2NZDC

Nucleosome core particle containing 145 bp of dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdC00
1AOIC 1KX5C 1ZLAC 3B6FD 2NZDC 1BFMA 4HGAB 5CHLB 3C1BD 4WNNB 5DNNB 2F8NB 3B6GC 5CPKB 5CPJA 1P3ID 3WTPA 2YFWB 5GXQC 5CPIB 5AVBB 3NQJA 5B40A 5AV9A 3W99C 5B33D 4UUZB 4XUJD 3X1TA 1P3PB 1P3OB 4NE5A 1WWSA 1JFIB 4JJNA 1M1AC 4E45A 1P3FA 3TU4B 3LELD 4H9SA 3AZGB 4YM6C 4Z5TB 3AZFC 2CV5B 2F8ND 3AZIC 3B0DB 5AV6B 4J8WB 5CPKD 1M19C 5B31G 4G91C 3UTAC 1KX5A 5AY8B 1B67A 2AROB 5CPID 1F1EA 5G49A 3B6GA 1P3LB 4H9NA 4WZSB 3WA9C 1ID3D 4G92B 5B31B 3AZJB 4H9OB 3KUYC 1BH8B 3B0CW 5B0ZB 3R45B 3LZ0C 3AZED 3O62C 1F66B 5F99A 5B24C 3REHB 3REJA 4ZUXB 5GT3B 3TU4D 3W99A 3KSYA 3X1VA 3V9RB 1TAFA 4Z66B 2L5AA 5BS7C 4J8VB 2F8NH 1M1AA 3W98D 3RELD 2CV5D 2NQBD 3WAAB 4KUDC 1TZYC 4J8WD 4YM6A 5JRGD 5CP6C 1S32C 2AROD 3AZFA 5BNXA 5B1LA 2HUEB 3AFAC 3B6FC 3AZIA 5DNMB 3AZHB 1M19A 3UTAA 3AV2C 5B31D 3C1CB 2RVQC 3REKC 1P3BB 5KDMB 4X23B 3MGPB 1F66D 3REHD 4WU9C 4ZUXD 2PYOD 3KXBD 4KHAA 3KUYA 3MNNB 5B33C 1P3MC 5BNVA 5B24A 3AZKA 1P3AD 5AVCB 1EQZB 1P3GB 4QLCD 5B0YB 4NE6A 2IO5C 3X1UB 1M18A 5BS7A 3UT9C 1U35B 4H9QB 4KUDA 5DNMD 1TZYA 3A6NB 3VH5W 5GSUD 5DNNC 5FUGA 3AN2B 1KX4B 4XZQC 3C1CD 1S32A 1P3BD 5B32B 3AFAA 4X23D 3AZNB 4LD9B 5B2JC 3LJAB 3AV2A 5AVBC 3REKA 1ULYA 2HIOA 3LZ1B 1KX3C 4WU9A 1P3PC 5AVCD 1P3OC 3VH5T 1EQZD 5F99D 4J8UB 3X1SD 3REJD 1P3GD 5B0YD 1P3MA 4J8XB 3X1UD 3AZGC 1U35D 4Z5TC 5B2IC 2CV5C 3A6ND 5BO0B 3REIA 3KWQB 4WU8C 4YS3D 3AZMA 3AN2D 5AV8B 1KX4D 1R4VA 3UT9A 5AV6C 4J8WC 1P34B 1P3KA 5AY8C 2AROC 5B1LD 3AZND 5DNNA 1P3LC 4XZQA 4G92C 5B31C 3AZJC 3AZLB 4H9RA 5B0ZC 4KGCB 3LELB 4H9PA 5B2JA 3WKJD 3WTPE 4J8UD 4ZUXC 5GT3C 1KX3A 3MVDB 1BH9B 4E44A 4UUZA 4R8PB 4J8XD 1P3PA 1P3OA 3AZKD 4Z66C 1JFIA 2BYKB 3WAAC 4J8VC 4CAYB 3KWQD 5AV8D 5AV5C 3MGSB 1P34D 3MGQA 1ID3B 4Z5TA 1M18D 5B2IA 3AYWA 1HQ3B 4WU8A 3AZEB 4DRBA 3MGRD 3AZHC 4DRAA 1WWIA 5AY8A 3AZLD 1Q9CA 5GT0B 4KGCD 1P3BC 4X23C 3MGPC 1P3LA 2BYMB 1HTAA 5B1MA 3AZJA 3W98B 3RELB 2NQBB 5B0ZA 3MVDD 3MNNC 4R8PD 5E5AC 3W97C 1AOIA 5AVCC 5JRGB 2FJ7A 3B0BA 3AV1D 1ZLAA 3W96D 5GT3A 2NZDA 3VH6A 5B0YC 3MGSD 3X1UC 4J8VA 5GXQA 1HQ3D 5AV5A 3A6NC 3REID 1KX4C 2PYOB 5GT0D 3KXBB 3NQJB 5B32C 5AV9B 2YFVA 3AZHA 1P3AB 4LD9C 3X1TB 3LJAC 3LZ1C 4QLCB 1P3FB 2FJ7D 3UTBD 4NFTA 4CSRA 5E5AA 3W97A 5GSUB 3C1BC 5CPJD 1KX5B 3WTPD 1P3IC 5G49B 3WA9A 3B6GB 5BT1D 3MGQD 5AV9D 5B40D 3LZ0A 3O62A 4XUJC 3X1TD 4NE3A 5F99B 3REJB 3X1SB 5B32A 4JJND 3AZLC 1P3FD 3W99B 4Z2MG 3LELC 4LD9A 3NQUB 3X1VB 3LZ1A 1M1AB 4HGAC 4YS3B 5CP6A 2LY8A 5CPKC 4YM6B 1KX5D 1ZLAD 3B6FA 5CPIC 5B1LB 5BNXB 2NZDD 3C1BA 1N1JB 3B6GD 3AZIB 5JA4B 1ID3C 4AWLB 3UTAB 4G91B 1P3IA 5GXQD 1H3OA 3AZEC 3WKJB 3W99D 5B33A 3TU4C 4XUJA 5BNVB 3X1VD 5B24B 3AZKB 3W98C 1M1AD 3RELC 2NQBC 3B0DC 4YM6D 5JRGC 1M18B 3AZFD 1BH9A 4KUDB 4WNNA 3AZID 2F8NA 1TZYB 3MGRB 5CPKA 1M19D 3UTAD 5FUGB 4EO5B 1S32B 2F8NK 2YFWA 5CPIA 3AFAB 1F66C 1KU5A 3REHC 5AVBA 1ID3A 2PYOC 3KXBC 3KUYD 5AV9C 2HIOB 3O62D 5B24D 4M6BA 4WU9B 1P3AC 3AV1B 4Z2MH 2CWEA 3W96B 3TU4A 4QLCC 3AZGA 3W98A 2JSSA 3RELA 2CV5A 2HUEC 4KUDD 5DNMC 1TZYD 3REIB 5GSUC 5AV6A 4J8WA 5JRGA 3AZMB 3C1CC 3UT9B 2AROA 1S32D 1P3KB 3AFAD 3AV2D 5B31A 4XZQB 4H9OA 2RVQD 3REKD 1BH8A 2HIOD 3R45A 1F66A 4H9RB 4WU9D 4ZBJC 3REHA 4H9PB 4ZUXA 5B2JB 2FJ7B 1EQZC 2PYOA 5F99C 3KXBA 3UTBB 3REJC 3X1SC 1P3GC 1P3MD 1KX3B 3V9RA 4Z66A 1P3AA 5C3IB 3WAAA 3X1VC 1U35C 5CPJB 3WTPB 4QLCA 4YS3C 3AZMD 3AN2C 3UT9D 1P3KD 3MGQB 5B2IB 5B40B 5B1LC 5DNMA 1A7WA 5GSUA 3AYWB 4WU8B 3AZNC 5DNND 3VH5A 1B6WA 4XZQD 3C1CA 4AWLC 1P3BA 5KDMA 4JJNB 4X23A 3MGPA 5B2JD 3WKJC 5AVBD 4J8UC 5B1MB 3MNNA 1KX3D 4J8XC 1P3OD 5AVCA 1P3PD 4ZBJB 1EQZA 3AZKC 1AOIB 3X1SA 1ZLAB 1P3GA 5B0YA 2NZDB 3KWQC 3X1UA 5AV8C 4H9NB 3AZGD 3NQUA 1P34C 1U35A 4Z5TD 1M18C 4H9QA 5B2ID 5GXQB 3A6NA 3AYWD 4WU8D 4YS3A 5AV5B 3B0CT 3AN2A 1KX4A 3MGRC 5AV6D 4EO5C 5AY8D 4KGCC 1N1JA 2YFVB 3AZNA 5JA4A 3LJAA 1P3LD 1TAFB 5B1MD 3AZJD 5B0ZD 3MVDC 2HIOC 4R8PC 3WKJA 1AOID 4J8UA 3AV1C 3W96C 5GT3D 3VH6W 4CSRB 3AZFB 4J8XA 5E5AB 3MGSC 3W97B 4Z66D 1M19B 4J8VD 3WAAD 5BO0A 1HQ3C 3KWQA 5AV5D 5AV8A 3REIC 1P34A 3WA9B 3AZMC 1P3KC 5B32G 4KHAB 5GT0C 3KUYB 3VH6T 3LZ0B 3O62B 3AZHD 3MGRA 3AZLA 4KGCA 4WV4B 3LELA 3MGPD 2FJ7C 3UTBC 3MNND 3MVDA 4R8PA 5E5AD 3W97D 2BYKA 5C3IC 3AV1A 3W96A 5CP6B 5CPJC 4CAYA 3WTPC 3B6FB 3MGSA 3WA9D 3C1BB 5BT1C 3AV2B 3MGQC 3REKB 1HQ3A 5B40C 1P3IB 3LZ0D 3AZEA 3AYWC 1H3OB 3X1TC 5GT0A 5B32D 4JJNC 1P3FC 5B33B 1P3MB 2BYMA 4LD9D 4XUJB 4H9SC 3LJAD 2NQBA 5B1MC 3LZ1D 2F8NG 2IO5B 5CP6D 3UTBA
chains in the Genus database with same CATH superfamily
1AOIC 1KX5C 1ZLAC 3B6FD 2NZDC 2Y2QA 1BFMA 4HGAB 5CHLB 3C1BD 4WNNB 5DNNB 2F8NB 3B6GC 2RIQA 5CPKB 5CPJA 1P3ID 3WTPA 2YFWB 5GXQC 5CPIB 5AVBB 3NQJA 5B40A 5AV9A 3W99C 5B33D 4UUZB 4XUJD 3X1TA 1P3PB 1P3OB 4WJ3C 2Y2HA 4NE5A 1WWSA 1JFIB 4JJNA 1M1AC 4E45A 1P3FA 3TU4B 2Y2JA 3LELD 4H9SA 3AZGB 2Y2GA 4YM6C 4Z5TB 3AZFC 2CV5B 2F8ND 3AZIC 3B0DB 5AV6B 4J8WB 5CPKD 1M19C 5B31G 4G91C 3UTAC 1KX5A 5AY8B 1B67A 2AROB 5CPID 1F1EA 5G49A 3B6GA 3F6TA 4H9NA 1P3LB 4WZSB 3WA9C 1ID3D 4G92B 3P5JB 5B31B 3AZJB 4H9OB 2ZY4A 3KUYC 1BH8B 3B0CW 5B0ZB 3R45B 3LZ0C 3AZED 3O62C 1F66B 5F99A 5B24C 3REHB 3REJA 4ZUXB 5GT3B 3TU4D 3W99A 3KSYA 3X1VA 3V9RB 2ZM5A 1TAFA 4Z66B 2L5AA 5BS7C 2XD5A 4J8VB 1M1AA 2F8NH 3RELD 2CV5D 2NQBD 3W98D 3WAAB 4KUDC 1TZYC 4J8WD 4YM6A 5JRGD 5CP6C 1S32C 2AROD 3AZFA 5BNXA 5B1LA 2HUEB 3AFAC 3B6FC 3AZIA 5DNMB 3AZHB 1M19A 3UTAA 3AV2C 5B31D 3C1CB 2RVQC 3REKC 1P3BB 5KDMB 4X23B 3MGPB 1F66D 3REHD 4WU9C 4ZUXD 2PYOD 3KXBD 4KHAA 3KUYA 3MNNB 5B33C 1P3MC 5BNVA 5B24A 3AZKA 1P3AD 5AVCB 1EQZB 1P3GB 4QLCD 5B0YB 4NE6A 2IO5C 3X1UB 1M18A 5BS7A 3UT9C 1U35B 4H9QB 4KUDA 5DNMD 1TZYA 3A6NB 3VH5W 5GSUD 5DNNC 5FUGA 3AN2B 1KX4B 4XZQC 3C1CD 1S32A 1P3BD 5B32B 3AFAA 2Y2MA 4X23D 3AZNB 4LD9B 5B2JC 3LJAB 3AV2A 5AVBC 3REKA 1ULYA 2HIOA 3LZ1B 1KX3C 4WU9A 1P3PC 5AVCD 1P3OC 3VH5T 1EQZD 5F99D 4J8UB 3X1SD 3REJD 1P3GD 5B0YD 1P3MA 1W2EA 4J8XB 3X1UD 3AZGC 1U35D 2Y2OA 4Z5TC 5B2IC 2CV5C 3A6ND 5BO0B 3REIA 3KWQB 4WU8C 4YS3D 3AZMA 3AN2D 5AV8B 1KX4D 1R4VA 3UT9A 5AV6C 4J8WC 1P34B 1P3KA 2Y2NA 3FDDA 5AY8C 2AROC 5B1LD 3AZND 5DNNA 1P3LC 2ZY3A 4XZQA 4G92C 5B31C 3AZJC 3AZLB 2ZY5A 4H9RA 5B0ZC 4KGCB 3LELB 4H9PA 5B2JA 3WKJD 3WTPE 4J8UD 4ZUXC 5GT3C 1KX3A 3MVDB 1BH9B 4E44A 4UUZA 4R8PB 4J8XD 3EPLA 1P3PA 1P3OA 3AZKD 4DQYB 4Z66C 1JFIA 2BYKB 3A1KA 3WAAC 4J8VC 4CAYB 3KWQD 5AV8D 5AV5C 3MGSB 1P34D 3MGQA 1ID3B 4Z5TA 1M18D 5B2IA 3H0MC 3AYWA 1HQ3B 4WU8A 3AZEB 4DRBA 3MGRD 3AZHC 4DRAA 1WWIA 5AY8A 3AZLD 1Q9CA 5GT0B 4KGCD 1P3BC 4X23C 2JE5A 3MGPC 1P3LA 2BYMB 1HTAA 5B1MA 3AZJA 3W98B 3RELB 2NQBB 5B0ZA 3MVDD 3MNNC 4R8PD 5E5AC 3W97C 1AOIA 5AVCC 5JRGB 2FJ7A 3B0BA 3AV1D 1ZLAA 3W96D 5GT3A 2NZDA 3VH6A 5B0YC 3MGSD 3X1UC 4J8VA 2DF4C 5GXQA 1HQ3D 5AV5A 3A6NC 3REID 1KX4C 2PYOB 5GT0D 3KXBB 3NQJB 5B32C 5AV9B 2YFVA 3EG5B 3AZHA 1P3AB 4LD9C 3X1TB 3LJAC 3LZ1C 4QLCB 1P3FB 2Y2PA 2FJ7D 3UTBD 4NFTA 4CSRA 5E5AA 3W97A 5GSUB 3C1BC 5CPJD 1KX5B 3WTPD 1P3IC 2BG1A 5G49B 3WA9A 3B6GB 5BT1D 3MGQD 5B40D 5AV9D 3LZ0A 3O62A 4XUJC 3X1TD 4NE3A 3EPJA 2F2AC 5F99B 3REJB 3X1SB 5B32A 4JJND 3AZLC 1P3FD 3W99B 4Z2MG 3LELC 4LD9A 3NQUB 3X1VB 2DQNC 3LZ1A 1M1AB 4HGAC 4YS3B 3A1IA 5CP6A 2LY8A 5CPKC 4YM6B 1KX5D 1ZLAD 3B6FA 5CPIC 5B1LB 5BNXB 2NZDD 3C1BA 1N1JB 3B6GD 3AZIB 5JA4B 1ID3C 4AWLB 3UTAB 4G91B 1P3IA 5GXQD 1H3OA 3AZEC 3KFUG 3WKJB 1Z2CB 3W99D 5B33A 3TU4C 4XUJA 5BNVB 3X1VD 5B24B 3AZKB 3W98C 1M1AD 3RELC 2NQBC 1T3UA 3B0DC 4YM6D 5JRGC 1M18B 3AZFD 1BH9A 4KUDB 4WNNA 3AZID 2F8NA 1TZYB 3MGRB 5CPKA 1M19D 3UTAD 5FUGB 4EO5B 1S32B 2F8NK 2YFWA 5CPIA 3AFAB 1F66C 1KU5A 3REHC 5AVBA 1ID3A 2PYOC 3KXBC 1PZRA 3KUYD 5AV9C 2HIOB 3O62D 5B24D 4M6BA 4WU9B 1P3AC 3AV1B 4Z2MH 2CWEA 3W96B 3TU4A 4QLCC 3AZGA 4UPKA 3W98A 2JSSA 3RELA 2CV5A 2HUEC 4KUDD 5DNMC 1TZYD 3REIB 5GSUC 5AV6A 4J8WA 5JRGA 3AZMB 3C1CC 3UT9B 2AROA 1S32D 1P3KB 3AFAD 3AV2D 5B31A 4XZQB 4H9OA 2RVQD 3REKD 1BH8A 2HIOD 3R45A 1F66A 4H9RB 4ZBJC 4WU9D 3REHA 4H9PB 4ZUXA 5B2JB 2UWXA 1EQZC 2FJ7B 5F99C 3KXBA 3UTBB 3REJC 3X1SC 2PYOA 1P3GC 1P3MD 1KX3B 3V9RA 4Z66A 1P3AA 5C3IB 3WAAA 3X1VC 1U35C 5CPJB 3WTPB 2G5HC 4QLCA 4YS3C 3AZMD 3AN2C 3UT9D 1P3KD 3MGQB 5B2IB 5B40B 5B1LC 5DNMA 1A7WA 5GSUA 3AYWB 4WU8B 3AZNC 5DNND 3VH5A 1B6WA 4XZQD 3C1CA 4AWLC 1P3BA 5KDMA 4JJNB 4X23A 3MGPA 2Y2LA 5B2JD 3WKJC 5AVBD 4J8UC 5B1MB 3MNNA 1KX3D 4J8XC 1P3OD 5AVCA 1P3PD 4ZBJB 1EQZA 3IP4C 3AZKC 1AOIB 3X1SA 1ZLAB 1P3GA 5B0YA 2NZDB 3KWQC 3X1UA 5AV8C 4H9NB 3AZGD 3NQUA 1P34C 1U35A 4Z5TD 1M18C 4H9QA 5B2ID 5GXQB 3A6NA 3AYWD 2Y2IA 4WU8D 4YS3A 5AV5B 3B0CT 3AN2A 1KX4A 3MGRC 5AV6D 4EO5C 5AY8D 2Y2KA 4KGCC 1N1JA 2YFVB 3AZNA 5JA4A 3LJAA 1P3LD 1TAFB 3AL0C 5B1MD 3AZJD 5B0ZD 3H0RC 3MVDC 2HIOC 4R8PC 2XD1A 3WKJA 2VQRA 1AOID 4J8UA 3AV1C 3W96C 5GT3D 3VH6W 4CSRB 3AZFB 4J8XA 5E5AB 3MGSC 3W97B 4Z66D 1M19B 4J8VD 3WAAD 3EPHA 5BO0A 1HQ3C 3KWQA 5AV5D 5AV8A 3REIC 1P34A 3WA9B 3AZMC 3EPKA 1P3KC 5B32G 4KHAB 5GT0C 3KUYB 3VH6T 3LZ0B 3O62B 3AZHD 3MGRA 3AZLA 2FFFB 4KGCA 4WV4B 3LELA 3MGPD 2ZY2A 2FJ7C 3UTBC 3MNND 3MVDA 4R8PA 5E5AD 3W97D 2J8PA 2BYKA 5C3IC 3AV1A 3W96A 5CP6B 5CPJC 4CAYA 3WTPC 3B6FB 3MGSA 3WA9D 3C1BB 5BT1C 3AV2B 3MGQC 3REKB 1HQ3A 5B40C 1P3IB 3LZ0D 3AZEA 3AYWC 1H3OB 3X1TC 5GT0A 5B32D 4JJNC 2JCHA 1P3FC 5B33B 1P3MB 2BYMA 4LD9D 4XUJB 4H9SC 3LJAD 2G5IC 3H0LC 2NQBA 5B1MC 3LZ1D 2W8SA 2F8NG 2IO5B 5CP6D 3UTBA
chains in the Genus database with same CATH topology
1AOIC 1KX5C 1ZLAC 3B6FD 2NZDC 2Y2QA 1BFMA 4HGAB 5CHLB 3C1BD 4WNNB 5DNNB 2F8NB 3B6GC 2RIQA 5CPKB 5CPJA 1P3ID 3WTPA 2YFWB 5GXQC 5CPIB 5AVBB 3NQJA 5B40A 5AV9A 3W99C 5B33D 4UUZB 4XUJD 3X1TA 1P3PB 1P3OB 4WJ3C 2Y2HA 4NE5A 1WWSA 1JFIB 4JJNA 1M1AC 4E45A 1P3FA 3TU4B 2Y2JA 3LELD 4H9SA 3AZGB 2Y2GA 4YM6C 4Z5TB 3AZFC 2CV5B 2F8ND 3AZIC 3B0DB 5AV6B 4J8WB 5CPKD 1M19C 5B31G 4G91C 3UTAC 1KX5A 5AY8B 1B67A 2AROB 5CPID 1F1EA 5G49A 3B6GA 3F6TA 4H9NA 1P3LB 4WZSB 3WA9C 1ID3D 4G92B 3P5JB 5B31B 3AZJB 4H9OB 2ZY4A 3KUYC 1BH8B 3B0CW 5B0ZB 3R45B 3LZ0C 3AZED 3O62C 1F66B 5F99A 5B24C 3REHB 3REJA 4ZUXB 5GT3B 3TU4D 3W99A 3KSYA 3X1VA 3V9RB 2ZM5A 1TAFA 4Z66B 2L5AA 5BS7C 2XD5A 4J8VB 1M1AA 2F8NH 3RELD 2CV5D 2NQBD 3W98D 3WAAB 4KUDC 1TZYC 4J8WD 4YM6A 5JRGD 5CP6C 1S32C 2AROD 3AZFA 5BNXA 5B1LA 2HUEB 3AFAC 3B6FC 3AZIA 5DNMB 3AZHB 1M19A 3UTAA 3AV2C 5B31D 3C1CB 2RVQC 3REKC 1P3BB 5KDMB 4X23B 3MGPB 1F66D 3REHD 4WU9C 4ZUXD 2PYOD 3KXBD 4KHAA 3KUYA 3MNNB 5B33C 1P3MC 5BNVA 5B24A 3AZKA 1P3AD 5AVCB 1EQZB 1P3GB 4QLCD 5B0YB 4NE6A 2IO5C 3X1UB 1M18A 5BS7A 3UT9C 1U35B 4H9QB 4KUDA 5DNMD 1TZYA 3A6NB 3VH5W 5GSUD 5DNNC 5FUGA 3AN2B 1KX4B 4XZQC 3C1CD 1S32A 1P3BD 5B32B 3AFAA 2Y2MA 4X23D 3AZNB 4LD9B 5B2JC 3LJAB 3AV2A 5AVBC 3REKA 1ULYA 2HIOA 3LZ1B 1KX3C 4WU9A 1P3PC 5AVCD 1P3OC 3VH5T 1EQZD 5F99D 4J8UB 3X1SD 3REJD 1P3GD 5B0YD 1P3MA 1W2EA 4J8XB 3X1UD 3AZGC 1U35D 2Y2OA 4Z5TC 5B2IC 2CV5C 3A6ND 5BO0B 3REIA 3KWQB 4WU8C 4YS3D 3AZMA 3AN2D 5AV8B 1KX4D 1R4VA 3UT9A 5AV6C 4J8WC 1P34B 1P3KA 2Y2NA 3FDDA 5AY8C 2AROC 5B1LD 3AZND 5DNNA 1P3LC 2ZY3A 4XZQA 4G92C 5B31C 3AZJC 3AZLB 2ZY5A 4H9RA 5B0ZC 4KGCB 3LELB 4H9PA 5B2JA 3WKJD 3WTPE 4J8UD 4ZUXC 5GT3C 1KX3A 3MVDB 1BH9B 4E44A 4UUZA 4R8PB 4J8XD 3EPLA 1P3PA 1P3OA 3AZKD 4DQYB 4Z66C 1JFIA 2BYKB 3A1KA 3WAAC 4J8VC 4CAYB 3KWQD 5AV8D 5AV5C 3MGSB 1P34D 3MGQA 1ID3B 4Z5TA 1M18D 5B2IA 3H0MC 3AYWA 1HQ3B 4WU8A 3AZEB 4DRBA 3MGRD 3AZHC 4DRAA 1WWIA 5AY8A 3AZLD 1Q9CA 5GT0B 4KGCD 1P3BC 4X23C 2JE5A 3MGPC 1P3LA 2BYMB 1HTAA 5B1MA 3AZJA 3W98B 3RELB 2NQBB 5B0ZA 3MVDD 3MNNC 4R8PD 5E5AC 3W97C 1AOIA 5AVCC 5JRGB 2FJ7A 3B0BA 3AV1D 1ZLAA 3W96D 5GT3A 2NZDA 3VH6A 5B0YC 3MGSD 3X1UC 4J8VA 2DF4C 5GXQA 1HQ3D 5AV5A 3A6NC 3REID 1KX4C 2PYOB 5GT0D 3KXBB 3NQJB 5B32C 5AV9B 2YFVA 3EG5B 3AZHA 1P3AB 4LD9C 3X1TB 3LJAC 3LZ1C 4QLCB 1P3FB 2Y2PA 2FJ7D 3UTBD 4NFTA 4CSRA 5E5AA 3W97A 5GSUB 3C1BC 5CPJD 1KX5B 3WTPD 1P3IC 2BG1A 5G49B 3WA9A 3B6GB 5BT1D 3MGQD 5B40D 5AV9D 3LZ0A 3O62A 4XUJC 3X1TD 4NE3A 3EPJA 2F2AC 5F99B 3REJB 3X1SB 5B32A 4JJND 3AZLC 1P3FD 3W99B 4Z2MG 3LELC 4LD9A 3NQUB 3X1VB 2DQNC 3LZ1A 1M1AB 4HGAC 4YS3B 3A1IA 5CP6A 2LY8A 5CPKC 4YM6B 1KX5D 1ZLAD 3B6FA 5CPIC 5B1LB 5BNXB 2NZDD 3C1BA 1N1JB 3B6GD 3AZIB 5JA4B 1ID3C 4AWLB 3UTAB 4G91B 1P3IA 5GXQD 1H3OA 3AZEC 3KFUG 3WKJB 1Z2CB 3W99D 5B33A 3TU4C 4XUJA 5BNVB 3X1VD 5B24B 3AZKB 3W98C 1M1AD 3RELC 2NQBC 1T3UA 3B0DC 4YM6D 5JRGC 1M18B 3AZFD 1BH9A 4KUDB 4WNNA 3AZID 2F8NA 1TZYB 3MGRB 5CPKA 1M19D 3UTAD 5FUGB 4EO5B 1S32B 2F8NK 2YFWA 5CPIA 3AFAB 1F66C 1KU5A 3REHC 5AVBA 1ID3A 2PYOC 3KXBC 1PZRA 3KUYD 5AV9C 2HIOB 3O62D 5B24D 4M6BA 4WU9B 1P3AC 3AV1B 4Z2MH 2CWEA 3W96B 3TU4A 4QLCC 3AZGA 4UPKA 3W98A 2JSSA 3RELA 2CV5A 2HUEC 4KUDD 5DNMC 1TZYD 3REIB 5GSUC 5AV6A 4J8WA 5JRGA 3AZMB 3C1CC 3UT9B 2AROA 1S32D 1P3KB 3AFAD 3AV2D 5B31A 4XZQB 4H9OA 2RVQD 3REKD 1BH8A 2HIOD 3R45A 1F66A 4H9RB 4ZBJC 4WU9D 3REHA 4H9PB 4ZUXA 5B2JB 2UWXA 1EQZC 2FJ7B 5F99C 3KXBA 3UTBB 3REJC 3X1SC 2PYOA 1P3GC 1P3MD 1KX3B 3V9RA 4Z66A 1P3AA 5C3IB 3WAAA 3X1VC 1U35C 5CPJB 3WTPB 2G5HC 4QLCA 4YS3C 3AZMD 3AN2C 3UT9D 1P3KD 3MGQB 5B2IB 5B40B 5B1LC 5DNMA 1A7WA 5GSUA 3AYWB 4WU8B 3AZNC 5DNND 3VH5A 1B6WA 4XZQD 3C1CA 4AWLC 1P3BA 5KDMA 4JJNB 4X23A 3MGPA 2Y2LA 5B2JD 3WKJC 5AVBD 4J8UC 5B1MB 3MNNA 1KX3D 4J8XC 1P3OD 5AVCA 1P3PD 4ZBJB 1EQZA 3IP4C 3AZKC 1AOIB 3X1SA 1ZLAB 1P3GA 5B0YA 2NZDB 3KWQC 3X1UA 5AV8C 4H9NB 3AZGD 3NQUA 1P34C 1U35A 4Z5TD 1M18C 4H9QA 5B2ID 5GXQB 3A6NA 3AYWD 2Y2IA 4WU8D 4YS3A 5AV5B 3B0CT 3AN2A 1KX4A 3MGRC 5AV6D 4EO5C 5AY8D 2Y2KA 4KGCC 1N1JA 2YFVB 3AZNA 5JA4A 3LJAA 1P3LD 1TAFB 3AL0C 5B1MD 3AZJD 5B0ZD 3H0RC 3MVDC 2HIOC 4R8PC 2XD1A 3WKJA 2VQRA 1AOID 4J8UA 3AV1C 3W96C 5GT3D 3VH6W 4CSRB 3AZFB 4J8XA 5E5AB 3MGSC 3W97B 4Z66D 1M19B 4J8VD 3WAAD 3EPHA 5BO0A 1HQ3C 3KWQA 5AV5D 5AV8A 3REIC 1P34A 3WA9B 3AZMC 3EPKA 1P3KC 5B32G 4KHAB 5GT0C 3KUYB 3VH6T 3LZ0B 3O62B 3AZHD 3MGRA 3AZLA 2FFFB 4KGCA 4WV4B 3LELA 3MGPD 2ZY2A 2FJ7C 3UTBC 3MNND 3MVDA 4R8PA 5E5AD 3W97D 2J8PA 2BYKA 5C3IC 3AV1A 3W96A 5CP6B 5CPJC 4CAYA 3WTPC 3B6FB 3MGSA 3WA9D 3C1BB 5BT1C 3AV2B 3MGQC 3REKB 1HQ3A 5B40C 1P3IB 3LZ0D 3AZEA 3AYWC 1H3OB 3X1TC 5GT0A 5B32D 4JJNC 2JCHA 1P3FC 5B33B 1P3MB 2BYMA 4LD9D 4XUJB 4H9SC 3LJAD 2G5IC 3H0LC 2NQBA 5B1MC 3LZ1D 2W8SA 2F8NG 2IO5B 5CP6D 3UTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI C;  1KX5 C;  1ZLA C;  3B6F D;  2NZD C;  1BFM A;  4HGA B;  5CHL B;  3C1B D;  4WNN B;  5DNN B;  2F8N B;  3B6G C;  5CPK B;  5CPJ A;  1P3I D;  3WTP A;  2YFW B;  5GXQ C;  5CPI B;  5AVB B;  3NQJ A;  5B40 A;  5AV9 A;  3W99 C;  5B33 D;  4UUZ B;  4XUJ D;  3X1T A;  1P3P B;  1P3O B;  4NE5 A;  1WWS A;  1JFI B;  4JJN A;  1M1A C;  4E45 A;  1P3F A;  3TU4 B;  3LEL D;  4H9S A;  3AZG B;  4YM6 C;  4Z5T B;  3AZF C;  2CV5 B;  2F8N D;  3AZI C;  3B0D B;  5AV6 B;  4J8W B;  5CPK D;  1M19 C;  5B31 G;  4G91 C;  3UTA C;  1KX5 A;  5AY8 B;  1B67 A;  2ARO B;  5CPI D;  1F1E A;  5G49 A;  3B6G A;  1P3L B;  4H9N A;  4WZS B;  3WA9 C;  1ID3 D;  4G92 B;  5B31 B;  3AZJ B;  4H9O B;  3KUY C;  1BH8 B;  3B0C W;  5B0Z B;  3R45 B;  3LZ0 C;  3AZE D;  3O62 C;  1F66 B;  5F99 A;  5B24 C;  3REH B;  3REJ A;  4ZUX B;  5GT3 B;  3TU4 D;  3W99 A;  3KSY A;  3X1V A;  3V9R B;  1TAF A;  4Z66 B;  2L5A A;  5BS7 C;  4J8V B;  2F8N H;  1M1A A;  3W98 D;  3REL D;  2CV5 D;  2NQB D;  3WAA B;  4KUD C;  1TZY C;  4J8W D;  4YM6 A;  5JRG D;  5CP6 C;  1S32 C;  2ARO D;  3AZF A;  5BNX A;  5B1L A;  2HUE B;  3AFA C;  3B6F C;  3AZI A;  5DNM B;  3AZH B;  1M19 A;  3UTA A;  3AV2 C;  5B31 D;  3C1C B;  2RVQ C;  3REK C;  1P3B B;  5KDM B;  4X23 B;  3MGP B;  1F66 D;  3REH D;  4WU9 C;  4ZUX D;  2PYO D;  3KXB D;  4KHA A;  3KUY A;  3MNN B;  5B33 C;  1P3M C;  5BNV A;  5B24 A;  3AZK A;  1P3A D;  5AVC B;  1EQZ B;  1P3G B;  4QLC D;  5B0Y B;  4NE6 A;  2IO5 C;  3X1U B;  1M18 A;  5BS7 A;  3UT9 C;  1U35 B;  4H9Q B;  4KUD A;  5DNM D;  1TZY A;  3A6N B;  3VH5 W;  5GSU D;  5DNN C;  5FUG A;  3AN2 B;  1KX4 B;  4XZQ C;  3C1C D;  1S32 A;  1P3B D;  5B32 B;  3AFA A;  4X23 D;  3AZN B;  4LD9 B;  5B2J C;  3LJA B;  3AV2 A;  5AVB C;  3REK A;  1ULY A;  2HIO A;  3LZ1 B;  1KX3 C;  4WU9 A;  1P3P C;  5AVC D;  1P3O C;  3VH5 T;  1EQZ D;  5F99 D;  4J8U B;  3X1S D;  3REJ D;  1P3G D;  5B0Y D;  1P3M A;  4J8X B;  3X1U D;  3AZG C;  1U35 D;  4Z5T C;  5B2I C;  2CV5 C;  3A6N D;  5BO0 B;  3REI A;  3KWQ B;  4WU8 C;  4YS3 D;  3AZM A;  3AN2 D;  5AV8 B;  1KX4 D;  1R4V A;  3UT9 A;  5AV6 C;  4J8W C;  1P34 B;  1P3K A;  5AY8 C;  2ARO C;  5B1L D;  3AZN D;  5DNN A;  1P3L C;  4XZQ A;  4G92 C;  5B31 C;  3AZJ C;  3AZL B;  4H9R A;  5B0Z C;  4KGC B;  3LEL B;  4H9P A;  5B2J A;  3WKJ D;  3WTP E;  4J8U D;  4ZUX C;  5GT3 C;  1KX3 A;  3MVD B;  1BH9 B;  4E44 A;  4UUZ A;  4R8P B;  4J8X D;  1P3P A;  1P3O A;  3AZK D;  4Z66 C;  1JFI A;  2BYK B;  3WAA C;  4J8V C;  4CAY B;  3KWQ D;  5AV8 D;  5AV5 C;  3MGS B;  1P34 D;  3MGQ A;  1ID3 B;  4Z5T A;  1M18 D;  5B2I A;  3AYW A;  1HQ3 B;  4WU8 A;  3AZE B;  4DRB A;  3MGR D;  3AZH C;  4DRA A;  1WWI A;  5AY8 A;  3AZL D;  1Q9C A;  5GT0 B;  4KGC D;  1P3B C;  4X23 C;  3MGP C;  1P3L A;  2BYM B;  1HTA A;  5B1M A;  3AZJ A;  3W98 B;  3REL B;  2NQB B;  5B0Z A;  3MVD D;  3MNN C;  4R8P D;  5E5A C;  3W97 C;  1AOI A;  5AVC C;  5JRG B;  2FJ7 A;  3B0B A;  3AV1 D;  1ZLA A;  3W96 D;  5GT3 A;  2NZD A;  3VH6 A;  5B0Y C;  3MGS D;  3X1U C;  4J8V A;  5GXQ A;  1HQ3 D;  5AV5 A;  3A6N C;  3REI D;  1KX4 C;  2PYO B;  5GT0 D;  3KXB B;  3NQJ B;  5B32 C;  5AV9 B;  2YFV A;  3AZH A;  1P3A B;  4LD9 C;  3X1T B;  3LJA C;  3LZ1 C;  4QLC B;  1P3F B;  2FJ7 D;  3UTB D;  4NFT A;  4CSR A;  5E5A A;  3W97 A;  5GSU B;  3C1B C;  5CPJ D;  1KX5 B;  3WTP D;  1P3I C;  5G49 B;  3WA9 A;  3B6G B;  5BT1 D;  3MGQ D;  5AV9 D;  5B40 D;  3LZ0 A;  3O62 A;  4XUJ C;  3X1T D;  4NE3 A;  5F99 B;  3REJ B;  3X1S B;  5B32 A;  4JJN D;  3AZL C;  1P3F D;  3W99 B;  4Z2M G;  3LEL C;  4LD9 A;  3NQU B;  3X1V B;  3LZ1 A;  1M1A B;  4HGA C;  4YS3 B;  5CP6 A;  2LY8 A;  5CPK C;  4YM6 B;  1KX5 D;  1ZLA D;  3B6F A;  5CPI C;  5B1L B;  5BNX B;  2NZD D;  3C1B A;  1N1J B;  3B6G D;  3AZI B;  5JA4 B;  1ID3 C;  4AWL B;  3UTA B;  4G91 B;  1P3I A;  5GXQ D;  1H3O A;  3AZE C;  3WKJ B;  3W99 D;  5B33 A;  3TU4 C;  4XUJ A;  5BNV B;  3X1V D;  5B24 B;  3AZK B;  3W98 C;  1M1A D;  3REL C;  2NQB C;  3B0D C;  4YM6 D;  5JRG C;  1M18 B;  3AZF D;  1BH9 A;  4KUD B;  4WNN A;  3AZI D;  2F8N A;  1TZY B;  3MGR B;  5CPK A;  1M19 D;  3UTA D;  5FUG B;  4EO5 B;  1S32 B;  2F8N K;  2YFW A;  5CPI A;  3AFA B;  1F66 C;  1KU5 A;  3REH C;  5AVB A;  1ID3 A;  2PYO C;  3KXB C;  3KUY D;  5AV9 C;  2HIO B;  3O62 D;  5B24 D;  4M6B A;  4WU9 B;  1P3A C;  3AV1 B;  4Z2M H;  2CWE A;  3W96 B;  3TU4 A;  4QLC C;  3AZG A;  3W98 A;  2JSS A;  3REL A;  2CV5 A;  2HUE C;  4KUD D;  5DNM C;  1TZY D;  3REI B;  5GSU C;  5AV6 A;  4J8W A;  5JRG A;  3AZM B;  3C1C C;  3UT9 B;  2ARO A;  1S32 D;  1P3K B;  3AFA D;  3AV2 D;  5B31 A;  4XZQ B;  4H9O A;  2RVQ D;  3REK D;  1BH8 A;  2HIO D;  3R45 A;  1F66 A;  4H9R B;  4WU9 D;  4ZBJ C;  3REH A;  4H9P B;  4ZUX A;  5B2J B;  2FJ7 B;  1EQZ C;  2PYO A;  5F99 C;  3KXB A;  3UTB B;  3REJ C;  3X1S C;  1P3G C;  1P3M D;  1KX3 B;  3V9R A;  4Z66 A;  1P3A A;  5C3I B;  3WAA A;  3X1V C;  1U35 C;  5CPJ B;  3WTP B;  4QLC A;  4YS3 C;  3AZM D;  3AN2 C;  3UT9 D;  1P3K D;  3MGQ B;  5B2I B;  5B40 B;  5B1L C;  5DNM A;  1A7W A;  5GSU A;  3AYW B;  4WU8 B;  3AZN C;  5DNN D;  3VH5 A;  1B6W A;  4XZQ D;  3C1C A;  4AWL C;  1P3B A;  5KDM A;  4JJN B;  4X23 A;  3MGP A;  5B2J D;  3WKJ C;  5AVB D;  4J8U C;  5B1M B;  3MNN A;  1KX3 D;  4J8X C;  1P3O D;  5AVC A;  1P3P D;  4ZBJ B;  1EQZ A;  3AZK C;  1AOI B;  3X1S A;  1ZLA B;  1P3G A;  5B0Y A;  2NZD B;  3KWQ C;  3X1U A;  5AV8 C;  4H9N B;  3AZG D;  3NQU A;  1P34 C;  1U35 A;  4Z5T D;  1M18 C;  4H9Q A;  5B2I D;  5GXQ B;  3A6N A;  3AYW D;  4WU8 D;  4YS3 A;  5AV5 B;  3B0C T;  3AN2 A;  1KX4 A;  3MGR C;  5AV6 D;  4EO5 C;  5AY8 D;  4KGC C;  1N1J A;  2YFV B;  3AZN A;  5JA4 A;  3LJA A;  1P3L D;  1TAF B;  5B1M D;  3AZJ D;  5B0Z D;  3MVD C;  2HIO C;  4R8P C;  3WKJ A;  1AOI D;  4J8U A;  3AV1 C;  3W96 C;  5GT3 D;  3VH6 W;  4CSR B;  3AZF B;  4J8X A;  5E5A B;  3MGS C;  3W97 B;  4Z66 D;  1M19 B;  4J8V D;  3WAA D;  5BO0 A;  1HQ3 C;  3KWQ A;  5AV5 D;  5AV8 A;  3REI C;  1P34 A;  3WA9 B;  3AZM C;  1P3K C;  5B32 G;  4KHA B;  5GT0 C;  3KUY B;  3VH6 T;  3LZ0 B;  3O62 B;  3AZH D;  3MGR A;  3AZL A;  4KGC A;  4WV4 B;  3LEL A;  3MGP D;  2FJ7 C;  3UTB C;  3MNN D;  3MVD A;  4R8P A;  5E5A D;  3W97 D;  2BYK A;  5C3I C;  3AV1 A;  3W96 A;  5CP6 B;  5CPJ C;  4CAY A;  3WTP C;  3B6F B;  3MGS A;  3WA9 D;  3C1B B;  5BT1 C;  3AV2 B;  3MGQ C;  3REK B;  1HQ3 A;  5B40 C;  1P3I B;  3LZ0 D;  3AZE A;  3AYW C;  1H3O B;  3X1T C;  5GT0 A;  5B32 D;  4JJN C;  1P3F C;  5B33 B;  1P3M B;  2BYM A;  4LD9 D;  4XUJ B;  4H9S C;  3LJA D;  2NQB A;  5B1M C;  3LZ1 D;  2F8N G;  2IO5 B;  5CP6 D;  3UTB A; 
#chains in the Genus database with same CATH topology
 1AOI C;  1KX5 C;  1ZLA C;  3B6F D;  2NZD C;  2Y2Q A;  1BFM A;  4HGA B;  5CHL B;  3C1B D;  4WNN B;  5DNN B;  2F8N B;  3B6G C;  2RIQ A;  5CPK B;  5CPJ A;  1P3I D;  3WTP A;  2YFW B;  5GXQ C;  5CPI B;  5AVB B;  3NQJ A;  5B40 A;  5AV9 A;  3W99 C;  5B33 D;  4UUZ B;  4XUJ D;  3X1T A;  1P3P B;  1P3O B;  4WJ3 C;  2Y2H A;  4NE5 A;  1WWS A;  1JFI B;  4JJN A;  1M1A C;  4E45 A;  1P3F A;  3TU4 B;  2Y2J A;  3LEL D;  4H9S A;  3AZG B;  2Y2G A;  4YM6 C;  4Z5T B;  3AZF C;  2CV5 B;  2F8N D;  3AZI C;  3B0D B;  5AV6 B;  4J8W B;  5CPK D;  1M19 C;  5B31 G;  4G91 C;  3UTA C;  1KX5 A;  5AY8 B;  1B67 A;  2ARO B;  5CPI D;  1F1E A;  5G49 A;  3B6G A;  3F6T A;  4H9N A;  1P3L B;  4WZS B;  3WA9 C;  1ID3 D;  4G92 B;  3P5J B;  5B31 B;  3AZJ B;  4H9O B;  2ZY4 A;  3KUY C;  1BH8 B;  3B0C W;  5B0Z B;  3R45 B;  3LZ0 C;  3AZE D;  3O62 C;  1F66 B;  5F99 A;  5B24 C;  3REH B;  3REJ A;  4ZUX B;  5GT3 B;  3TU4 D;  3W99 A;  3KSY A;  3X1V A;  3V9R B;  2ZM5 A;  1TAF A;  4Z66 B;  2L5A A;  5BS7 C;  2XD5 A;  4J8V B;  1M1A A;  2F8N H;  3REL D;  2CV5 D;  2NQB D;  3W98 D;  3WAA B;  4KUD C;  1TZY C;  4J8W D;  4YM6 A;  5JRG D;  5CP6 C;  1S32 C;  2ARO D;  3AZF A;  5BNX A;  5B1L A;  2HUE B;  3AFA C;  3B6F C;  3AZI A;  5DNM B;  3AZH B;  1M19 A;  3UTA A;  3AV2 C;  5B31 D;  3C1C B;  2RVQ C;  3REK C;  1P3B B;  5KDM B;  4X23 B;  3MGP B;  1F66 D;  3REH D;  4WU9 C;  4ZUX D;  2PYO D;  3KXB D;  4KHA A;  3KUY A;  3MNN B;  5B33 C;  1P3M C;  5BNV A;  5B24 A;  3AZK A;  1P3A D;  5AVC B;  1EQZ B;  1P3G B;  4QLC D;  5B0Y B;  4NE6 A;  2IO5 C;  3X1U B;  1M18 A;  5BS7 A;  3UT9 C;  1U35 B;  4H9Q B;  4KUD A;  5DNM D;  1TZY A;  3A6N B;  3VH5 W;  5GSU D;  5DNN C;  5FUG A;  3AN2 B;  1KX4 B;  4XZQ C;  3C1C D;  1S32 A;  1P3B D;  5B32 B;  3AFA A;  2Y2M A;  4X23 D;  3AZN B;  4LD9 B;  5B2J C;  3LJA B;  3AV2 A;  5AVB C;  3REK A;  1ULY A;  2HIO A;  3LZ1 B;  1KX3 C;  4WU9 A;  1P3P C;  5AVC D;  1P3O C;  3VH5 T;  1EQZ D;  5F99 D;  4J8U B;  3X1S D;  3REJ D;  1P3G D;  5B0Y D;  1P3M A;  1W2E A;  4J8X B;  3X1U D;  3AZG C;  1U35 D;  2Y2O A;  4Z5T C;  5B2I C;  2CV5 C;  3A6N D;  5BO0 B;  3REI A;  3KWQ B;  4WU8 C;  4YS3 D;  3AZM A;  3AN2 D;  5AV8 B;  1KX4 D;  1R4V A;  3UT9 A;  5AV6 C;  4J8W C;  1P34 B;  1P3K A;  2Y2N A;  3FDD A;  5AY8 C;  2ARO C;  5B1L D;  3AZN D;  5DNN A;  1P3L C;  2ZY3 A;  4XZQ A;  4G92 C;  5B31 C;  3AZJ C;  3AZL B;  2ZY5 A;  4H9R A;  5B0Z C;  4KGC B;  3LEL B;  4H9P A;  5B2J A;  3WKJ D;  3WTP E;  4J8U D;  4ZUX C;  5GT3 C;  1KX3 A;  3MVD B;  1BH9 B;  4E44 A;  4UUZ A;  4R8P B;  4J8X D;  3EPL A;  1P3P A;  1P3O A;  3AZK D;  4DQY B;  4Z66 C;  1JFI A;  2BYK B;  3A1K A;  3WAA C;  4J8V C;  4CAY B;  3KWQ D;  5AV8 D;  5AV5 C;  3MGS B;  1P34 D;  3MGQ A;  1ID3 B;  4Z5T A;  1M18 D;  5B2I A;  3H0M C;  3AYW A;  1HQ3 B;  4WU8 A;  3AZE B;  4DRB A;  3MGR D;  3AZH C;  4DRA A;  1WWI A;  5AY8 A;  3AZL D;  1Q9C A;  5GT0 B;  4KGC D;  1P3B C;  4X23 C;  2JE5 A;  3MGP C;  1P3L A;  2BYM B;  1HTA A;  5B1M A;  3AZJ A;  3W98 B;  3REL B;  2NQB B;  5B0Z A;  3MVD D;  3MNN C;  4R8P D;  5E5A C;  3W97 C;  1AOI A;  5AVC C;  5JRG B;  2FJ7 A;  3B0B A;  3AV1 D;  1ZLA A;  3W96 D;  5GT3 A;  2NZD A;  3VH6 A;  5B0Y C;  3MGS D;  3X1U C;  4J8V A;  2DF4 C;  5GXQ A;  1HQ3 D;  5AV5 A;  3A6N C;  3REI D;  1KX4 C;  2PYO B;  5GT0 D;  3KXB B;  3NQJ B;  5B32 C;  5AV9 B;  2YFV A;  3EG5 B;  3AZH A;  1P3A B;  4LD9 C;  3X1T B;  3LJA C;  3LZ1 C;  4QLC B;  1P3F B;  2Y2P A;  2FJ7 D;  3UTB D;  4NFT A;  4CSR A;  5E5A A;  3W97 A;  5GSU B;  3C1B C;  5CPJ D;  1KX5 B;  3WTP D;  1P3I C;  2BG1 A;  5G49 B;  3WA9 A;  3B6G B;  5BT1 D;  3MGQ D;  5B40 D;  5AV9 D;  3LZ0 A;  3O62 A;  4XUJ C;  3X1T D;  4NE3 A;  3EPJ A;  2F2A C;  5F99 B;  3REJ B;  3X1S B;  5B32 A;  4JJN D;  3AZL C;  1P3F D;  3W99 B;  4Z2M G;  3LEL C;  4LD9 A;  3NQU B;  3X1V B;  2DQN C;  3LZ1 A;  1M1A B;  4HGA C;  4YS3 B;  3A1I A;  5CP6 A;  2LY8 A;  5CPK C;  4YM6 B;  1KX5 D;  1ZLA D;  3B6F A;  5CPI C;  5B1L B;  5BNX B;  2NZD D;  3C1B A;  1N1J B;  3B6G D;  3AZI B;  5JA4 B;  1ID3 C;  4AWL B;  3UTA B;  4G91 B;  1P3I A;  5GXQ D;  1H3O A;  3AZE C;  3KFU G;  3WKJ B;  1Z2C B;  3W99 D;  5B33 A;  3TU4 C;  4XUJ A;  5BNV B;  3X1V D;  5B24 B;  3AZK B;  3W98 C;  1M1A D;  3REL C;  2NQB C;  1T3U A;  3B0D C;  4YM6 D;  5JRG C;  1M18 B;  3AZF D;  1BH9 A;  4KUD B;  4WNN A;  3AZI D;  2F8N A;  1TZY B;  3MGR B;  5CPK A;  1M19 D;  3UTA D;  5FUG B;  4EO5 B;  1S32 B;  2F8N K;  2YFW A;  5CPI A;  3AFA B;  1F66 C;  1KU5 A;  3REH C;  5AVB A;  1ID3 A;  2PYO C;  3KXB C;  1PZR A;  3KUY D;  5AV9 C;  2HIO B;  3O62 D;  5B24 D;  4M6B A;  4WU9 B;  1P3A C;  3AV1 B;  4Z2M H;  2CWE A;  3W96 B;  3TU4 A;  4QLC C;  3AZG A;  4UPK A;  3W98 A;  2JSS A;  3REL A;  2CV5 A;  2HUE C;  4KUD D;  5DNM C;  1TZY D;  3REI B;  5GSU C;  5AV6 A;  4J8W A;  5JRG A;  3AZM B;  3C1C C;  3UT9 B;  2ARO A;  1S32 D;  1P3K B;  3AFA D;  3AV2 D;  5B31 A;  4XZQ B;  4H9O A;  2RVQ D;  3REK D;  1BH8 A;  2HIO D;  3R45 A;  1F66 A;  4H9R B;  4ZBJ C;  4WU9 D;  3REH A;  4H9P B;  4ZUX A;  5B2J B;  2UWX A;  1EQZ C;  2FJ7 B;  5F99 C;  3KXB A;  3UTB B;  3REJ C;  3X1S C;  2PYO A;  1P3G C;  1P3M D;  1KX3 B;  3V9R A;  4Z66 A;  1P3A A;  5C3I B;  3WAA A;  3X1V C;  1U35 C;  5CPJ B;  3WTP B;  2G5H C;  4QLC A;  4YS3 C;  3AZM D;  3AN2 C;  3UT9 D;  1P3K D;  3MGQ B;  5B2I B;  5B40 B;  5B1L C;  5DNM A;  1A7W A;  5GSU A;  3AYW B;  4WU8 B;  3AZN C;  5DNN D;  3VH5 A;  1B6W A;  4XZQ D;  3C1C A;  4AWL C;  1P3B A;  5KDM A;  4JJN B;  4X23 A;  3MGP A;  2Y2L A;  5B2J D;  3WKJ C;  5AVB D;  4J8U C;  5B1M B;  3MNN A;  1KX3 D;  4J8X C;  1P3O D;  5AVC A;  1P3P D;  4ZBJ B;  1EQZ A;  3IP4 C;  3AZK C;  1AOI B;  3X1S A;  1ZLA B;  1P3G A;  5B0Y A;  2NZD B;  3KWQ C;  3X1U A;  5AV8 C;  4H9N B;  3AZG D;  3NQU A;  1P34 C;  1U35 A;  4Z5T D;  1M18 C;  4H9Q A;  5B2I D;  5GXQ B;  3A6N A;  3AYW D;  2Y2I A;  4WU8 D;  4YS3 A;  5AV5 B;  3B0C T;  3AN2 A;  1KX4 A;  3MGR C;  5AV6 D;  4EO5 C;  5AY8 D;  2Y2K A;  4KGC C;  1N1J A;  2YFV B;  3AZN A;  5JA4 A;  3LJA A;  1P3L D;  1TAF B;  3AL0 C;  5B1M D;  3AZJ D;  5B0Z D;  3H0R C;  3MVD C;  2HIO C;  4R8P C;  2XD1 A;  3WKJ A;  2VQR A;  1AOI D;  4J8U A;  3AV1 C;  3W96 C;  5GT3 D;  3VH6 W;  4CSR B;  3AZF B;  4J8X A;  5E5A B;  3MGS C;  3W97 B;  4Z66 D;  1M19 B;  4J8V D;  3WAA D;  3EPH A;  5BO0 A;  1HQ3 C;  3KWQ A;  5AV5 D;  5AV8 A;  3REI C;  1P34 A;  3WA9 B;  3AZM C;  3EPK A;  1P3K C;  5B32 G;  4KHA B;  5GT0 C;  3KUY B;  3VH6 T;  3LZ0 B;  3O62 B;  3AZH D;  3MGR A;  3AZL A;  2FFF B;  4KGC A;  4WV4 B;  3LEL A;  3MGP D;  2ZY2 A;  2FJ7 C;  3UTB C;  3MNN D;  3MVD A;  4R8P A;  5E5A D;  3W97 D;  2J8P A;  2BYK A;  5C3I C;  3AV1 A;  3W96 A;  5CP6 B;  5CPJ C;  4CAY A;  3WTP C;  3B6F B;  3MGS A;  3WA9 D;  3C1B B;  5BT1 C;  3AV2 B;  3MGQ C;  3REK B;  1HQ3 A;  5B40 C;  1P3I B;  3LZ0 D;  3AZE A;  3AYW C;  1H3O B;  3X1T C;  5GT0 A;  5B32 D;  4JJN C;  2JCH A;  1P3F C;  5B33 B;  1P3M B;  2BYM A;  4LD9 D;  4XUJ B;  4H9S C;  3LJA D;  2G5I C;  3H0L C;  2NQB A;  5B1M C;  3LZ1 D;  2W8S A;  2F8N G;  2IO5 B;  5CP6 D;  3UTB A; 
#chains in the Genus database with same CATH homology
 1AOI C;  1KX5 C;  1ZLA C;  3B6F D;  2NZD C;  2Y2Q A;  1BFM A;  4HGA B;  5CHL B;  3C1B D;  4WNN B;  5DNN B;  2F8N B;  3B6G C;  2RIQ A;  5CPK B;  5CPJ A;  1P3I D;  3WTP A;  2YFW B;  5GXQ C;  5CPI B;  5AVB B;  3NQJ A;  5B40 A;  5AV9 A;  3W99 C;  5B33 D;  4UUZ B;  4XUJ D;  3X1T A;  1P3P B;  1P3O B;  4WJ3 C;  2Y2H A;  4NE5 A;  1WWS A;  1JFI B;  4JJN A;  1M1A C;  4E45 A;  1P3F A;  3TU4 B;  2Y2J A;  3LEL D;  4H9S A;  3AZG B;  2Y2G A;  4YM6 C;  4Z5T B;  3AZF C;  2CV5 B;  2F8N D;  3AZI C;  3B0D B;  5AV6 B;  4J8W B;  5CPK D;  1M19 C;  5B31 G;  4G91 C;  3UTA C;  1KX5 A;  5AY8 B;  1B67 A;  2ARO B;  5CPI D;  1F1E A;  5G49 A;  3B6G A;  3F6T A;  4H9N A;  1P3L B;  4WZS B;  3WA9 C;  1ID3 D;  4G92 B;  3P5J B;  5B31 B;  3AZJ B;  4H9O B;  2ZY4 A;  3KUY C;  1BH8 B;  3B0C W;  5B0Z B;  3R45 B;  3LZ0 C;  3AZE D;  3O62 C;  1F66 B;  5F99 A;  5B24 C;  3REH B;  3REJ A;  4ZUX B;  5GT3 B;  3TU4 D;  3W99 A;  3KSY A;  3X1V A;  3V9R B;  2ZM5 A;  1TAF A;  4Z66 B;  2L5A A;  5BS7 C;  2XD5 A;  4J8V B;  1M1A A;  2F8N H;  3REL D;  2CV5 D;  2NQB D;  3W98 D;  3WAA B;  4KUD C;  1TZY C;  4J8W D;  4YM6 A;  5JRG D;  5CP6 C;  1S32 C;  2ARO D;  3AZF A;  5BNX A;  5B1L A;  2HUE B;  3AFA C;  3B6F C;  3AZI A;  5DNM B;  3AZH B;  1M19 A;  3UTA A;  3AV2 C;  5B31 D;  3C1C B;  2RVQ C;  3REK C;  1P3B B;  5KDM B;  4X23 B;  3MGP B;  1F66 D;  3REH D;  4WU9 C;  4ZUX D;  2PYO D;  3KXB D;  4KHA A;  3KUY A;  3MNN B;  5B33 C;  1P3M C;  5BNV A;  5B24 A;  3AZK A;  1P3A D;  5AVC B;  1EQZ B;  1P3G B;  4QLC D;  5B0Y B;  4NE6 A;  2IO5 C;  3X1U B;  1M18 A;  5BS7 A;  3UT9 C;  1U35 B;  4H9Q B;  4KUD A;  5DNM D;  1TZY A;  3A6N B;  3VH5 W;  5GSU D;  5DNN C;  5FUG A;  3AN2 B;  1KX4 B;  4XZQ C;  3C1C D;  1S32 A;  1P3B D;  5B32 B;  3AFA A;  2Y2M A;  4X23 D;  3AZN B;  4LD9 B;  5B2J C;  3LJA B;  3AV2 A;  5AVB C;  3REK A;  1ULY A;  2HIO A;  3LZ1 B;  1KX3 C;  4WU9 A;  1P3P C;  5AVC D;  1P3O C;  3VH5 T;  1EQZ D;  5F99 D;  4J8U B;  3X1S D;  3REJ D;  1P3G D;  5B0Y D;  1P3M A;  1W2E A;  4J8X B;  3X1U D;  3AZG C;  1U35 D;  2Y2O A;  4Z5T C;  5B2I C;  2CV5 C;  3A6N D;  5BO0 B;  3REI A;  3KWQ B;  4WU8 C;  4YS3 D;  3AZM A;  3AN2 D;  5AV8 B;  1KX4 D;  1R4V A;  3UT9 A;  5AV6 C;  4J8W C;  1P34 B;  1P3K A;  2Y2N A;  3FDD A;  5AY8 C;  2ARO C;  5B1L D;  3AZN D;  5DNN A;  1P3L C;  2ZY3 A;  4XZQ A;  4G92 C;  5B31 C;  3AZJ C;  3AZL B;  2ZY5 A;  4H9R A;  5B0Z C;  4KGC B;  3LEL B;  4H9P A;  5B2J A;  3WKJ D;  3WTP E;  4J8U D;  4ZUX C;  5GT3 C;  1KX3 A;  3MVD B;  1BH9 B;  4E44 A;  4UUZ A;  4R8P B;  4J8X D;  3EPL A;  1P3P A;  1P3O A;  3AZK D;  4DQY B;  4Z66 C;  1JFI A;  2BYK B;  3A1K A;  3WAA C;  4J8V C;  4CAY B;  3KWQ D;  5AV8 D;  5AV5 C;  3MGS B;  1P34 D;  3MGQ A;  1ID3 B;  4Z5T A;  1M18 D;  5B2I A;  3H0M C;  3AYW A;  1HQ3 B;  4WU8 A;  3AZE B;  4DRB A;  3MGR D;  3AZH C;  4DRA A;  1WWI A;  5AY8 A;  3AZL D;  1Q9C A;  5GT0 B;  4KGC D;  1P3B C;  4X23 C;  2JE5 A;  3MGP C;  1P3L A;  2BYM B;  1HTA A;  5B1M A;  3AZJ A;  3W98 B;  3REL B;  2NQB B;  5B0Z A;  3MVD D;  3MNN C;  4R8P D;  5E5A C;  3W97 C;  1AOI A;  5AVC C;  5JRG B;  2FJ7 A;  3B0B A;  3AV1 D;  1ZLA A;  3W96 D;  5GT3 A;  2NZD A;  3VH6 A;  5B0Y C;  3MGS D;  3X1U C;  4J8V A;  2DF4 C;  5GXQ A;  1HQ3 D;  5AV5 A;  3A6N C;  3REI D;  1KX4 C;  2PYO B;  5GT0 D;  3KXB B;  3NQJ B;  5B32 C;  5AV9 B;  2YFV A;  3EG5 B;  3AZH A;  1P3A B;  4LD9 C;  3X1T B;  3LJA C;  3LZ1 C;  4QLC B;  1P3F B;  2Y2P A;  2FJ7 D;  3UTB D;  4NFT A;  4CSR A;  5E5A A;  3W97 A;  5GSU B;  3C1B C;  5CPJ D;  1KX5 B;  3WTP D;  1P3I C;  2BG1 A;  5G49 B;  3WA9 A;  3B6G B;  5BT1 D;  3MGQ D;  5B40 D;  5AV9 D;  3LZ0 A;  3O62 A;  4XUJ C;  3X1T D;  4NE3 A;  3EPJ A;  2F2A C;  5F99 B;  3REJ B;  3X1S B;  5B32 A;  4JJN D;  3AZL C;  1P3F D;  3W99 B;  4Z2M G;  3LEL C;  4LD9 A;  3NQU B;  3X1V B;  2DQN C;  3LZ1 A;  1M1A B;  4HGA C;  4YS3 B;  3A1I A;  5CP6 A;  2LY8 A;  5CPK C;  4YM6 B;  1KX5 D;  1ZLA D;  3B6F A;  5CPI C;  5B1L B;  5BNX B;  2NZD D;  3C1B A;  1N1J B;  3B6G D;  3AZI B;  5JA4 B;  1ID3 C;  4AWL B;  3UTA B;  4G91 B;  1P3I A;  5GXQ D;  1H3O A;  3AZE C;  3KFU G;  3WKJ B;  1Z2C B;  3W99 D;  5B33 A;  3TU4 C;  4XUJ A;  5BNV B;  3X1V D;  5B24 B;  3AZK B;  3W98 C;  1M1A D;  3REL C;  2NQB C;  1T3U A;  3B0D C;  4YM6 D;  5JRG C;  1M18 B;  3AZF D;  1BH9 A;  4KUD B;  4WNN A;  3AZI D;  2F8N A;  1TZY B;  3MGR B;  5CPK A;  1M19 D;  3UTA D;  5FUG B;  4EO5 B;  1S32 B;  2F8N K;  2YFW A;  5CPI A;  3AFA B;  1F66 C;  1KU5 A;  3REH C;  5AVB A;  1ID3 A;  2PYO C;  3KXB C;  1PZR A;  3KUY D;  5AV9 C;  2HIO B;  3O62 D;  5B24 D;  4M6B A;  4WU9 B;  1P3A C;  3AV1 B;  4Z2M H;  2CWE A;  3W96 B;  3TU4 A;  4QLC C;  3AZG A;  4UPK A;  3W98 A;  2JSS A;  3REL A;  2CV5 A;  2HUE C;  4KUD D;  5DNM C;  1TZY D;  3REI B;  5GSU C;  5AV6 A;  4J8W A;  5JRG A;  3AZM B;  3C1C C;  3UT9 B;  2ARO A;  1S32 D;  1P3K B;  3AFA D;  3AV2 D;  5B31 A;  4XZQ B;  4H9O A;  2RVQ D;  3REK D;  1BH8 A;  2HIO D;  3R45 A;  1F66 A;  4H9R B;  4ZBJ C;  4WU9 D;  3REH A;  4H9P B;  4ZUX A;  5B2J B;  2UWX A;  1EQZ C;  2FJ7 B;  5F99 C;  3KXB A;  3UTB B;  3REJ C;  3X1S C;  2PYO A;  1P3G C;  1P3M D;  1KX3 B;  3V9R A;  4Z66 A;  1P3A A;  5C3I B;  3WAA A;  3X1V C;  1U35 C;  5CPJ B;  3WTP B;  2G5H C;  4QLC A;  4YS3 C;  3AZM D;  3AN2 C;  3UT9 D;  1P3K D;  3MGQ B;  5B2I B;  5B40 B;  5B1L C;  5DNM A;  1A7W A;  5GSU A;  3AYW B;  4WU8 B;  3AZN C;  5DNN D;  3VH5 A;  1B6W A;  4XZQ D;  3C1C A;  4AWL C;  1P3B A;  5KDM A;  4JJN B;  4X23 A;  3MGP A;  2Y2L A;  5B2J D;  3WKJ C;  5AVB D;  4J8U C;  5B1M B;  3MNN A;  1KX3 D;  4J8X C;  1P3O D;  5AVC A;  1P3P D;  4ZBJ B;  1EQZ A;  3IP4 C;  3AZK C;  1AOI B;  3X1S A;  1ZLA B;  1P3G A;  5B0Y A;  2NZD B;  3KWQ C;  3X1U A;  5AV8 C;  4H9N B;  3AZG D;  3NQU A;  1P34 C;  1U35 A;  4Z5T D;  1M18 C;  4H9Q A;  5B2I D;  5GXQ B;  3A6N A;  3AYW D;  2Y2I A;  4WU8 D;  4YS3 A;  5AV5 B;  3B0C T;  3AN2 A;  1KX4 A;  3MGR C;  5AV6 D;  4EO5 C;  5AY8 D;  2Y2K A;  4KGC C;  1N1J A;  2YFV B;  3AZN A;  5JA4 A;  3LJA A;  1P3L D;  1TAF B;  3AL0 C;  5B1M D;  3AZJ D;  5B0Z D;  3H0R C;  3MVD C;  2HIO C;  4R8P C;  2XD1 A;  3WKJ A;  2VQR A;  1AOI D;  4J8U A;  3AV1 C;  3W96 C;  5GT3 D;  3VH6 W;  4CSR B;  3AZF B;  4J8X A;  5E5A B;  3MGS C;  3W97 B;  4Z66 D;  1M19 B;  4J8V D;  3WAA D;  3EPH A;  5BO0 A;  1HQ3 C;  3KWQ A;  5AV5 D;  5AV8 A;  3REI C;  1P34 A;  3WA9 B;  3AZM C;  3EPK A;  1P3K C;  5B32 G;  4KHA B;  5GT0 C;  3KUY B;  3VH6 T;  3LZ0 B;  3O62 B;  3AZH D;  3MGR A;  3AZL A;  2FFF B;  4KGC A;  4WV4 B;  3LEL A;  3MGP D;  2ZY2 A;  2FJ7 C;  3UTB C;  3MNN D;  3MVD A;  4R8P A;  5E5A D;  3W97 D;  2J8P A;  2BYK A;  5C3I C;  3AV1 A;  3W96 A;  5CP6 B;  5CPJ C;  4CAY A;  3WTP C;  3B6F B;  3MGS A;  3WA9 D;  3C1B B;  5BT1 C;  3AV2 B;  3MGQ C;  3REK B;  1HQ3 A;  5B40 C;  1P3I B;  3LZ0 D;  3AZE A;  3AYW C;  1H3O B;  3X1T C;  5GT0 A;  5B32 D;  4JJN C;  2JCH A;  1P3F C;  5B33 B;  1P3M B;  2BYM A;  4LD9 D;  4XUJ B;  4H9S C;  3LJA D;  2G5I C;  3H0L C;  2NQB A;  5B1M C;  3LZ1 D;  2W8S A;  2F8N G;  2IO5 B;  5CP6 D;  3UTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...