2NZDB

Nucleosome core particle containing 145 bp of dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdB00
5GT3D 3AZHA 5B1MB 1BH8B 4E44A 5DNMD 4R8PD 5GXQD 1TAFA 3X1SA 1KX3D 5KDMA 5AV8C 3X1UB 5BNVA 3KSYA 3LJAA 3REJC 1AOIC 3W99B 1TZYC 3AFAD 5CP6A 4Z66A 2FJ7D 5CHLB 4J8VD 3B6FD 4JJNC 1JFIB 4WV4B 4ZUXA 4WU9D 3V9RA 3WTPE 4WU8C 5B40C 1U35B 4J8WA 3AZMC 4LD9B 3WKJB 3MGPC 4UUZB 3R45A 5B2JC 1S32B 3B6FC 5B2ID 3X1VA 2L5AA 1P3GB 5AVBB 3KXBB 4HGAB 3UT9D 5B1LC 4WNNB 3W96C 5GT0B 4H9RB 1P3BB 3W98B 1P3OA 3W97B 4KUDD 3AV1C 2F8NB 2HUEC 4J8UB 4WZSB 5BNXB 1KX4B 5AVCD 1P3LD 3REHB 1ID3C 5B24B 3C1CA 3REJA 3AZLD 5B33A 4X23A 3UTBD 3KWQB 4KUDC 4YM6D 3B0BA 4DRBA 2AROB 5JRGB 3WTPD 3A6NA 5B31D 4JJNA 3AN2A 4WU8A 1HQ3B 4EO5B 3AV2C 5AV5D 4CSRB 3MGRC 3X1SB 1P3PD 3X1TD 4ZBJB 4G92B 3AYWD 3LJAB 1KX5D 1EQZA 2PYOA 5F99C 1M18C 5AY8B 5B0YD 1P3PC 2F8NH 3X1TC 4XUJA 2F8NG 3NQJB 4CAYA 1BH9A 3NQUA 3V9RB 2HIOA 3REIC 3AV1A 1ULYA 4H9PA 5GT3B 3X1UD 3AZIC 3WA9A 3WAAA 1N1JA 1ID3A 3W99D 5B1MC 3LELC 3LZ0A 1P3FC 3AZEC 1U35D 3AZKA 2RVQD 5JA4A 3AV2A 1P3MD 4LD9D 2NZDA 5GSUA 3WKJD 4WU9B 4H9OA 3LZ1A 3C1BC 3C1CB 1P3GD 5AVBD 4NE3A 1H3OA 4Z2MH 4X23B 3KXBD 2CV5C 4Z2MG 4H9SC 3MNNA 1M18A 1P3BD 5B32C 1M19B 3A6NB 3W98D 5CPJA 3W97D 3UT9B 2F8ND 1S32C 4J8UD 5FUGA 3KXBC 3AZIA 5GT0C 1KX4D 3KUYA 5B0ZC 5B24D 1P3IB 3REKD 2PYOB 5BT1C 3KWQD 4J8UC 3LELA 2AROD 4G91B 5JRGD 5E5AA 4CAYB 3AZND 3NQUB 3REHC 3AZHD 1HQ3D 5AV9A 3WTPB 3B6GC 3AZJC 5B31B 3X1SD 3WA9B 3WAAB 1N1JB 2BYKA 3LJAD 3C1BA 4Z5TB 2CV5A 4EO5C 5CPKC 3MGQB 5AY8D 2LY8A 4H9QA 5B32A 4AWLC 3UTAC 1KU5A 3O62A 2NZDB 3MGSC 4H9OB 3AZGA 5AY8C 3LZ1B 5B0ZA 3TU4C 3B0CT 5AV6A 3MNNB 5GT3C 3MVDA 1M1AA 4R8PC 1P3OD 5DNMC 5GXQC 1KX3C 1F66B 5B31G 3B6GA 1P34A 1P3MB 3AFAC 3KUYB 4J8XA 3VH6T 3C1CD 2FJ7C 3RELA 4QLCA 4J8VC 4X23D 2IO5B 4XZQB 4WU9C 1M19D 3A6ND 4KHAA 5DNNB 5E5AB 5CPIB 5AV9B 5C3IC 3AZFA 3MGSA 1P3AB 5B2IC 2NQBB 2BYKB 1P3ID 2PYOD 3UT9C 3TU4A 5AV8A 1P3KB 1ZLAB 1AOIA 1HTAA 3REKB 4KGCB 1TZYA 1WWSA 2YFVA 2HIOD 1KX3A 4YS3B 3O62B 5AVCC 3AZNB 1P3LC 3AZHB 5B40A 3AZGB 3WA9D 3AZLC 3WAAD 3AZMA 4G91C 1BFMA 3B0DB 3UTBC 1TAFB 3MGPA 4Z5TD 4YM6C 5KDMB 2FJ7A 5BNVB 5B2JA 3WTPC 3MGQD 5G49A 3B6FA 5B31C 3LZ0D 5CP6B 4Z66B 3MVDB 5AV5C 5B1LA 3AZKD 3W96A 2NZDD 4ZUXB 4NE5A 3AYWC 3MGQC 1KX5C 4J8WB 5BS7C 5B2IA 3LZ1D 3R45B 4QLCB 5B0YC 3MNND 3X1VB 4KUDA 1R4VA 4KHAB 1F66D 2YFWA 3X1UC 1P3OB 3AZFB 5AVCA 3W99C 3KUYD 3MGRA 3UTBA 4YM6A 5AV8B 1F66C 4XZQD 3REJB 5B33B 1U35C 2RVQC 4LD9C 1P3MC 5BO0A 5E5AD 5DNND 3WKJC 2YFVB 5F99A 5CPID 5AV9D 1P3PA 3X1TA 4JJNB 3AN2B 1P3AD 4WU8B 4XZQC 3AYWA 5B40B 3REIA 1KX5A 2NQBD 1P3GC 5AVBC 4HGAC 2BYMA 5CPIC 1P3KD 5B0YA 1P3BC 1ZLAD 3W98C 1EQZB 4KGCD 3W97C 1P3AC 5B1MA 5B1LB 4YS3D 4XUJB 3O62D 1P3FA 3AZEA 3X1UA 1KX4C 1BH9B 2HIOB 5B24C 3AZGD 3B0CW 2HUEB 3REKC 3AV1B 3W99A 3KWQC 4H9PB 2AROC 5JRGC 5AV6D 1ID3B 1JFIA 4DRAA 5CP6D 3AZNC 4Z66D 1HQ3C 3MVDD 3AZHC 2JSSA 4LD9A 3B0DC 4H9SA 3X1SC 3WKJA 2YFWB 3LZ0B 4UUZA 4ZBJC 4G92C 3VH6W 3VH6A 4ZUXD 1P34D 3LJAC 1S32A 4J8WD 3AZKB 5JA4B 3AV2B 5GSUB 5CP6C 5AVBA 4J8XD 4Z66C 3KXBA 3MGRB 1P3GA 3RELD 4QLCD 4WNNA 5GT0A 4H9RA 1P3BA 3W98A 3X1VD 4ZUXC 3W97A 1H3OB 4J8UA 4H9NA 4E45A 5F99B 1M18B 5BNXA 5CPJB 3AZFD 3REHA 3REIB 3VH5T 5FUGB 3AZJA 3AZIB 5AV8D 5JRGA 3REJD 1P3OC 1AOID 1TZYD 5B33D 1HQ3A 5CPKA 3LELB 4M6BA 4CSRA 2CWEA 1P3FB 4JJND 3AZEB 3AN2D 4WU8D 3UTAA 5B40D 3C1CC 3AZMD 5B33C 4X23C 1B6WA 3MGPD 5AY8A 5B2JD 1M19C 3A6NC 3C1BB 1EQZD 3AN2C 3NQJA 2CV5B 1F1EA 5B1LD 3W96D 4XUJD 4H9QB 5GT3A 5B32B 4R8PA 5DNMA 5GXQA 3AV1D 1P3IC 1EQZC 2PYOC 3AFAA 4XUJC 1ID3D 5B0ZB 4J8VA 2HIOC 4H9NB 5AV6B 4WU9A 3WA9C 1M1AB 3WAAC 3AV2D 4Z5TC 5GSUD 3B6GB 3AZJB 3MGRD 1P34B 3LZ0C 4J8XB 1M19A 3RELB 3UT9A 3AZKC 5CPKB 2NZDC 5GSUC 5F99D 1M18D 5B32G 5CPJD 4AWLB 3LZ1C 3UTAB 3REID 1P3IA 3MGSB 1P3LA 3AZID 3MNNC 3AZLA 5CPJC 3TU4B 5B1MD 3LELD 3WTPA 1AOIB 5B31A 1TZYB 1P3FD 3AZED 4R8PB 5AV5A 5DNMB 3KUYC 5GXQB 1KX3B 4Z5TA 2IO5C 3MGQA 5BS7A 3AZMB 3AFAB 3C1BD 3MGPB 5DNNC 5E5AC 2FJ7B 4J8VB 2CV5D 5B2JB 5AV9C 5G49B 3B6FB 5B32D 1BH8A 2NQBC 1B67A 1S32D 3W96B 5C3IB 1P3KC 1ZLAC 5B2IB 4KGCC 5GT0D 5B0ZD 5BT1D 1F66A 4YS3C 2F8NK 3O62C 1A7WA 3VH5W 3VH5A 3AZGC 1U35A 4NE6A 1M1AD 4KUDB 1P3MA 4NFTA 3REHD 3B6GD 3AZJD 5AV6C 5AVCB 1P3LB 4XZQA 3AZLB 3MVDC 3UTBB 1M1AC 5DNNA 4YM6B 5CPIA 5CPKD 1Q9CA 1P34C 1P3AA 2F8NA 4J8WC 5BO0B 5AV5B 2NQBA 4J8XC 3UTAD 1WWIA 1P3PB 3RELC 3X1TB 4QLCC 3MGSD 1KX4A 1P3KA 1ZLAA 3AYWB 5B24A 3X1VC 1KX5B 3REKA 4KGCA 3KWQA 3TU4D 2BYMB 2AROA 5B0YB 4YS3A 3AZFC 3AZNA
chains in the Genus database with same CATH superfamily
5GT3D 3AZHA 5B1MB 1BH8B 4E44A 5DNMD 4R8PD 5GXQD 1TAFA 3X1SA 1KX3D 5KDMA 5AV8C 3X1UB 1W2EA 5BNVA 3KSYA 3LJAA 3REJC 1AOIC 3W99B 1TZYC 3AFAD 5CP6A 4Z66A 2FJ7D 5CHLB 4J8VD 2Y2IA 3B6FD 4JJNC 1JFIB 4WV4B 2Y2GA 4ZUXA 3V9RA 4WU9D 3WTPE 5B40C 4WU8C 1U35B 4J8WA 3AZMC 4LD9B 3WKJB 3MGPC 2W8SA 4UUZB 3R45A 5B2JC 1S32B 3B6FC 5B2ID 3X1VA 2L5AA 2ZY5A 1P3GB 5AVBB 3KXBB 4HGAB 3UT9D 5B1LC 4WNNB 3W96C 5GT0B 3FDDA 4H9RB 1P3BB 3W98B 1P3OA 3W97B 4KUDD 3AV1C 2F8NB 2HUEC 4J8UB 4WZSB 5BNXB 1KX4B 5AVCD 1P3LD 3REHB 1ID3C 5B24B 2Y2HA 3C1CA 3REJA 3AZLD 5B33A 4X23A 3UTBD 3KWQB 4KUDC 4YM6D 3B0BA 4DRBA 2AROB 5JRGB 3WTPD 3A6NA 5B31D 4JJNA 2Y2NA 3AN2A 4WU8A 1HQ3B 4EO5B 3AV2C 5AV5D 4CSRB 3MGRC 3X1SB 1P3PD 3X1TD 4ZBJB 4G92B 3AYWD 3LJAB 1KX5D 1EQZA 2PYOA 2G5HC 5F99C 1M18C 5AY8B 5B0YD 1P3PC 2F8NH 3X1TC 4XUJA 2F8NG 3NQJB 4CAYA 1BH9A 3NQUA 3V9RB 2HIOA 3REIC 3AV1A 1ULYA 4H9PA 5GT3B 3X1UD 3AZIC 3WA9A 3WAAA 1N1JA 1ID3A 3W99D 5B1MC 3LELC 2J8PA 3LZ0A 2DQNC 1P3FC 3AZEC 1U35D 3AZKA 2RVQD 5JA4A 3AV2A 1P3MD 4LD9D 2NZDA 5GSUA 3WKJD 4WU9B 4H9OA 3IP4C 3LZ1A 3C1BC 3C1CB 1P3GD 5AVBD 4NE3A 1H3OA 4Z2MH 4X23B 3KXBD 2CV5C 4Z2MG 4H9SC 3MNNA 1M18A 1P3BD 5B32C 1M19B 3A6NB 3W98D 5CPJA 3W97D 3UT9B 2F8ND 1S32C 4J8UD 5FUGA 2DF4C 3KXBC 3AZIA 5GT0C 1KX4D 3KUYA 5B24D 5B0ZC 1P3IB 3REKD 2PYOB 5BT1C 2Y2JA 3H0RC 3KWQD 4J8UC 3LELA 3H0LC 2AROD 4G91B 5JRGD 2JE5A 5E5AA 4CAYB 3AZND 3NQUB 3REHC 3AZHD 1HQ3D 5AV9A 3WTPB 3B6GC 3AZJC 5B31B 3X1SD 3WA9B 3WAAB 2VQRA 1N1JB 2BYKA 3LJAD 3C1BA 4Z5TB 2ZY4A 2CV5A 4EO5C 5CPKC 3MGQB 5AY8D 2LY8A 4H9QA 5B32A 4AWLC 3UTAC 1KU5A 3A1IA 3O62A 2NZDB 3MGSC 4H9OB 3AZGA 5AY8C 3LZ1B 5B0ZA 3TU4C 3B0CT 5AV6A 3MNNB 5GT3C 2ZY3A 3MVDA 4R8PC 1P3OD 5DNMC 3EPKA 1M1AA 5GXQC 1KX3C 1F66B 5B31G 3B6GA 1P34A 1P3MB 3AFAC 3KUYB 4J8XA 3VH6T 3C1CD 2FJ7C 3RELA 4QLCA 4J8VC 4X23D 2IO5B 4XZQB 4WU9C 1M19D 3A6ND 4KHAA 5DNNB 5E5AB 4UPKA 5CPIB 5AV9B 5C3IC 3AZFA 3MGSA 1P3AB 5B2IC 2NQBB 2BYKB 1P3ID 2PYOD 3UT9C 3TU4A 5AV8A 4DQYB 1P3KB 1ZLAB 1AOIA 1HTAA 3REKB 4KGCB 1TZYA 1WWSA 2YFVA 2HIOD 1KX3A 4YS3B 3O62B 2Y2QA 5AVCC 3AZNB 1P3LC 3AZHB 5B40A 3AZGB 3WA9D 3AZLC 3WAAD 3AZMA 4G91C 2XD1A 3B0DB 3UTBC 1BFMA 1TAFB 3MGPA 4Z5TD 4YM6C 5KDMB 2FJ7A 5BNVB 5B2JA 3WTPC 3MGQD 5G49A 3B6FA 5B31C 3LZ0D 5CP6B 4Z66B 3MVDB 3EPLA 5AV5C 5B1LA 3AZKD 3W96A 2NZDD 4ZUXB 4NE5A 3AYWC 3MGQC 1KX5C 4J8WB 5BS7C 5B2IA 3LZ1D 3R45B 4QLCB 5B0YC 3MNND 3X1VB 4KUDA 1R4VA 4KHAB 1F66D 2YFWA 3X1UC 1P3OB 3AZFB 5AVCA 3W99C 3KUYD 3MGRA 3UTBA 2UWXA 4YM6A 5AV8B 2ZM5A 1F66C 4XZQD 3REJB 5B33B 1U35C 2RVQC 4LD9C 1P3MC 5BO0A 5E5AD 5DNND 3WKJC 2Y2KA 2YFVB 5F99A 5CPID 5AV9D 1P3PA 3X1TA 3A1KA 4JJNB 2Y2MA 3AN2B 1P3AD 4WU8B 4XZQC 3AYWA 5B40B 3REIA 1KX5A 2NQBD 1P3GC 5AVBC 4HGAC 2BYMA 5CPIC 1P3KD 5B0YA 1P3BC 1ZLAD 3W98C 1EQZB 4KGCD 3W97C 1P3AC 5B1MA 4WJ3C 5B1LB 4YS3D 3H0MC 4XUJB 3O62D 1P3FA 3AZEA 3X1UA 1KX4C 1BH9B 2HIOB 5B24C 3AZGD 3B0CW 2HUEB 3REKC 3AV1B 3W99A 3KWQC 4H9PB 2AROC 5JRGC 5AV6D 1ID3B 1JFIA 4DRAA 5CP6D 3AZNC 4Z66D 1HQ3C 3MVDD 3AZHC 2JSSA 4LD9A 3B0DC 4H9SA 3X1SC 3WKJA 2YFWB 3LZ0B 4UUZA 4ZBJC 4G92C 3VH6W 3VH6A 4ZUXD 1P34D 3LJAC 1S32A 4J8WD 3AZKB 5JA4B 3AV2B 2FFFB 5GSUB 5CP6C 5AVBA 4Z66C 3KXBA 3MGRB 4J8XD 1P3GA 3RELD 4QLCD 4WNNA 5GT0A 4H9RA 1P3BA 3W98A 3X1VD 4ZUXC 3W97A 1H3OB 4J8UA 4H9NA 4E45A 5F99B 1M18B 1T3UA 5BNXA 5CPJB 3AZFD 3REHA 3REIB 2ZY2A 3VH5T 5FUGB 3AZJA 3AZIB 5AV8D 5JRGA 2XD5A 3REJD 1P3OC 1AOID 1TZYD 5B33D 1HQ3A 5CPKA 3LELB 4M6BA 4CSRA 2CWEA 1P3FB 4JJND 3AZEB 3AN2D 4WU8D 3UTAA 5B40D 3C1CC 3KFUG 3AZMD 5B33C 4X23C 1B6WA 3MGPD 2Y2PA 5AY8A 5B2JD 1M19C 3A6NC 3C1BB 1EQZD 3AN2C 3NQJA 2Y2OA 2CV5B 3AL0C 1F1EA 5B1LD 3W96D 4XUJD 4H9QB 5GT3A 5B32B 4R8PA 5DNMA 5GXQA 3AV1D 1P3IC 1EQZC 2PYOC 2G5IC 2RIQA 3AFAA 4XUJC 1ID3D 5B0ZB 2BG1A 4J8VA 2HIOC 3EG5B 4H9NB 5AV6B 4WU9A 3WA9C 1M1AB 3WAAC 3EPHA 3AV2D 4Z5TC 5GSUD 3B6GB 3AZJB 3MGRD 1P34B 2Y2LA 3LZ0C 4J8XB 1M19A 1PZRA 3RELB 1Z2CB 3UT9A 3AZKC 5CPKB 2NZDC 5GSUC 5F99D 1M18D 5B32G 5CPJD 4AWLB 3LZ1C 3UTAB 3REID 1P3IA 3MGSB 1P3LA 3AZID 3MNNC 3AZLA 5CPJC 3TU4B 5B1MD 3LELD 3WTPA 1AOIB 5B31A 1TZYB 1P3FD 3AZED 4R8PB 5AV5A 5DNMB 3KUYC 5GXQB 1KX3B 4Z5TA 2IO5C 3MGQA 5BS7A 3AZMB 3AFAB 3C1BD 3MGPB 5DNNC 5E5AC 2FJ7B 4J8VB 2CV5D 5B2JB 5AV9C 5G49B 3B6FB 5B32D 1BH8A 2NQBC 1B67A 1S32D 3W96B 5C3IB 3EPJA 1P3KC 1ZLAC 3P5JB 5B2IB 4KGCC 5GT0D 5B0ZD 5BT1D 1F66A 4YS3C 2F8NK 3O62C 1A7WA 3VH5W 3VH5A 3AZGC 1U35A 4NE6A 1M1AD 4KUDB 1P3MA 4NFTA 3REHD 3B6GD 3AZJD 5AV6C 5AVCB 1P3LB 4XZQA 3AZLB 3MVDC 3UTBB 1M1AC 5DNNA 4YM6B 5CPIA 5CPKD 3F6TA 1Q9CA 1P34C 1P3AA 2F8NA 4J8WC 5BO0B 5AV5B 2NQBA 4J8XC 3UTAD 1WWIA 1P3PB 3RELC 3X1TB 4QLCC 3MGSD 1KX4A 1P3KA 1ZLAA 3AYWB 5B24A 3X1VC 1KX5B 3REKA 4KGCA 3KWQA 2JCHA 3TU4D 2BYMB 2AROA 5B0YB 4YS3A 3AZFC 2F2AC 3AZNA
chains in the Genus database with same CATH topology
5GT3D 3AZHA 5B1MB 1BH8B 4E44A 5DNMD 4R8PD 5GXQD 1TAFA 3X1SA 1KX3D 5KDMA 5AV8C 3X1UB 1W2EA 5BNVA 3KSYA 3LJAA 3REJC 1AOIC 3W99B 1TZYC 3AFAD 5CP6A 4Z66A 2FJ7D 5CHLB 4J8VD 2Y2IA 3B6FD 4JJNC 1JFIB 4WV4B 2Y2GA 4ZUXA 3V9RA 4WU9D 3WTPE 5B40C 4WU8C 1U35B 4J8WA 3AZMC 4LD9B 3WKJB 3MGPC 2W8SA 4UUZB 3R45A 5B2JC 1S32B 3B6FC 5B2ID 3X1VA 2L5AA 2ZY5A 1P3GB 5AVBB 3KXBB 4HGAB 3UT9D 5B1LC 4WNNB 3W96C 5GT0B 3FDDA 4H9RB 1P3BB 3W98B 1P3OA 3W97B 4KUDD 3AV1C 2F8NB 2HUEC 4J8UB 4WZSB 5BNXB 1KX4B 5AVCD 1P3LD 3REHB 1ID3C 5B24B 2Y2HA 3C1CA 3REJA 3AZLD 5B33A 4X23A 3UTBD 3KWQB 4KUDC 4YM6D 3B0BA 4DRBA 2AROB 5JRGB 3WTPD 3A6NA 5B31D 4JJNA 2Y2NA 3AN2A 4WU8A 1HQ3B 4EO5B 3AV2C 5AV5D 4CSRB 3MGRC 3X1SB 1P3PD 3X1TD 4ZBJB 4G92B 3AYWD 3LJAB 1KX5D 1EQZA 2PYOA 2G5HC 5F99C 1M18C 5AY8B 5B0YD 1P3PC 2F8NH 3X1TC 4XUJA 2F8NG 3NQJB 4CAYA 1BH9A 3NQUA 3V9RB 2HIOA 3REIC 3AV1A 1ULYA 4H9PA 5GT3B 3X1UD 3AZIC 3WA9A 3WAAA 1N1JA 1ID3A 3W99D 5B1MC 3LELC 2J8PA 3LZ0A 2DQNC 1P3FC 3AZEC 1U35D 3AZKA 2RVQD 5JA4A 3AV2A 1P3MD 4LD9D 2NZDA 5GSUA 3WKJD 4WU9B 4H9OA 3IP4C 3LZ1A 3C1BC 3C1CB 1P3GD 5AVBD 4NE3A 1H3OA 4Z2MH 4X23B 3KXBD 2CV5C 4Z2MG 4H9SC 3MNNA 1M18A 1P3BD 5B32C 1M19B 3A6NB 3W98D 5CPJA 3W97D 3UT9B 2F8ND 1S32C 4J8UD 5FUGA 2DF4C 3KXBC 3AZIA 5GT0C 1KX4D 3KUYA 5B24D 5B0ZC 1P3IB 3REKD 2PYOB 5BT1C 2Y2JA 3H0RC 3KWQD 4J8UC 3LELA 3H0LC 2AROD 4G91B 5JRGD 2JE5A 5E5AA 4CAYB 3AZND 3NQUB 3REHC 3AZHD 1HQ3D 5AV9A 3WTPB 3B6GC 3AZJC 5B31B 3X1SD 3WA9B 3WAAB 2VQRA 1N1JB 2BYKA 3LJAD 3C1BA 4Z5TB 2ZY4A 2CV5A 4EO5C 5CPKC 3MGQB 5AY8D 2LY8A 4H9QA 5B32A 4AWLC 3UTAC 1KU5A 3A1IA 3O62A 2NZDB 3MGSC 4H9OB 3AZGA 5AY8C 3LZ1B 5B0ZA 3TU4C 3B0CT 5AV6A 3MNNB 5GT3C 2ZY3A 3MVDA 4R8PC 1P3OD 5DNMC 3EPKA 1M1AA 5GXQC 1KX3C 1F66B 5B31G 3B6GA 1P34A 1P3MB 3AFAC 3KUYB 4J8XA 3VH6T 3C1CD 2FJ7C 3RELA 4QLCA 4J8VC 4X23D 2IO5B 4XZQB 4WU9C 1M19D 3A6ND 4KHAA 5DNNB 5E5AB 4UPKA 5CPIB 5AV9B 5C3IC 3AZFA 3MGSA 1P3AB 5B2IC 2NQBB 2BYKB 1P3ID 2PYOD 3UT9C 3TU4A 5AV8A 4DQYB 1P3KB 1ZLAB 1AOIA 1HTAA 3REKB 4KGCB 1TZYA 1WWSA 2YFVA 2HIOD 1KX3A 4YS3B 3O62B 2Y2QA 5AVCC 3AZNB 1P3LC 3AZHB 5B40A 3AZGB 3WA9D 3AZLC 3WAAD 3AZMA 4G91C 2XD1A 3B0DB 3UTBC 1BFMA 1TAFB 3MGPA 4Z5TD 4YM6C 5KDMB 2FJ7A 5BNVB 5B2JA 3WTPC 3MGQD 5G49A 3B6FA 5B31C 3LZ0D 5CP6B 4Z66B 3MVDB 3EPLA 5AV5C 5B1LA 3AZKD 3W96A 2NZDD 4ZUXB 4NE5A 3AYWC 3MGQC 1KX5C 4J8WB 5BS7C 5B2IA 3LZ1D 3R45B 4QLCB 5B0YC 3MNND 3X1VB 4KUDA 1R4VA 4KHAB 1F66D 2YFWA 3X1UC 1P3OB 3AZFB 5AVCA 3W99C 3KUYD 3MGRA 3UTBA 2UWXA 4YM6A 5AV8B 2ZM5A 1F66C 4XZQD 3REJB 5B33B 1U35C 2RVQC 4LD9C 1P3MC 5BO0A 5E5AD 5DNND 3WKJC 2Y2KA 2YFVB 5F99A 5CPID 5AV9D 1P3PA 3X1TA 3A1KA 4JJNB 2Y2MA 3AN2B 1P3AD 4WU8B 4XZQC 3AYWA 5B40B 3REIA 1KX5A 2NQBD 1P3GC 5AVBC 4HGAC 2BYMA 5CPIC 1P3KD 5B0YA 1P3BC 1ZLAD 3W98C 1EQZB 4KGCD 3W97C 1P3AC 5B1MA 4WJ3C 5B1LB 4YS3D 3H0MC 4XUJB 3O62D 1P3FA 3AZEA 3X1UA 1KX4C 1BH9B 2HIOB 5B24C 3AZGD 3B0CW 2HUEB 3REKC 3AV1B 3W99A 3KWQC 4H9PB 2AROC 5JRGC 5AV6D 1ID3B 1JFIA 4DRAA 5CP6D 3AZNC 4Z66D 1HQ3C 3MVDD 3AZHC 2JSSA 4LD9A 3B0DC 4H9SA 3X1SC 3WKJA 2YFWB 3LZ0B 4UUZA 4ZBJC 4G92C 3VH6W 3VH6A 4ZUXD 1P34D 3LJAC 1S32A 4J8WD 3AZKB 5JA4B 3AV2B 2FFFB 5GSUB 5CP6C 5AVBA 4Z66C 3KXBA 3MGRB 4J8XD 1P3GA 3RELD 4QLCD 4WNNA 5GT0A 4H9RA 1P3BA 3W98A 3X1VD 4ZUXC 3W97A 1H3OB 4J8UA 4H9NA 4E45A 5F99B 1M18B 1T3UA 5BNXA 5CPJB 3AZFD 3REHA 3REIB 2ZY2A 3VH5T 5FUGB 3AZJA 3AZIB 5AV8D 5JRGA 2XD5A 3REJD 1P3OC 1AOID 1TZYD 5B33D 1HQ3A 5CPKA 3LELB 4M6BA 4CSRA 2CWEA 1P3FB 4JJND 3AZEB 3AN2D 4WU8D 3UTAA 5B40D 3C1CC 3KFUG 3AZMD 5B33C 4X23C 1B6WA 3MGPD 2Y2PA 5AY8A 5B2JD 1M19C 3A6NC 3C1BB 1EQZD 3AN2C 3NQJA 2Y2OA 2CV5B 3AL0C 1F1EA 5B1LD 3W96D 4XUJD 4H9QB 5GT3A 5B32B 4R8PA 5DNMA 5GXQA 3AV1D 1P3IC 1EQZC 2PYOC 2G5IC 2RIQA 3AFAA 4XUJC 1ID3D 5B0ZB 2BG1A 4J8VA 2HIOC 3EG5B 4H9NB 5AV6B 4WU9A 3WA9C 1M1AB 3WAAC 3EPHA 3AV2D 4Z5TC 5GSUD 3B6GB 3AZJB 3MGRD 1P34B 2Y2LA 3LZ0C 4J8XB 1M19A 1PZRA 3RELB 1Z2CB 3UT9A 3AZKC 5CPKB 2NZDC 5GSUC 5F99D 1M18D 5B32G 5CPJD 4AWLB 3LZ1C 3UTAB 3REID 1P3IA 3MGSB 1P3LA 3AZID 3MNNC 3AZLA 5CPJC 3TU4B 5B1MD 3LELD 3WTPA 1AOIB 5B31A 1TZYB 1P3FD 3AZED 4R8PB 5AV5A 5DNMB 3KUYC 5GXQB 1KX3B 4Z5TA 2IO5C 3MGQA 5BS7A 3AZMB 3AFAB 3C1BD 3MGPB 5DNNC 5E5AC 2FJ7B 4J8VB 2CV5D 5B2JB 5AV9C 5G49B 3B6FB 5B32D 1BH8A 2NQBC 1B67A 1S32D 3W96B 5C3IB 3EPJA 1P3KC 1ZLAC 3P5JB 5B2IB 4KGCC 5GT0D 5B0ZD 5BT1D 1F66A 4YS3C 2F8NK 3O62C 1A7WA 3VH5W 3VH5A 3AZGC 1U35A 4NE6A 1M1AD 4KUDB 1P3MA 4NFTA 3REHD 3B6GD 3AZJD 5AV6C 5AVCB 1P3LB 4XZQA 3AZLB 3MVDC 3UTBB 1M1AC 5DNNA 4YM6B 5CPIA 5CPKD 3F6TA 1Q9CA 1P34C 1P3AA 2F8NA 4J8WC 5BO0B 5AV5B 2NQBA 4J8XC 3UTAD 1WWIA 1P3PB 3RELC 3X1TB 4QLCC 3MGSD 1KX4A 1P3KA 1ZLAA 3AYWB 5B24A 3X1VC 1KX5B 3REKA 4KGCA 3KWQA 2JCHA 3TU4D 2BYMB 2AROA 5B0YB 4YS3A 3AZFC 2F2AC 3AZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT3 D;  3AZH A;  5B1M B;  1BH8 B;  4E44 A;  5DNM D;  4R8P D;  5GXQ D;  1TAF A;  3X1S A;  1KX3 D;  5KDM A;  5AV8 C;  3X1U B;  5BNV A;  3KSY A;  3LJA A;  3REJ C;  1AOI C;  3W99 B;  1TZY C;  3AFA D;  5CP6 A;  4Z66 A;  2FJ7 D;  5CHL B;  4J8V D;  3B6F D;  4JJN C;  1JFI B;  4WV4 B;  4ZUX A;  4WU9 D;  3V9R A;  3WTP E;  4WU8 C;  5B40 C;  1U35 B;  4J8W A;  3AZM C;  4LD9 B;  3WKJ B;  3MGP C;  4UUZ B;  3R45 A;  5B2J C;  1S32 B;  3B6F C;  5B2I D;  3X1V A;  2L5A A;  1P3G B;  5AVB B;  3KXB B;  4HGA B;  3UT9 D;  5B1L C;  4WNN B;  3W96 C;  5GT0 B;  4H9R B;  1P3B B;  3W98 B;  1P3O A;  3W97 B;  4KUD D;  3AV1 C;  2F8N B;  2HUE C;  4J8U B;  4WZS B;  5BNX B;  1KX4 B;  5AVC D;  1P3L D;  3REH B;  1ID3 C;  5B24 B;  3C1C A;  3REJ A;  3AZL D;  5B33 A;  4X23 A;  3UTB D;  3KWQ B;  4KUD C;  4YM6 D;  3B0B A;  4DRB A;  2ARO B;  5JRG B;  3WTP D;  3A6N A;  5B31 D;  4JJN A;  3AN2 A;  4WU8 A;  1HQ3 B;  4EO5 B;  3AV2 C;  5AV5 D;  4CSR B;  3MGR C;  3X1S B;  1P3P D;  3X1T D;  4ZBJ B;  4G92 B;  3AYW D;  3LJA B;  1KX5 D;  1EQZ A;  2PYO A;  5F99 C;  1M18 C;  5AY8 B;  5B0Y D;  1P3P C;  2F8N H;  3X1T C;  4XUJ A;  2F8N G;  3NQJ B;  4CAY A;  1BH9 A;  3NQU A;  3V9R B;  2HIO A;  3REI C;  3AV1 A;  1ULY A;  4H9P A;  5GT3 B;  3X1U D;  3AZI C;  3WA9 A;  3WAA A;  1N1J A;  1ID3 A;  3W99 D;  5B1M C;  3LEL C;  3LZ0 A;  1P3F C;  3AZE C;  1U35 D;  3AZK A;  2RVQ D;  5JA4 A;  3AV2 A;  1P3M D;  4LD9 D;  2NZD A;  5GSU A;  3WKJ D;  4WU9 B;  4H9O A;  3LZ1 A;  3C1B C;  3C1C B;  1P3G D;  5AVB D;  4NE3 A;  1H3O A;  4Z2M H;  4X23 B;  3KXB D;  2CV5 C;  4Z2M G;  4H9S C;  3MNN A;  1M18 A;  1P3B D;  5B32 C;  1M19 B;  3A6N B;  3W98 D;  5CPJ A;  3W97 D;  3UT9 B;  2F8N D;  1S32 C;  4J8U D;  5FUG A;  3KXB C;  3AZI A;  5GT0 C;  1KX4 D;  3KUY A;  5B0Z C;  5B24 D;  1P3I B;  3REK D;  2PYO B;  5BT1 C;  3KWQ D;  4J8U C;  3LEL A;  2ARO D;  4G91 B;  5JRG D;  5E5A A;  4CAY B;  3AZN D;  3NQU B;  3REH C;  3AZH D;  1HQ3 D;  5AV9 A;  3WTP B;  3B6G C;  3AZJ C;  5B31 B;  3X1S D;  3WA9 B;  3WAA B;  1N1J B;  2BYK A;  3LJA D;  3C1B A;  4Z5T B;  2CV5 A;  4EO5 C;  5CPK C;  3MGQ B;  5AY8 D;  2LY8 A;  4H9Q A;  5B32 A;  4AWL C;  3UTA C;  1KU5 A;  3O62 A;  2NZD B;  3MGS C;  4H9O B;  3AZG A;  5AY8 C;  3LZ1 B;  5B0Z A;  3TU4 C;  3B0C T;  5AV6 A;  3MNN B;  5GT3 C;  3MVD A;  1M1A A;  4R8P C;  1P3O D;  5DNM C;  5GXQ C;  1KX3 C;  1F66 B;  5B31 G;  3B6G A;  1P34 A;  1P3M B;  3AFA C;  3KUY B;  4J8X A;  3VH6 T;  3C1C D;  2FJ7 C;  3REL A;  4QLC A;  4J8V C;  4X23 D;  2IO5 B;  4XZQ B;  4WU9 C;  1M19 D;  3A6N D;  4KHA A;  5DNN B;  5E5A B;  5CPI B;  5AV9 B;  5C3I C;  3AZF A;  3MGS A;  1P3A B;  5B2I C;  2NQB B;  2BYK B;  1P3I D;  2PYO D;  3UT9 C;  3TU4 A;  5AV8 A;  1P3K B;  1ZLA B;  1AOI A;  1HTA A;  3REK B;  4KGC B;  1TZY A;  1WWS A;  2YFV A;  2HIO D;  1KX3 A;  4YS3 B;  3O62 B;  5AVC C;  3AZN B;  1P3L C;  3AZH B;  5B40 A;  3AZG B;  3WA9 D;  3AZL C;  3WAA D;  3AZM A;  4G91 C;  1BFM A;  3B0D B;  3UTB C;  1TAF B;  3MGP A;  4Z5T D;  4YM6 C;  5KDM B;  2FJ7 A;  5BNV B;  5B2J A;  3WTP C;  3MGQ D;  5G49 A;  3B6F A;  5B31 C;  3LZ0 D;  5CP6 B;  4Z66 B;  3MVD B;  5AV5 C;  5B1L A;  3AZK D;  3W96 A;  2NZD D;  4ZUX B;  4NE5 A;  3AYW C;  3MGQ C;  1KX5 C;  4J8W B;  5BS7 C;  5B2I A;  3LZ1 D;  3R45 B;  4QLC B;  5B0Y C;  3MNN D;  3X1V B;  4KUD A;  1R4V A;  4KHA B;  1F66 D;  2YFW A;  3X1U C;  1P3O B;  3AZF B;  5AVC A;  3W99 C;  3KUY D;  3MGR A;  3UTB A;  4YM6 A;  5AV8 B;  1F66 C;  4XZQ D;  3REJ B;  5B33 B;  1U35 C;  2RVQ C;  4LD9 C;  1P3M C;  5BO0 A;  5E5A D;  5DNN D;  3WKJ C;  2YFV B;  5F99 A;  5CPI D;  5AV9 D;  1P3P A;  3X1T A;  4JJN B;  3AN2 B;  1P3A D;  4WU8 B;  4XZQ C;  3AYW A;  5B40 B;  3REI A;  1KX5 A;  2NQB D;  1P3G C;  5AVB C;  4HGA C;  2BYM A;  5CPI C;  1P3K D;  5B0Y A;  1P3B C;  1ZLA D;  3W98 C;  1EQZ B;  4KGC D;  3W97 C;  1P3A C;  5B1M A;  5B1L B;  4YS3 D;  4XUJ B;  3O62 D;  1P3F A;  3AZE A;  3X1U A;  1KX4 C;  1BH9 B;  2HIO B;  5B24 C;  3AZG D;  3B0C W;  2HUE B;  3REK C;  3AV1 B;  3W99 A;  3KWQ C;  4H9P B;  2ARO C;  5JRG C;  5AV6 D;  1ID3 B;  1JFI A;  4DRA A;  5CP6 D;  3AZN C;  4Z66 D;  1HQ3 C;  3MVD D;  3AZH C;  2JSS A;  4LD9 A;  3B0D C;  4H9S A;  3X1S C;  3WKJ A;  2YFW B;  3LZ0 B;  4UUZ A;  4ZBJ C;  4G92 C;  3VH6 W;  3VH6 A;  4ZUX D;  1P34 D;  3LJA C;  1S32 A;  4J8W D;  3AZK B;  5JA4 B;  3AV2 B;  5GSU B;  5CP6 C;  5AVB A;  4J8X D;  4Z66 C;  3KXB A;  3MGR B;  1P3G A;  3REL D;  4QLC D;  4WNN A;  5GT0 A;  4H9R A;  1P3B A;  3W98 A;  3X1V D;  4ZUX C;  3W97 A;  1H3O B;  4J8U A;  4H9N A;  4E45 A;  5F99 B;  1M18 B;  5BNX A;  5CPJ B;  3AZF D;  3REH A;  3REI B;  3VH5 T;  5FUG B;  3AZJ A;  3AZI B;  5AV8 D;  5JRG A;  3REJ D;  1P3O C;  1AOI D;  1TZY D;  5B33 D;  1HQ3 A;  5CPK A;  3LEL B;  4M6B A;  4CSR A;  2CWE A;  1P3F B;  4JJN D;  3AZE B;  3AN2 D;  4WU8 D;  3UTA A;  5B40 D;  3C1C C;  3AZM D;  5B33 C;  4X23 C;  1B6W A;  3MGP D;  5AY8 A;  5B2J D;  1M19 C;  3A6N C;  3C1B B;  1EQZ D;  3AN2 C;  3NQJ A;  2CV5 B;  1F1E A;  5B1L D;  3W96 D;  4XUJ D;  4H9Q B;  5GT3 A;  5B32 B;  4R8P A;  5DNM A;  5GXQ A;  3AV1 D;  1P3I C;  1EQZ C;  2PYO C;  3AFA A;  4XUJ C;  1ID3 D;  5B0Z B;  4J8V A;  2HIO C;  4H9N B;  5AV6 B;  4WU9 A;  3WA9 C;  1M1A B;  3WAA C;  3AV2 D;  4Z5T C;  5GSU D;  3B6G B;  3AZJ B;  3MGR D;  1P34 B;  3LZ0 C;  4J8X B;  1M19 A;  3REL B;  3UT9 A;  3AZK C;  5CPK B;  2NZD C;  5GSU C;  5F99 D;  1M18 D;  5B32 G;  5CPJ D;  4AWL B;  3LZ1 C;  3UTA B;  3REI D;  1P3I A;  3MGS B;  1P3L A;  3AZI D;  3MNN C;  3AZL A;  5CPJ C;  3TU4 B;  5B1M D;  3LEL D;  3WTP A;  1AOI B;  5B31 A;  1TZY B;  1P3F D;  3AZE D;  4R8P B;  5AV5 A;  5DNM B;  3KUY C;  5GXQ B;  1KX3 B;  4Z5T A;  2IO5 C;  3MGQ A;  5BS7 A;  3AZM B;  3AFA B;  3C1B D;  3MGP B;  5DNN C;  5E5A C;  2FJ7 B;  4J8V B;  2CV5 D;  5B2J B;  5AV9 C;  5G49 B;  3B6F B;  5B32 D;  1BH8 A;  2NQB C;  1B67 A;  1S32 D;  3W96 B;  5C3I B;  1P3K C;  1ZLA C;  5B2I B;  4KGC C;  5GT0 D;  5B0Z D;  5BT1 D;  1F66 A;  4YS3 C;  2F8N K;  3O62 C;  1A7W A;  3VH5 W;  3VH5 A;  3AZG C;  1U35 A;  4NE6 A;  1M1A D;  4KUD B;  1P3M A;  4NFT A;  3REH D;  3B6G D;  3AZJ D;  5AV6 C;  5AVC B;  1P3L B;  4XZQ A;  3AZL B;  3MVD C;  3UTB B;  1M1A C;  5DNN A;  4YM6 B;  5CPI A;  5CPK D;  1Q9C A;  1P34 C;  1P3A A;  2F8N A;  4J8W C;  5BO0 B;  5AV5 B;  2NQB A;  4J8X C;  3UTA D;  1WWI A;  1P3P B;  3REL C;  3X1T B;  4QLC C;  3MGS D;  1KX4 A;  1P3K A;  1ZLA A;  3AYW B;  5B24 A;  3X1V C;  1KX5 B;  3REK A;  4KGC A;  3KWQ A;  3TU4 D;  2BYM B;  2ARO A;  5B0Y B;  4YS3 A;  3AZF C;  3AZN A; 
#chains in the Genus database with same CATH topology
 5GT3 D;  3AZH A;  5B1M B;  1BH8 B;  4E44 A;  5DNM D;  4R8P D;  5GXQ D;  1TAF A;  3X1S A;  1KX3 D;  5KDM A;  5AV8 C;  3X1U B;  1W2E A;  5BNV A;  3KSY A;  3LJA A;  3REJ C;  1AOI C;  3W99 B;  1TZY C;  3AFA D;  5CP6 A;  4Z66 A;  2FJ7 D;  5CHL B;  4J8V D;  2Y2I A;  3B6F D;  4JJN C;  1JFI B;  4WV4 B;  2Y2G A;  4ZUX A;  3V9R A;  4WU9 D;  3WTP E;  5B40 C;  4WU8 C;  1U35 B;  4J8W A;  3AZM C;  4LD9 B;  3WKJ B;  3MGP C;  2W8S A;  4UUZ B;  3R45 A;  5B2J C;  1S32 B;  3B6F C;  5B2I D;  3X1V A;  2L5A A;  2ZY5 A;  1P3G B;  5AVB B;  3KXB B;  4HGA B;  3UT9 D;  5B1L C;  4WNN B;  3W96 C;  5GT0 B;  3FDD A;  4H9R B;  1P3B B;  3W98 B;  1P3O A;  3W97 B;  4KUD D;  3AV1 C;  2F8N B;  2HUE C;  4J8U B;  4WZS B;  5BNX B;  1KX4 B;  5AVC D;  1P3L D;  3REH B;  1ID3 C;  5B24 B;  2Y2H A;  3C1C A;  3REJ A;  3AZL D;  5B33 A;  4X23 A;  3UTB D;  3KWQ B;  4KUD C;  4YM6 D;  3B0B A;  4DRB A;  2ARO B;  5JRG B;  3WTP D;  3A6N A;  5B31 D;  4JJN A;  2Y2N A;  3AN2 A;  4WU8 A;  1HQ3 B;  4EO5 B;  3AV2 C;  5AV5 D;  4CSR B;  3MGR C;  3X1S B;  1P3P D;  3X1T D;  4ZBJ B;  4G92 B;  3AYW D;  3LJA B;  1KX5 D;  1EQZ A;  2PYO A;  2G5H C;  5F99 C;  1M18 C;  5AY8 B;  5B0Y D;  1P3P C;  2F8N H;  3X1T C;  4XUJ A;  2F8N G;  3NQJ B;  4CAY A;  1BH9 A;  3NQU A;  3V9R B;  2HIO A;  3REI C;  3AV1 A;  1ULY A;  4H9P A;  5GT3 B;  3X1U D;  3AZI C;  3WA9 A;  3WAA A;  1N1J A;  1ID3 A;  3W99 D;  5B1M C;  3LEL C;  2J8P A;  3LZ0 A;  2DQN C;  1P3F C;  3AZE C;  1U35 D;  3AZK A;  2RVQ D;  5JA4 A;  3AV2 A;  1P3M D;  4LD9 D;  2NZD A;  5GSU A;  3WKJ D;  4WU9 B;  4H9O A;  3IP4 C;  3LZ1 A;  3C1B C;  3C1C B;  1P3G D;  5AVB D;  4NE3 A;  1H3O A;  4Z2M H;  4X23 B;  3KXB D;  2CV5 C;  4Z2M G;  4H9S C;  3MNN A;  1M18 A;  1P3B D;  5B32 C;  1M19 B;  3A6N B;  3W98 D;  5CPJ A;  3W97 D;  3UT9 B;  2F8N D;  1S32 C;  4J8U D;  5FUG A;  2DF4 C;  3KXB C;  3AZI A;  5GT0 C;  1KX4 D;  3KUY A;  5B24 D;  5B0Z C;  1P3I B;  3REK D;  2PYO B;  5BT1 C;  2Y2J A;  3H0R C;  3KWQ D;  4J8U C;  3LEL A;  3H0L C;  2ARO D;  4G91 B;  5JRG D;  2JE5 A;  5E5A A;  4CAY B;  3AZN D;  3NQU B;  3REH C;  3AZH D;  1HQ3 D;  5AV9 A;  3WTP B;  3B6G C;  3AZJ C;  5B31 B;  3X1S D;  3WA9 B;  3WAA B;  2VQR A;  1N1J B;  2BYK A;  3LJA D;  3C1B A;  4Z5T B;  2ZY4 A;  2CV5 A;  4EO5 C;  5CPK C;  3MGQ B;  5AY8 D;  2LY8 A;  4H9Q A;  5B32 A;  4AWL C;  3UTA C;  1KU5 A;  3A1I A;  3O62 A;  2NZD B;  3MGS C;  4H9O B;  3AZG A;  5AY8 C;  3LZ1 B;  5B0Z A;  3TU4 C;  3B0C T;  5AV6 A;  3MNN B;  5GT3 C;  2ZY3 A;  3MVD A;  4R8P C;  1P3O D;  5DNM C;  3EPK A;  1M1A A;  5GXQ C;  1KX3 C;  1F66 B;  5B31 G;  3B6G A;  1P34 A;  1P3M B;  3AFA C;  3KUY B;  4J8X A;  3VH6 T;  3C1C D;  2FJ7 C;  3REL A;  4QLC A;  4J8V C;  4X23 D;  2IO5 B;  4XZQ B;  4WU9 C;  1M19 D;  3A6N D;  4KHA A;  5DNN B;  5E5A B;  4UPK A;  5CPI B;  5AV9 B;  5C3I C;  3AZF A;  3MGS A;  1P3A B;  5B2I C;  2NQB B;  2BYK B;  1P3I D;  2PYO D;  3UT9 C;  3TU4 A;  5AV8 A;  4DQY B;  1P3K B;  1ZLA B;  1AOI A;  1HTA A;  3REK B;  4KGC B;  1TZY A;  1WWS A;  2YFV A;  2HIO D;  1KX3 A;  4YS3 B;  3O62 B;  2Y2Q A;  5AVC C;  3AZN B;  1P3L C;  3AZH B;  5B40 A;  3AZG B;  3WA9 D;  3AZL C;  3WAA D;  3AZM A;  4G91 C;  2XD1 A;  3B0D B;  3UTB C;  1BFM A;  1TAF B;  3MGP A;  4Z5T D;  4YM6 C;  5KDM B;  2FJ7 A;  5BNV B;  5B2J A;  3WTP C;  3MGQ D;  5G49 A;  3B6F A;  5B31 C;  3LZ0 D;  5CP6 B;  4Z66 B;  3MVD B;  3EPL A;  5AV5 C;  5B1L A;  3AZK D;  3W96 A;  2NZD D;  4ZUX B;  4NE5 A;  3AYW C;  3MGQ C;  1KX5 C;  4J8W B;  5BS7 C;  5B2I A;  3LZ1 D;  3R45 B;  4QLC B;  5B0Y C;  3MNN D;  3X1V B;  4KUD A;  1R4V A;  4KHA B;  1F66 D;  2YFW A;  3X1U C;  1P3O B;  3AZF B;  5AVC A;  3W99 C;  3KUY D;  3MGR A;  3UTB A;  2UWX A;  4YM6 A;  5AV8 B;  2ZM5 A;  1F66 C;  4XZQ D;  3REJ B;  5B33 B;  1U35 C;  2RVQ C;  4LD9 C;  1P3M C;  5BO0 A;  5E5A D;  5DNN D;  3WKJ C;  2Y2K A;  2YFV B;  5F99 A;  5CPI D;  5AV9 D;  1P3P A;  3X1T A;  3A1K A;  4JJN B;  2Y2M A;  3AN2 B;  1P3A D;  4WU8 B;  4XZQ C;  3AYW A;  5B40 B;  3REI A;  1KX5 A;  2NQB D;  1P3G C;  5AVB C;  4HGA C;  2BYM A;  5CPI C;  1P3K D;  5B0Y A;  1P3B C;  1ZLA D;  3W98 C;  1EQZ B;  4KGC D;  3W97 C;  1P3A C;  5B1M A;  4WJ3 C;  5B1L B;  4YS3 D;  3H0M C;  4XUJ B;  3O62 D;  1P3F A;  3AZE A;  3X1U A;  1KX4 C;  1BH9 B;  2HIO B;  5B24 C;  3AZG D;  3B0C W;  2HUE B;  3REK C;  3AV1 B;  3W99 A;  3KWQ C;  4H9P B;  2ARO C;  5JRG C;  5AV6 D;  1ID3 B;  1JFI A;  4DRA A;  5CP6 D;  3AZN C;  4Z66 D;  1HQ3 C;  3MVD D;  3AZH C;  2JSS A;  4LD9 A;  3B0D C;  4H9S A;  3X1S C;  3WKJ A;  2YFW B;  3LZ0 B;  4UUZ A;  4ZBJ C;  4G92 C;  3VH6 W;  3VH6 A;  4ZUX D;  1P34 D;  3LJA C;  1S32 A;  4J8W D;  3AZK B;  5JA4 B;  3AV2 B;  2FFF B;  5GSU B;  5CP6 C;  5AVB A;  4Z66 C;  3KXB A;  3MGR B;  4J8X D;  1P3G A;  3REL D;  4QLC D;  4WNN A;  5GT0 A;  4H9R A;  1P3B A;  3W98 A;  3X1V D;  4ZUX C;  3W97 A;  1H3O B;  4J8U A;  4H9N A;  4E45 A;  5F99 B;  1M18 B;  1T3U A;  5BNX A;  5CPJ B;  3AZF D;  3REH A;  3REI B;  2ZY2 A;  3VH5 T;  5FUG B;  3AZJ A;  3AZI B;  5AV8 D;  5JRG A;  2XD5 A;  3REJ D;  1P3O C;  1AOI D;  1TZY D;  5B33 D;  1HQ3 A;  5CPK A;  3LEL B;  4M6B A;  4CSR A;  2CWE A;  1P3F B;  4JJN D;  3AZE B;  3AN2 D;  4WU8 D;  3UTA A;  5B40 D;  3C1C C;  3KFU G;  3AZM D;  5B33 C;  4X23 C;  1B6W A;  3MGP D;  2Y2P A;  5AY8 A;  5B2J D;  1M19 C;  3A6N C;  3C1B B;  1EQZ D;  3AN2 C;  3NQJ A;  2Y2O A;  2CV5 B;  3AL0 C;  1F1E A;  5B1L D;  3W96 D;  4XUJ D;  4H9Q B;  5GT3 A;  5B32 B;  4R8P A;  5DNM A;  5GXQ A;  3AV1 D;  1P3I C;  1EQZ C;  2PYO C;  2G5I C;  2RIQ A;  3AFA A;  4XUJ C;  1ID3 D;  5B0Z B;  2BG1 A;  4J8V A;  2HIO C;  3EG5 B;  4H9N B;  5AV6 B;  4WU9 A;  3WA9 C;  1M1A B;  3WAA C;  3EPH A;  3AV2 D;  4Z5T C;  5GSU D;  3B6G B;  3AZJ B;  3MGR D;  1P34 B;  2Y2L A;  3LZ0 C;  4J8X B;  1M19 A;  1PZR A;  3REL B;  1Z2C B;  3UT9 A;  3AZK C;  5CPK B;  2NZD C;  5GSU C;  5F99 D;  1M18 D;  5B32 G;  5CPJ D;  4AWL B;  3LZ1 C;  3UTA B;  3REI D;  1P3I A;  3MGS B;  1P3L A;  3AZI D;  3MNN C;  3AZL A;  5CPJ C;  3TU4 B;  5B1M D;  3LEL D;  3WTP A;  1AOI B;  5B31 A;  1TZY B;  1P3F D;  3AZE D;  4R8P B;  5AV5 A;  5DNM B;  3KUY C;  5GXQ B;  1KX3 B;  4Z5T A;  2IO5 C;  3MGQ A;  5BS7 A;  3AZM B;  3AFA B;  3C1B D;  3MGP B;  5DNN C;  5E5A C;  2FJ7 B;  4J8V B;  2CV5 D;  5B2J B;  5AV9 C;  5G49 B;  3B6F B;  5B32 D;  1BH8 A;  2NQB C;  1B67 A;  1S32 D;  3W96 B;  5C3I B;  3EPJ A;  1P3K C;  1ZLA C;  3P5J B;  5B2I B;  4KGC C;  5GT0 D;  5B0Z D;  5BT1 D;  1F66 A;  4YS3 C;  2F8N K;  3O62 C;  1A7W A;  3VH5 W;  3VH5 A;  3AZG C;  1U35 A;  4NE6 A;  1M1A D;  4KUD B;  1P3M A;  4NFT A;  3REH D;  3B6G D;  3AZJ D;  5AV6 C;  5AVC B;  1P3L B;  4XZQ A;  3AZL B;  3MVD C;  3UTB B;  1M1A C;  5DNN A;  4YM6 B;  5CPI A;  5CPK D;  3F6T A;  1Q9C A;  1P34 C;  1P3A A;  2F8N A;  4J8W C;  5BO0 B;  5AV5 B;  2NQB A;  4J8X C;  3UTA D;  1WWI A;  1P3P B;  3REL C;  3X1T B;  4QLC C;  3MGS D;  1KX4 A;  1P3K A;  1ZLA A;  3AYW B;  5B24 A;  3X1V C;  1KX5 B;  3REK A;  4KGC A;  3KWQ A;  2JCH A;  3TU4 D;  2BYM B;  2ARO A;  5B0Y B;  4YS3 A;  3AZF C;  2F2A C;  3AZN A; 
#chains in the Genus database with same CATH homology
 5GT3 D;  3AZH A;  5B1M B;  1BH8 B;  4E44 A;  5DNM D;  4R8P D;  5GXQ D;  1TAF A;  3X1S A;  1KX3 D;  5KDM A;  5AV8 C;  3X1U B;  1W2E A;  5BNV A;  3KSY A;  3LJA A;  3REJ C;  1AOI C;  3W99 B;  1TZY C;  3AFA D;  5CP6 A;  4Z66 A;  2FJ7 D;  5CHL B;  4J8V D;  2Y2I A;  3B6F D;  4JJN C;  1JFI B;  4WV4 B;  2Y2G A;  4ZUX A;  3V9R A;  4WU9 D;  3WTP E;  5B40 C;  4WU8 C;  1U35 B;  4J8W A;  3AZM C;  4LD9 B;  3WKJ B;  3MGP C;  2W8S A;  4UUZ B;  3R45 A;  5B2J C;  1S32 B;  3B6F C;  5B2I D;  3X1V A;  2L5A A;  2ZY5 A;  1P3G B;  5AVB B;  3KXB B;  4HGA B;  3UT9 D;  5B1L C;  4WNN B;  3W96 C;  5GT0 B;  3FDD A;  4H9R B;  1P3B B;  3W98 B;  1P3O A;  3W97 B;  4KUD D;  3AV1 C;  2F8N B;  2HUE C;  4J8U B;  4WZS B;  5BNX B;  1KX4 B;  5AVC D;  1P3L D;  3REH B;  1ID3 C;  5B24 B;  2Y2H A;  3C1C A;  3REJ A;  3AZL D;  5B33 A;  4X23 A;  3UTB D;  3KWQ B;  4KUD C;  4YM6 D;  3B0B A;  4DRB A;  2ARO B;  5JRG B;  3WTP D;  3A6N A;  5B31 D;  4JJN A;  2Y2N A;  3AN2 A;  4WU8 A;  1HQ3 B;  4EO5 B;  3AV2 C;  5AV5 D;  4CSR B;  3MGR C;  3X1S B;  1P3P D;  3X1T D;  4ZBJ B;  4G92 B;  3AYW D;  3LJA B;  1KX5 D;  1EQZ A;  2PYO A;  2G5H C;  5F99 C;  1M18 C;  5AY8 B;  5B0Y D;  1P3P C;  2F8N H;  3X1T C;  4XUJ A;  2F8N G;  3NQJ B;  4CAY A;  1BH9 A;  3NQU A;  3V9R B;  2HIO A;  3REI C;  3AV1 A;  1ULY A;  4H9P A;  5GT3 B;  3X1U D;  3AZI C;  3WA9 A;  3WAA A;  1N1J A;  1ID3 A;  3W99 D;  5B1M C;  3LEL C;  2J8P A;  3LZ0 A;  2DQN C;  1P3F C;  3AZE C;  1U35 D;  3AZK A;  2RVQ D;  5JA4 A;  3AV2 A;  1P3M D;  4LD9 D;  2NZD A;  5GSU A;  3WKJ D;  4WU9 B;  4H9O A;  3IP4 C;  3LZ1 A;  3C1B C;  3C1C B;  1P3G D;  5AVB D;  4NE3 A;  1H3O A;  4Z2M H;  4X23 B;  3KXB D;  2CV5 C;  4Z2M G;  4H9S C;  3MNN A;  1M18 A;  1P3B D;  5B32 C;  1M19 B;  3A6N B;  3W98 D;  5CPJ A;  3W97 D;  3UT9 B;  2F8N D;  1S32 C;  4J8U D;  5FUG A;  2DF4 C;  3KXB C;  3AZI A;  5GT0 C;  1KX4 D;  3KUY A;  5B24 D;  5B0Z C;  1P3I B;  3REK D;  2PYO B;  5BT1 C;  2Y2J A;  3H0R C;  3KWQ D;  4J8U C;  3LEL A;  3H0L C;  2ARO D;  4G91 B;  5JRG D;  2JE5 A;  5E5A A;  4CAY B;  3AZN D;  3NQU B;  3REH C;  3AZH D;  1HQ3 D;  5AV9 A;  3WTP B;  3B6G C;  3AZJ C;  5B31 B;  3X1S D;  3WA9 B;  3WAA B;  2VQR A;  1N1J B;  2BYK A;  3LJA D;  3C1B A;  4Z5T B;  2ZY4 A;  2CV5 A;  4EO5 C;  5CPK C;  3MGQ B;  5AY8 D;  2LY8 A;  4H9Q A;  5B32 A;  4AWL C;  3UTA C;  1KU5 A;  3A1I A;  3O62 A;  2NZD B;  3MGS C;  4H9O B;  3AZG A;  5AY8 C;  3LZ1 B;  5B0Z A;  3TU4 C;  3B0C T;  5AV6 A;  3MNN B;  5GT3 C;  2ZY3 A;  3MVD A;  4R8P C;  1P3O D;  5DNM C;  3EPK A;  1M1A A;  5GXQ C;  1KX3 C;  1F66 B;  5B31 G;  3B6G A;  1P34 A;  1P3M B;  3AFA C;  3KUY B;  4J8X A;  3VH6 T;  3C1C D;  2FJ7 C;  3REL A;  4QLC A;  4J8V C;  4X23 D;  2IO5 B;  4XZQ B;  4WU9 C;  1M19 D;  3A6N D;  4KHA A;  5DNN B;  5E5A B;  4UPK A;  5CPI B;  5AV9 B;  5C3I C;  3AZF A;  3MGS A;  1P3A B;  5B2I C;  2NQB B;  2BYK B;  1P3I D;  2PYO D;  3UT9 C;  3TU4 A;  5AV8 A;  4DQY B;  1P3K B;  1ZLA B;  1AOI A;  1HTA A;  3REK B;  4KGC B;  1TZY A;  1WWS A;  2YFV A;  2HIO D;  1KX3 A;  4YS3 B;  3O62 B;  2Y2Q A;  5AVC C;  3AZN B;  1P3L C;  3AZH B;  5B40 A;  3AZG B;  3WA9 D;  3AZL C;  3WAA D;  3AZM A;  4G91 C;  2XD1 A;  3B0D B;  3UTB C;  1BFM A;  1TAF B;  3MGP A;  4Z5T D;  4YM6 C;  5KDM B;  2FJ7 A;  5BNV B;  5B2J A;  3WTP C;  3MGQ D;  5G49 A;  3B6F A;  5B31 C;  3LZ0 D;  5CP6 B;  4Z66 B;  3MVD B;  3EPL A;  5AV5 C;  5B1L A;  3AZK D;  3W96 A;  2NZD D;  4ZUX B;  4NE5 A;  3AYW C;  3MGQ C;  1KX5 C;  4J8W B;  5BS7 C;  5B2I A;  3LZ1 D;  3R45 B;  4QLC B;  5B0Y C;  3MNN D;  3X1V B;  4KUD A;  1R4V A;  4KHA B;  1F66 D;  2YFW A;  3X1U C;  1P3O B;  3AZF B;  5AVC A;  3W99 C;  3KUY D;  3MGR A;  3UTB A;  2UWX A;  4YM6 A;  5AV8 B;  2ZM5 A;  1F66 C;  4XZQ D;  3REJ B;  5B33 B;  1U35 C;  2RVQ C;  4LD9 C;  1P3M C;  5BO0 A;  5E5A D;  5DNN D;  3WKJ C;  2Y2K A;  2YFV B;  5F99 A;  5CPI D;  5AV9 D;  1P3P A;  3X1T A;  3A1K A;  4JJN B;  2Y2M A;  3AN2 B;  1P3A D;  4WU8 B;  4XZQ C;  3AYW A;  5B40 B;  3REI A;  1KX5 A;  2NQB D;  1P3G C;  5AVB C;  4HGA C;  2BYM A;  5CPI C;  1P3K D;  5B0Y A;  1P3B C;  1ZLA D;  3W98 C;  1EQZ B;  4KGC D;  3W97 C;  1P3A C;  5B1M A;  4WJ3 C;  5B1L B;  4YS3 D;  3H0M C;  4XUJ B;  3O62 D;  1P3F A;  3AZE A;  3X1U A;  1KX4 C;  1BH9 B;  2HIO B;  5B24 C;  3AZG D;  3B0C W;  2HUE B;  3REK C;  3AV1 B;  3W99 A;  3KWQ C;  4H9P B;  2ARO C;  5JRG C;  5AV6 D;  1ID3 B;  1JFI A;  4DRA A;  5CP6 D;  3AZN C;  4Z66 D;  1HQ3 C;  3MVD D;  3AZH C;  2JSS A;  4LD9 A;  3B0D C;  4H9S A;  3X1S C;  3WKJ A;  2YFW B;  3LZ0 B;  4UUZ A;  4ZBJ C;  4G92 C;  3VH6 W;  3VH6 A;  4ZUX D;  1P34 D;  3LJA C;  1S32 A;  4J8W D;  3AZK B;  5JA4 B;  3AV2 B;  2FFF B;  5GSU B;  5CP6 C;  5AVB A;  4Z66 C;  3KXB A;  3MGR B;  4J8X D;  1P3G A;  3REL D;  4QLC D;  4WNN A;  5GT0 A;  4H9R A;  1P3B A;  3W98 A;  3X1V D;  4ZUX C;  3W97 A;  1H3O B;  4J8U A;  4H9N A;  4E45 A;  5F99 B;  1M18 B;  1T3U A;  5BNX A;  5CPJ B;  3AZF D;  3REH A;  3REI B;  2ZY2 A;  3VH5 T;  5FUG B;  3AZJ A;  3AZI B;  5AV8 D;  5JRG A;  2XD5 A;  3REJ D;  1P3O C;  1AOI D;  1TZY D;  5B33 D;  1HQ3 A;  5CPK A;  3LEL B;  4M6B A;  4CSR A;  2CWE A;  1P3F B;  4JJN D;  3AZE B;  3AN2 D;  4WU8 D;  3UTA A;  5B40 D;  3C1C C;  3KFU G;  3AZM D;  5B33 C;  4X23 C;  1B6W A;  3MGP D;  2Y2P A;  5AY8 A;  5B2J D;  1M19 C;  3A6N C;  3C1B B;  1EQZ D;  3AN2 C;  3NQJ A;  2Y2O A;  2CV5 B;  3AL0 C;  1F1E A;  5B1L D;  3W96 D;  4XUJ D;  4H9Q B;  5GT3 A;  5B32 B;  4R8P A;  5DNM A;  5GXQ A;  3AV1 D;  1P3I C;  1EQZ C;  2PYO C;  2G5I C;  2RIQ A;  3AFA A;  4XUJ C;  1ID3 D;  5B0Z B;  2BG1 A;  4J8V A;  2HIO C;  3EG5 B;  4H9N B;  5AV6 B;  4WU9 A;  3WA9 C;  1M1A B;  3WAA C;  3EPH A;  3AV2 D;  4Z5T C;  5GSU D;  3B6G B;  3AZJ B;  3MGR D;  1P34 B;  2Y2L A;  3LZ0 C;  4J8X B;  1M19 A;  1PZR A;  3REL B;  1Z2C B;  3UT9 A;  3AZK C;  5CPK B;  2NZD C;  5GSU C;  5F99 D;  1M18 D;  5B32 G;  5CPJ D;  4AWL B;  3LZ1 C;  3UTA B;  3REI D;  1P3I A;  3MGS B;  1P3L A;  3AZI D;  3MNN C;  3AZL A;  5CPJ C;  3TU4 B;  5B1M D;  3LEL D;  3WTP A;  1AOI B;  5B31 A;  1TZY B;  1P3F D;  3AZE D;  4R8P B;  5AV5 A;  5DNM B;  3KUY C;  5GXQ B;  1KX3 B;  4Z5T A;  2IO5 C;  3MGQ A;  5BS7 A;  3AZM B;  3AFA B;  3C1B D;  3MGP B;  5DNN C;  5E5A C;  2FJ7 B;  4J8V B;  2CV5 D;  5B2J B;  5AV9 C;  5G49 B;  3B6F B;  5B32 D;  1BH8 A;  2NQB C;  1B67 A;  1S32 D;  3W96 B;  5C3I B;  3EPJ A;  1P3K C;  1ZLA C;  3P5J B;  5B2I B;  4KGC C;  5GT0 D;  5B0Z D;  5BT1 D;  1F66 A;  4YS3 C;  2F8N K;  3O62 C;  1A7W A;  3VH5 W;  3VH5 A;  3AZG C;  1U35 A;  4NE6 A;  1M1A D;  4KUD B;  1P3M A;  4NFT A;  3REH D;  3B6G D;  3AZJ D;  5AV6 C;  5AVC B;  1P3L B;  4XZQ A;  3AZL B;  3MVD C;  3UTB B;  1M1A C;  5DNN A;  4YM6 B;  5CPI A;  5CPK D;  3F6T A;  1Q9C A;  1P34 C;  1P3A A;  2F8N A;  4J8W C;  5BO0 B;  5AV5 B;  2NQB A;  4J8X C;  3UTA D;  1WWI A;  1P3P B;  3REL C;  3X1T B;  4QLC C;  3MGS D;  1KX4 A;  1P3K A;  1ZLA A;  3AYW B;  5B24 A;  3X1V C;  1KX5 B;  3REK A;  4KGC A;  3KWQ A;  2JCH A;  3TU4 D;  2BYM B;  2ARO A;  5B0Y B;  4YS3 A;  3AZF C;  2F2A C;  3AZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...