  3LEL A;  5AV9 A;  4J8V A;  4DRB A;  4CAY A;  5JA4 B;  2F8N H;  1N1J B;  3FDD A;  4XUJ C;  2RIQ A;  3UT9 B;  3W98 A;  3UTB D;  3W97 C;  4YM6 D;  4JJN A;  2ARO D;  3REL D;  5BNX B;  3W96 C;  2JE5 A;  2Y2L A;  3MGP B;  3AZE D;  3X1V B;  5B0Z B;  1P34 C;  1M19 D;  3AN2 A;  3WAA C;  3P5J B;  5AV6 A;  1KX3 D;  2IO5 B;  3X1U B;  5B2I A;  4G92 B;  3B6G D;  2F8N G;  4NFT A;  4LD9 D;  3LZ1 A;  3UTB C;  3LJA D;  1ZLA D;  4YM6 C;  1F66 D;  2ARO C;  2Y2Q A;  2XD5 A;  4H9R B;  5AVC D;  3REL C;  4H9P A;  3REJ A;  5BNV B;  3AZE C;  3AV1 D;  1M19 C;  5BO0 B;  4E44 A;  4ZBJ C;  3X1S D;  3AZH A;  5CPK B;  1T3U A;  5DNM B;  1U35 B;  1KX3 C;  3AL0 C;  3B6G C;  5CP6 B;  4LD9 C;  3LJA C;  3MNN D;  5B0Y B;  1ZLA C;  4X23 D;  1F66 C;  5AVC C;  2J8P A;  3LZ0 D;  1H3O B;  2F8N K;  1M18 D;  2F8N D;  2PYO D;  3AZI B;  3AV1 C;  4Z66 B;  3MGS A;  3AFA D;  3AZJ D;  4E45 A;  3B6F D;  5C3I C;  5GXQ A;  3X1T A;  4YS3 B;  3X1S C;  1AOI B;  1B67 A;  3A1K A;  1P3L B;  4EO5 C;  3MNN C;  4X23 C;  3W97 B;  3LZ0 C;  2NQB B;  4ZUX D;  4H9O A;  1P3F D;  2PYO C;  1M18 C;  2Y2J A;  3W96 B;  4KGC D;  3AZF A;  3AFA C;  5B31 B;  3KWQ D;  3AZJ C;  3B6F C;  1S32 B;  5GT3 A;  1Z2C B;  3UTA B;  4J8W A;  1P3A D;  3VH6 W;  5AV8 C;  3C1B D;  5JRG A;  3VH5 T;  5BT1 C;  1ID3 D;  4WU9 A;  5CPI A;  1PZR A;  5AVB D;  1P3P A;  5B24 D;  2DF4 C;  3WKJ A;  3AYW D;  3C1C C;  4ZUX C;  1P3F C;  3AZM D;  2F2A C;  5B1L C;  5B1M A;  3UT9 D;  4WU8 A;  4KGC C;  4J8X B;  5B32 A;  3A1I A;  1P3I B;  3AZE B;  3KWQ C;  2HUE C;  1M19 B;  3W99 A;  4AWL C;  1P3A C;  3C1B C;  3MGP D;  1KX3 B;  3B6G B;  1ID3 C;  5AVB C;  5B24 C;  4LD9 B;  3AYW C;  3LJA B;  5B33 B;  1ZLA B;  3F6T A;  3X1U D;  1F66 B;  5AVC B;  3AZM C;  3UT9 C;  5E5A D;  3AZN A;  1P3M A;  3MVD B;  1HQ3 D;  3AV2 A;  3AV1 B;  3NQU B;  1TZY D;  5C3I B;  5GSU A;  4QLC A;  3X1S B;  3MGP C;  5B40 A;  4Z5T D;  4EO5 B;  3MNN B;  3VH6 A;  3X1U C;  1BH8 B;  3LZ0 B;  5CP6 D;  3A6N B;  5E5A C;  2PYO B;  2F8N B;  1P3B A;  3WA9 A;  1HQ3 C;  5B31 G;  3C1C B;  2Y2K A;  3MGQ A;  2NZD A;  1TZY C;  5DNN B;  3B6F B;  5AY8 A;  1P3K A;  4Z66 D;  4Z5T C;  2BYM A;  4NE3 A;  3REI B;  1F1E A;  1P3L D;  5CP6 C;  2VQR A;  3AZK B;  1P3O A;  5B2J A;  3REK D;  5F99 A;  2NQB D;  3KWQ B;  2HUE B;  3B0C W;  4AWL B;  4J8U D;  1P3A B;  4Z66 C;  3C1B B;  5B31 D;  3WTP A;  5AV5 D;  1S32 D;  3O62 B;  3UTA D;  5AVB B;  2BYK B;  5B24 B;  2ZY5 A;  3AYW B;  1P3G D;  1P3L C;  2YFV B;  3AZM B;  3R45 B;  5JA4 A;  1N1J A;  3REK C;  3V9R B;  2NQB C;  3VH5 W;  3KXB B;  2LY8 A;  4J8X D;  4J8U C;  2YFW B;  1P3I D;  5B31 C;  5AV5 C;  3AZG B;  1S32 C;  3X1V A;  5B0Z A;  3UTA C;  1M1A A;  5CPJ D;  3TU4 D;  1B6W A;  1P3G C;  3AZL D;  3H0R C;  3LEL B;  3REH A;  5E5A B;  5AV9 B;  5GT0 D;  5B33 D;  1HQ3 B;  4J8V B;  4CAY B;  4R8P A;  1TZY B;  4J8X C;  5FUG A;  3MVD D;  2Y2I A;  1P3I C;  4KHA A;  4Z5T B;  2Y2G A;  5BO0 A;  5CPJ C;  3TU4 C;  3KFU G;  5CPK A;  1U35 A;  5DNM A;  3AN2 B;  3AZL C;  3B0D B;  4KUD A;  5GT0 C;  5AV6 B;  5B33 C;  5B2I B;  2Y2M A;  5B0Y A;  3A6N D;  3LZ1 B;  3MVD C;  1H3O A;  3KUY D;  3C1C D;  1WWS A;  3AZI A;  5DNN D;  5CHL B;  3MGR D;  4H9P B;  3VH5 A;  3REJ B;  2CV5 A;  3AV2 D;  2W8S A;  4XZQ A;  2HIO D;  2JCH A;  1KX5 D;  1AOI A;  1TAF B;  3AZH B;  3B0C T;  4XUJ A;  3EPK A;  3REK B;  3REI D;  2L5A A;  4H9S C;  3W97 A;  2BG1 A;  3A6N C;  3AZK D;  4UPK A;  3KUY C;  4J8U B; 
#chains in the Genus database with same CATH homology
 2FJ7 D;  3W96 A;  5DNN C;  3MGR C;  5AV5 B;  2Y2H A;  1KX5 C;  1P34 A;  2HIO C;  1KX4 D;  3WAA A;  1P3G B;  5GXQ B;  3X1T B;  3O62 D;  4H9Q A;  4M6B A;  3NQJ A;  4CSR B;  3REI C;  3UTB A;  2RVQ D;  4H9N B;  4YM6 A;  3AZK C;  2ARO A;  3REL A;  2FJ7 C;  3KXB D;  3AZE A;  2Y2P A;  1P3O D;  4G91 C;  1M19 A;  5CPJ B;  1KX4 C;  3TU4 B;  1BH9 A;  1EQZ D;  1Q9C A;  3AZG D;  4HGA B;  3O62 C;  3AZL B;  1KX3 A;  3B6G A;  5JRG B;  5GT0 B;  4LD9 A;  3LJA A;  2RVQ C;  1ZLA A;  4WU9 B;  1P3P B;  1F66 A;  5AVC A;  3LEL D;  2CWE A;  5AV9 D;  5BS7 C;  4J8V D;  3KXB C;  3EPL A;  5B1M B;  3AV1 A;  1P3O C;  4WU8 B;  3W98 D;  4JJN D;  1EQZ C;  3AZG C;  3X1S A;  1JFI A;  2FFF B;  3MNN A;  3AN2 D;  4X23 A;  1M1A D;  3LEL C;  1BH8 A;  5AV9 C;  3LZ0 A;  4NE6 A;  5AV6 D;  4J8V C;  3KUY B;  1M18 A;  5B2I D;  2F8N A;  2PYO A;  2DQN C;  3MGR B;  3W98 C;  3AFA A;  3LZ1 D;  3AZJ A;  3AZN B;  1P3M B;  3AV2 B;  1KX5 B;  3B6F A;  2HIO B;  4JJN C;  5KDM A;  2G5H C;  5AV8 A;  2ZY4 A;  3REJ D;  5GSU B;  4QLC B;  3H0L C;  3EPH A;  3AN2 C;  1M1A C;  3B0D C;  4ZUX A;  4UUZ B;  5AV6 C;  3AZH D;  1P3F A;  5B1L A;  5B2I C;  2FJ7 B;  4WV4 B;  4KGC A;  3LZ1 C;  3KWQ A;  1P3B B;  4G91 B;  1KX4 B;  4WNN A;  1P3A A;  5G49 B;  1HTA A;  3C1B A;  3REJ C;  5AY8 B;  1P3K B;  1ID3 A;  3MGS D;  5AVB A;  5B24 A;  3AYW A;  5GXQ D;  3X1T D;  2YFV A;  3AZH C;  3AZM A;  3R45 A;  3UT9 A;  4Z2M H;  5B32 G;  1P3O B;  5B2J B;  3KSY A;  5BNX A;  5F99 B;  1EQZ B;  3MGP A;  1W2E A;  3MGS C;  3AZF D;  5GXQ C;  3X1T C;  5GT3 D;  3X1U A;  4J8W D;  4DQY B;  5JRG D;  5E5A A;  1HQ3 A;  4WU9 D;  5CPI D;  4Z2M G;  1P3P D;  3WKJ D;  3W98 B;  3H0M C;  4H9R A;  1TZY A;  2Y2O A;  4JJN B;  5BNV A;  3EPJ A;  5B1M D;  4WU8 D;  4Z5T A;  5B32 D;  2ZM5 A;  3AZF C;  4HGA C;  3W99 D;  2ZY3 A;  5GT3 C;  3EG5 B;  1M1A B;  4J8W C;  5JRG C;  1A7W A;  5CP6 A;  3B0B A;  4WU9 C;  5CPI C;  1P3P C;  3WKJ C;  3REH B;  4DRA A;  4NE5 A;  4R8P B;  1KU5 A;  5B1M C;  4Z66 A;  4WU8 C;  5FUG B;  3AZN D;  5B32 C;  1P3M D;  4KHA B;  4YS3 A;  2ZY2 A;  3W99 C;  1P3L A;  5GSU D;  4QLC D;  1TAF A;  5B40 D;  3REK A;  4WZS B;  2NQB A;  4KUD B;  4J8U A;  5B31 A;  3AZN C;  5AV5 A;  3AV2 C;  1S32 A;  1P3B D;  1P3M C;  3WA9 D;  3MGQ D;  2NZD D;  3MGS B;  3UTA A;  5AY8 D;  2CV5 B;  1P3K D;  1P3G A;  4XZQ B;  4QLC C;  5GSU C;  5B40 C;  4CSR A;  5AV8 D;  5BT1 D;  4H9N A;  4XUJ B;  4J8X A;  4H9O B;  1P3I A;  1P3B C;  3WA9 C;  5B1L D;  5B2J D;  5F99 D;  3MGQ C;  2NZD C;  3AZF B;  5CPJ A;  3TU4 A;  5AY8 C;  1P3K C;  2UWX A;  5GT3 B;  1P34 B;  4J8W B;  3WAA B;  3AZL A;  1BFM A;  3WTP D;  5GT0 A;  5B33 A;  5CPI B;  3WKJ B;  4H9Q B;  3NQJ B;  3UTB B;  3MVD A;  4YM6 B;  2ARO B;  3NQU A;  5B2J C;  3REL B;  5F99 C;  5B32 B;  2G5I C;  3W99 B;  1BH9 B;  4ZBJ B;  3WTP C;  3IP4 C;  4WJ3 C;  3X1V D;  5B0Z D;  4H9S A;  3A6N A;  3KUY A;  2JSS A;  3C1C A;  3REH D;  5DNN A;  3MGR A;  4R8P D;  1KX5 A;  2HIO A;  5B40 B;  3WTP E;  3X1V C;  5B0Z C;  1JFI B;  3REI A;  3AZK A;  4UUZ A;  5CPK D;  1U35 D;  5DNM D;  2IO5 C;  4X23 B;  4G92 C;  2FJ7 A;  3REH C;  4KUD D;  3WA9 B;  1M18 B;  4R8P C;  3MGQ B;  2NZD B;  5B0Y D;  1KX4 A;  3AFA B;  5G49 A;  3AZJ B;  1R4V A;  5KDM B;  3O62 A;  2BYK A;  3AZI D;  5AV8 B;  2CV5 D;  4XZQ D;  2BYM B;  4YS3 D;  1AOI D;  5CPK C;  1WWI A;  5DNM C;  1U35 C;  5BS7 A;  2XD1 A;  3V9R A;  4KUD C;  4ZUX B;  3KXB A;  1P3F B;  5B1L B;  4XUJ D;  5B0Y C;  4KGC B;  3VH6 T;  3W97 D;  2YFW A;  1EQZ A;  3AZG A;  4WNN B;  2Y2N A;  3AZI C;  3W96 D;  3WTP B;  2CV5 C;  1ULY A;  4XZQ C;  1P34 D;  4YS3 C;  1ID3 B;  3WAA D;  1AOI C;  3LEL A;  5AV9 A;  4J8V A;  4DRB A;  4CAY A;  5JA4 B;  2F8N H;  1N1J B;  3FDD A;  4XUJ C;  2RIQ A;  3UT9 B;  3W98 A;  3UTB D;  3W97 C;  4YM6 D;  4JJN A;  2ARO D;  3REL D;  5BNX B;  3W96 C;  2JE5 A;  2Y2L A;  3MGP B;  3AZE D;  3X1V B;  5B0Z B;  1P34 C;  1M19 D;  3AN2 A;  3WAA C;  3P5J B;  5AV6 A;  1KX3 D;  2IO5 B;  3X1U B;  5B2I A;  4G92 B;  3B6G D;  2F8N G;  4NFT A;  4LD9 D;  3LZ1 A;  3UTB C;  3LJA D;  1ZLA D;  4YM6 C;  1F66 D;  2ARO C;  2Y2Q A;  2XD5 A;  4H9R B;  5AVC D;  3REL C;  4H9P A;  3REJ A;  5BNV B;  3AZE C;  3AV1 D;  1M19 C;  5BO0 B;  4E44 A;  4ZBJ C;  3X1S D;  3AZH A;  5CPK B;  1T3U A;  5DNM B;  1U35 B;  1KX3 C;  3AL0 C;  3B6G C;  5CP6 B;  4LD9 C;  3LJA C;  3MNN D;  5B0Y B;  1ZLA C;  4X23 D;  1F66 C;  5AVC C;  2J8P A;  3LZ0 D;  1H3O B;  2F8N K;  1M18 D;  2F8N D;  2PYO D;  3AZI B;  3AV1 C;  4Z66 B;  3MGS A;  3AFA D;  3AZJ D;  4E45 A;  3B6F D;  5C3I C;  5GXQ A;  3X1T A;  4YS3 B;  3X1S C;  1AOI B;  1B67 A;  3A1K A;  1P3L B;  4EO5 C;  3MNN C;  4X23 C;  3W97 B;  3LZ0 C;  2NQB B;  4ZUX D;  4H9O A;  1P3F D;  2PYO C;  1M18 C;  2Y2J A;  3W96 B;  4KGC D;  3AZF A;  3AFA C;  5B31 B;  3KWQ D;  3AZJ C;  3B6F C;  1S32 B;  5GT3 A;  1Z2C B;  3UTA B;  4J8W A;  1P3A D;  3VH6 W;  5AV8 C;  3C1B D;  5JRG A;  3VH5 T;  5BT1 C;  1ID3 D;  4WU9 A;  5CPI A;  1PZR A;  5AVB D;  1P3P A;  5B24 D;  2DF4 C;  3WKJ A;  3AYW D;  3C1C C;  4ZUX C;  1P3F C;  3AZM D;  2F2A C;  5B1L C;  5B1M A;  3UT9 D;  4WU8 A;  4KGC C;  4J8X B;  5B32 A;  3A1I A;  1P3I B;  3AZE B;  3KWQ C;  2HUE C;  1M19 B;  3W99 A;  4AWL C;  1P3A C;  3C1B C;  3MGP D;  1KX3 B;  3B6G B;  1ID3 C;  5AVB C;  5B24 C;  4LD9 B;  3AYW C;  3LJA B;  5B33 B;  1ZLA B;  3F6T A;  3X1U D;  1F66 B;  5AVC B;  3AZM C;  3UT9 C;  5E5A D;  3AZN A;  1P3M A;  3MVD B;  1HQ3 D;  3AV2 A;  3AV1 B;  3NQU B;  1TZY D;  5C3I B;  5GSU A;  4QLC A;  3X1S B;  3MGP C;  5B40 A;  4Z5T D;  4EO5 B;  3MNN B;  3VH6 A;  3X1U C;  1BH8 B;  3LZ0 B;  5CP6 D;  3A6N B;  5E5A C;  2PYO B;  2F8N B;  1P3B A;  3WA9 A;  1HQ3 C;  5B31 G;  3C1C B;  2Y2K A;  3MGQ A;  2NZD A;  1TZY C;  5DNN B;  3B6F B;  5AY8 A;  1P3K A;  4Z66 D;  4Z5T C;  2BYM A;  4NE3 A;  3REI B;  1F1E A;  1P3L D;  5CP6 C;  2VQR A;  3AZK B;  1P3O A;  5B2J A;  3REK D;  5F99 A;  2NQB D;  3KWQ B;  2HUE B;  3B0C W;  4AWL B;  4J8U D;  1P3A B;  4Z66 C;  3C1B B;  5B31 D;  3WTP A;  5AV5 D;  1S32 D;  3O62 B;  3UTA D;  5AVB B;  2BYK B;  5B24 B;  2ZY5 A;  3AYW B;  1P3G D;  1P3L C;  2YFV B;  3AZM B;  3R45 B;  5JA4 A;  1N1J A;  3REK C;  3V9R B;  2NQB C;  3VH5 W;  3KXB B;  2LY8 A;  4J8X D;  4J8U C;  2YFW B;  1P3I D;  5B31 C;  5AV5 C;  3AZG B;  1S32 C;  3X1V A;  5B0Z A;  3UTA C;  1M1A A;  5CPJ D;  3TU4 D;  1B6W A;  1P3G C;  3AZL D;  3H0R C;  3LEL B;  3REH A;  5E5A B;  5AV9 B;  5GT0 D;  5B33 D;  1HQ3 B;  4J8V B;  4CAY B;  4R8P A;  1TZY B;  4J8X C;  5FUG A;  3MVD D;  2Y2I A;  1P3I C;  4KHA A;  4Z5T B;  2Y2G A;  5BO0 A;  5CPJ C;  3TU4 C;  3KFU G;  5CPK A;  1U35 A;  5DNM A;  3AN2 B;  3AZL C;  3B0D B;  4KUD A;  5GT0 C;  5AV6 B;  5B33 C;  5B2I B;  2Y2M A;  5B0Y A;  3A6N D;  3LZ1 B;  3MVD C;  1H3O A;  3KUY D;  3C1C D;  1WWS A;  3AZI A;  5DNN D;  5CHL B;  3MGR D;  4H9P B;  3VH5 A;  3REJ B;  2CV5 A;  3AV2 D;  2W8S A;  4XZQ A;  2HIO D;  2JCH A;  1KX5 D;  1AOI A;  1TAF B;  3AZH B;  3B0C T;  4XUJ A;  3EPK A;  3REK B;  3REI D;  2L5A A;  4H9S C;  3W97 A;  2BG1 A;  3A6N C;  3AZK D;  4UPK A;  3KUY C;  4J8U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...