2NZDC

Nucleosome core particle containing 145 bp of dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdC00
5AVBD 4NFTA 1WWIA 1ID3C 4J8XC 3X1VA 3MGQB 3MGPD 4NE3A 4XUJD 3MGQD 3REKA 1P3IB 2F8NB 5B31C 4WNNB 3WTPC 3MNNB 1KX4C 1AOIB 3V9RB 1P3ID 2F8ND 5GT0A 1KX3C 3MNND 3UTBD 1S32A 4J8XB 1ID3B 1AOID 4Z5TA 3AZNC 3X1SB 3MGSC 4LD9C 1ID3D 4J8XD 4H9NA 3X1SD 5B31B 3AZGC 3WTPB 3AFAC 1KX4B 1N1JA 3W96B 5B31D 5B0ZA 4Z66C 3WTPD 2JSSA 1KX4D 3AZNB 3W96D 4LD9B 3B6FC 2IO5B 1KU5A 3AZND 1HTAA 5AY8C 3AZGB 4LD9D 4G92B 3AZIC 3AFAB 5CPJA 4H9QB 3AZGD 4Z66B 1KX5C 2F8NG 5B2JC 3AFAD 3X1TC 4CSRB 3UT9A 4Z66D 3LZ0A 1JFIA 3VH5W 5AY8B 5CPKC 3AZIB 5AVBA 5AY8D 3MGPA 2NZDC 3AZID 5B2JB 5B40A 4XUJA 3AZEA 3AYWC 3MVDC 4YM6C 5AV6C 1P3AC 1P3BC 5B2JD 1KX5D 5CPKB 1P3IA 5B33A 4WNNA 5C3IC 3B0CT 3AN2C 3MNNA 3UTBA 3UTAA 1AOIA 5CPKD 2NZDB 3VH6T 1ID3A 4J8XA 4QLCC 3W98C 2NZDD 1P3AB 5AV6B 1P3BB 5F99C 3AZMC 5B31A 5C3IB 1P3BD 5AV6D 1P3AD 5AV5B 3WTPA 3AN2B 5B0YC 3WA9C 4JJNC 1KX3A 5AV5D 3AN2D 3AZNA 4H9RB 4KUDC 4QLCB 3MGSA 3W98B 2PYOC 5BNXB 4LD9A 5BO0B 3REJA 5F99B 4QLCD 3AZMB 3W98D 1P3LC 5B0YB 3WA9B 5F99D 4H9QA 3AZMD 4JJNB 4Z66A 5JA4A 4WV4B 4E45A 5B0YD 4CSRA 4EO5C 3RELC 5AVCC 3WA9D 4JJND 2PYOB 3B6FA 2FJ7C 5AY8A 1B67A 2PYOD 3AZIA 1P3LB 1KX5A 3X1TA 1P3LD 3RELB 4EO5B 1P3FC 5AVCB 1TAFA 5B2IA 1M19A 4H9OB 3RELD 2FJ7B 3MGQC 5AVCD 5CPKA 5B32B 5BNVB 2YFVB 5B1MC 2FJ7D 5B32D 3TU4A 1M18B 1P3FB 3AYWA 3MVDA 4YM6A 5AV6A 5B24B 2YFWB 3AV2C 1P3AA 1P3BA 4G91B 1M18D 5GSUC 1P3FD 3AV1C 3X1SC 2F8NH 4J8UC 3NQJA 4HGAB 4ZBJC 5B24D 3LELC 3AN2A 5B1MB 5KDMB 5E5AC 3KWQC 5B1MD 3W96C 2BYMA 1M1AB 4QLCA 3W98A 5GXQA 4AWLC 4X23C 5BNXA 3AV2B 1P3MC 5GSUB 3AV1B 1M1AD 4J8UB 3AZMA 4UUZB 4ZBJB 4H9PB 3AV2D 3LELB 2IO5C 5GSUD 3AV1D 5B0YA 3WA9A 5E5AB 4J8UD 5AV9B 4KHAB 4G92C 4J8WB 5B32G 3LELD 3KWQB 1BH8B 1P3PB 4KUDA 5E5AD 3MGRC 5AV9D 4AWLB 4X23B 4J8VB 4CAYB 1P3MB 4M6BA 3KWQD 1P3PD 3C1CC 3AZFB 4X23D 4J8VD 4YS3A 3C1BC 1P3MD 3REIA 1P3LA 3AZFD 1P34C 2NQBC 3AZHB 3RELA 5AVCA 3MGRB 3AZHD 4H9OA 3C1CB 2FJ7A 3MGRD 5DNMC 4KGCA 3C1BB 5BNVA 2YFVA 3X1UB 3C1CD 3O62B 3LZ1C 1P34B 2NQBB 3C1BD 3B0BA 4WU8B 3NQUA 1ZLAC 3X1UD 3O62D 3AZJC 1P34D 2NQBD 4WU8D 3MGQA 5DNMB 5B1MA 2F8NA 4Z2MH 3LZ1B 5DNMD 2BYKB 5AV5C 3V9RA 1ZLAB 3WAAC 2AROB 3AZJB 3LZ1D 3B6GB 3AV2A 5GSUA 1ZLAD 2RVQD 3B0CW 2AROD 3X1SA 3AZJD 1H3OB 3AV1A 4UUZA 3B6GD 3LELA 4WZSB 5E5AA 5CHLB 4KHAA 2HIOB 1KX4A 3KWQA 1BH8A 3W96A 3WAAB 5GT3C 4X23A 2HIOD 4CAYA 1P3MA 3WAAD 3A6NC 2HUEC 4DRAA 3WKJC 3AZGA 4XZQC 3AZLC 4WU9C 3AFAA 5GT3B 3MGRA 4R8PC 3A6NB 3C1CA 5GT3D 2HUEB 3C1BA 3B0DB 3A6ND 3WKJB 5B32C 4XZQB 5AV8C 3AZLB 4WU9B 3KUYC 3WKJD 4XZQD 4R8PB 3AZLD 4Z5TB 4WU9D 5B2JA 1M18C 4R8PD 4H9NB 4Z5TD 5B24C 4G91C 5AV8B 4E44A 1N1JB 3LZ1A 4HGAC 3KUYB 1ZLAA 5CP6C 2NZDA 5AV8D 3KUYD 1P3GC 1M1AC 1H3OA 4NE6A 5G49B 4ZUXC 3AZKC 5AV5A 1U35C 5CP6B 3WAAA 5B40C 5AV9C 2CV5C 4J8WC 1P3GB 1P3PC 3LZ0B 4H9RA 5CP6D 4J8VC 1P3GD 5BO0A 5B33C 3LZ0D 5F99A 4ZUXB 3AZFC 3W99C 3AZKB 4H9SC 1U35B 4ZUXD 5B40B 5GT3A 4JJNA 3AZKD 2CV5B 4XUJB 3AZEB 3AZHC 1U35D 3A6NA 5BT1D 5JRGC 5B40D 2PYOA 3VH6A 2CV5D 4J8WD 3AZED 5B33B 4NE5A 1R4VA 3WKJA 1BH9B 3UTBB 4XZQA 3UTAB 3AZLA 3W99B 4WU9A 5B33D 5DNNC 3X1UC 3O62C 3W99D 3UTAD 4R8PA 4DRBA 3W97C 4WU8C 1Q9CA 5JRGB 3REJC 1WWSA 5CPIC 5JRGD 1F66C 5B32A 5AV8A 3KUYA 5DNNB 1KX3B 3WTPE 3W97B 3MGSB 1M18A 3REHC 5DNND 1KX3D 1P3FA 2RVQC 2AROC 3REJB 3KXBC 5B24A 2YFWA 1B6WA 5G49A 3MGSD 1P3OC 3B6GC 3W97D 5CPIB 3REJD 1F66B 5B1LC 3VH5T 1EQZC 5KDMA 5JA4B 5CPID 5CP6A 1P3KC 1F66D 5FUGB 2HIOC 1A7WA 1HQ3C 1P3GA 3REHB 5B2IC 1M19C 3LJAC 1TZYC 1M1AA 3B6FB 3KXBB 1P3OB 3REHD 3B6FD 4J8UA 4ZUXA 5B1LB 3KXBD 3AZKA 4H9PA 2LY8A 1U35A 3VH6W 1P3OD 1EQZB 3TU4C 1KX5B 5B31G 3X1TB 1P3KB 5AV9A 5B1LD 2CV5A 4J8WA 1HQ3B 1P3PA 1TAFB 3KSYA 5BS7C 5B2IB 1M19B 1EQZD 3LJAB 1TZYB 3X1TD 1P3KD 3X1VC 4J8VA 1HQ3D 5B2ID 1M19D 3LJAD 1TZYD 2L5AA 3AZFA 1BH9A 3R45B 3W99A 4H9SA 3REKC 3TU4B 3B0DC 3AYWB 3AZHA 5GT0C 3MVDB 5GXQC 2CWEA 3TU4D 4YM6B 2F8NK 1S32C 5JRGA 3X1VB 4Z5TC 3AYWD 3MVDD 3NQJB 4YM6D 3X1VD 3REKB 5DNNA 3X1UA 3O62A 1F1EA 1P34A 2NQBA 3REKD 2BYMB 3W97A 5GT0B 5GXQB 5B0ZC 4WU8A 1S32B 5GT0D 5GXQD 4YS3C 5CPIA 1S32D 1F66A 5DNMA 3REIC 1BFMA 5FUGA 2BYKA 5CPJC 4KUDB 3REHA 5B0ZB 3AZJA 2AROA 4Z2MG 3KXBA 3UT9C 4KUDD 3B6GA 1P3OA 5B0ZD 3LZ0C 4YS3B 4KGCC 3REIB 5B1LA 1EQZA 4YS3D 5AVBC 1ULYA 3REID 1P3KA 5CPJB 2HIOA 1HQ3A 3MGPC 3LJAA 1TZYA 5BT1C 4XUJC 5CPJD 3UT9B 3AZEC 4KGCB 1JFIB 3R45A 3UT9D 1P3IC 4KGCD 5AVBB 3MNNC 3UTAC 3UTBC 3NQUB 1AOIC 3MGPB 3VH5A 5BS7A
chains in the Genus database with same CATH superfamily
5AVBD 4NFTA 1WWIA 1ID3C 4J8XC 3X1VA 3MGQB 3MGPD 3AL0C 4NE3A 4XUJD 3MGQD 3REKA 1P3IB 3EPLA 2F8NB 5B31C 4WNNB 3WTPC 3MNNB 1KX4C 1AOIB 3V9RB 1P3ID 2F8ND 4UPKA 5GT0A 1KX3C 3FDDA 3MNND 3UTBD 1S32A 4J8XB 1ID3B 1AOID 4Z5TA 3AZNC 3X1SB 3MGSC 2Y2HA 4LD9C 1ID3D 4J8XD 4H9NA 3X1SD 5B31B 3AZGC 3WTPB 3AFAC 1KX4B 1N1JA 3W96B 5B31D 5B0ZA 4Z66C 3WTPD 2JSSA 1KX4D 2BG1A 3AZNB 3W96D 4LD9B 3B6FC 3A1IA 2IO5B 1KU5A 3AZND 1HTAA 5AY8C 3AZGB 2Y2LA 4LD9D 4G92B 3AZIC 3AFAB 5CPJA 4H9QB 2Y2NA 3AZGD 4Z66B 1KX5C 2F8NG 5B2JC 3AFAD 3X1TC 4CSRB 3UT9A 4Z66D 3LZ0A 1JFIA 3VH5W 5AY8B 5CPKC 3AZIB 5AVBA 1T3UA 5AY8D 3MGPA 2NZDC 3AZID 5B2JB 5B40A 4XUJA 3AZEA 3AYWC 3MVDC 4YM6C 5AV6C 1P3AC 1P3BC 5B2JD 1KX5D 5CPKB 1P3IA 5B33A 4WNNA 5C3IC 3B0CT 3AN2C 3MNNA 3UTBA 3UTAA 1AOIA 5CPKD 2NZDB 3VH6T 1ID3A 4J8XA 4QLCC 3W98C 2NZDD 1P3AB 5AV6B 1P3BB 5F99C 3AZMC 5B31A 5C3IB 1P3BD 5AV6D 1P3AD 5AV5B 3WTPA 3AN2B 5B0YC 3WA9C 4JJNC 1KX3A 5AV5D 3AN2D 3AZNA 4H9RB 4KUDC 4QLCB 3MGSA 3W98B 2PYOC 5BNXB 4LD9A 5BO0B 3REJA 5F99B 4QLCD 3AZMB 3W98D 2XD5A 1P3LC 5B0YB 3WA9B 5F99D 4H9QA 3AZMD 4JJNB 4Z66A 5JA4A 4WV4B 2F2AC 4EO5C 5B0YD 2JCHA 4CSRA 4E45A 5AVCC 3RELC 4JJND 2PYOB 3WA9D 2Y2MA 3B6FA 2FJ7C 5AY8A 1B67A 2PYOD 2JE5A 3AZIA 1Z2CB 1P3LB 2Y2PA 3EG5B 2W8SA 1KX5A 3X1TA 1P3LD 3RELB 4EO5B 1P3FC 5AVCB 1TAFA 5B2IA 1M19A 4H9OB 3RELD 2FJ7B 3MGQC 5AVCD 5CPKA 5B32B 5BNVB 2Y2OA 2YFVB 5B1MC 2FJ7D 5B32D 3TU4A 2ZY2A 1M18B 3H0RC 1P3FB 3AYWA 3MVDA 2G5IC 4YM6A 5AV6A 5B24B 2YFWB 3AV2C 1P3AA 1P3BA 4G91B 1M18D 5GSUC 1P3FD 3AV1C 3X1SC 2F8NH 4J8UC 3NQJA 4HGAB 4ZBJC 5B24D 3LELC 3AN2A 5B1MB 5KDMB 5E5AC 2Y2KA 3KWQC 5B1MD 3W96C 2BYMA 1M1AB 4QLCA 3W98A 5GXQA 4AWLC 4X23C 5BNXA 3AV2B 1P3MC 5GSUB 3AV1B 1M1AD 4J8UB 3AZMA 4UUZB 4ZBJB 4H9PB 3AV2D 3LELB 2IO5C 5GSUD 3AV1D 5B0YA 3WA9A 5E5AB 4J8UD 5AV9B 4KHAB 4G92C 4J8WB 2Y2QA 5B32G 3LELD 3KWQB 1BH8B 1P3PB 4KUDA 5E5AD 3MGRC 5AV9D 4AWLB 4X23B 4J8VB 4CAYB 1P3MB 4M6BA 3KWQD 1P3PD 3EPHA 3C1CC 3AZFB 4X23D 4J8VD 4YS3A 3C1BC 1P3MD 3REIA 1P3LA 3F6TA 3A1KA 3AZFD 1P34C 2NQBC 3AZHB 2FFFB 3RELA 2J8PA 5AVCA 3MGRB 3AZHD 4H9OA 3C1CB 2FJ7A 3MGRD 5DNMC 4KGCA 3C1BB 5BNVA 2YFVA 3X1UB 3C1CD 3O62B 3LZ1C 1P34B 2NQBB 3EPJA 3C1BD 3B0BA 4WU8B 3NQUA 1ZLAC 3X1UD 3EPKA 3O62D 3AZJC 1P34D 2NQBD 4WU8D 3MGQA 5DNMB 5B1MA 2Y2IA 4Z2MH 3LZ1B 5DNMD 2F8NA 2BYKB 5AV5C 2G5HC 3V9RA 1ZLAB 3WAAC 2AROB 3AZJB 3LZ1D 3B6GB 3AV2A 5GSUA 1ZLAD 2RVQD 3X1SA 2AROD 3B0CW 3AZJD 1H3OB 3AV1A 4UUZA 3IP4C 3B6GD 3LELA 4WZSB 5E5AA 5CHLB 4KHAA 2HIOB 1KX4A 3KWQA 1BH8A 3W96A 3WAAB 5GT3C 4X23A 2HIOD 4CAYA 1P3MA 3WAAD 3A6NC 2HUEC 4DRAA 3WKJC 3AZGA 4XZQC 3AZLC 4WU9C 3AFAA 2UWXA 5GT3B 3MGRA 4R8PC 2ZY4A 3A6NB 3C1CA 5GT3D 2HUEB 3C1BA 3B0DB 3A6ND 3WKJB 5B32C 4XZQB 5AV8C 3AZLB 4WU9B 3KUYC 3WKJD 4XZQD 4R8PB 3AZLD 4Z5TB 4WU9D 5B2JA 1M18C 3H0MC 4R8PD 2VQRA 4H9NB 4Z5TD 5B24C 4G91C 5AV8B 4E44A 1N1JB 3LZ1A 4HGAC 3KUYB 1ZLAA 5CP6C 2NZDA 5AV8D 3KUYD 1P3GC 1M1AC 1H3OA 4NE6A 5G49B 4ZUXC 3AZKC 5AV5A 1U35C 5CP6B 3WAAA 5B40C 5AV9C 2CV5C 4J8WC 1P3GB 1P3PC 3LZ0B 4H9RA 5CP6D 3P5JB 4J8VC 1P3GD 5BO0A 5B33C 3LZ0D 5F99A 4ZUXB 3AZFC 3W99C 3AZKB 4H9SC 1U35B 4ZUXD 5B40B 5GT3A 4JJNA 3AZKD 2CV5B 4XUJB 3AZEB 3AZHC 1U35D 3A6NA 5BT1D 5JRGC 5B40D 2PYOA 3VH6A 2CV5D 4J8WD 3AZED 2DQNC 5B33B 2ZY3A 4NE5A 1R4VA 3WKJA 1BH9B 3UTBB 4XZQA 3UTAB 3AZLA 3W99B 4WU9A 5B33D 5DNNC 3X1UC 3O62C 3W99D 3UTAD 4R8PA 3KFUG 4DRBA 3W97C 4DQYB 4WU8C 1Q9CA 5JRGB 3REJC 1WWSA 5CPIC 5JRGD 1F66C 5B32A 5AV8A 3KUYA 5DNNB 1KX3B 3WTPE 3W97B 3MGSB 1M18A 3REHC 5DNND 1KX3D 1P3FA 2RVQC 2AROC 3REJB 3KXBC 5B24A 2YFWA 1B6WA 5G49A 3MGSD 1P3OC 3B6GC 3W97D 5CPIB 3REJD 1F66B 5B1LC 3VH5T 1EQZC 5KDMA 5JA4B 5CPID 5CP6A 1P3KC 1F66D 5FUGB 2HIOC 1A7WA 1HQ3C 1P3GA 3REHB 5B2IC 1M19C 3LJAC 1TZYC 1M1AA 3B6FB 3KXBB 1P3OB 3REHD 3B6FD 4J8UA 4ZUXA 5B1LB 3KXBD 3AZKA 2RIQA 4H9PA 2LY8A 1U35A 3VH6W 1P3OD 1EQZB 3TU4C 1KX5B 5B31G 3X1TB 1P3KB 5AV9A 5B1LD 2CV5A 4J8WA 1HQ3B 1P3PA 1TAFB 3KSYA 5BS7C 5B2IB 1M19B 1EQZD 3LJAB 1TZYB 3X1TD 1P3KD 3X1VC 4J8VA 1HQ3D 5B2ID 1M19D 3LJAD 1TZYD 2L5AA 3AZFA 1BH9A 3R45B 3W99A 3H0LC 4H9SA 3REKC 3TU4B 3B0DC 2DF4C 2ZY5A 3AYWB 3AZHA 5GT0C 3MVDB 5GXQC 2CWEA 3TU4D 4YM6B 2F8NK 1S32C 5JRGA 3X1VB 4Z5TC 3AYWD 3MVDD 3NQJB 4YM6D 2Y2JA 2Y2GA 3X1VD 3REKB 5DNNA 3X1UA 3O62A 1F1EA 1P34A 2NQBA 3REKD 2BYMB 3W97A 5GT0B 5GXQB 5B0ZC 4WU8A 1S32B 2ZM5A 5GT0D 5GXQD 4YS3C 1W2EA 5CPIA 1S32D 1F66A 5DNMA 3REIC 1BFMA 5FUGA 2BYKA 5CPJC 4KUDB 3REHA 5B0ZB 3AZJA 2AROA 4Z2MG 3KXBA 3UT9C 4KUDD 3B6GA 1P3OA 5B0ZD 3LZ0C 4YS3B 4KGCC 3REIB 5B1LA 1EQZA 4YS3D 5AVBC 1ULYA 3REID 1P3KA 5CPJB 2HIOA 1HQ3A 3MGPC 3LJAA 1TZYA 5BT1C 4XUJC 5CPJD 2XD1A 3UT9B 3AZEC 4KGCB 1JFIB 1PZRA 3R45A 3UT9D 1P3IC 4WJ3C 4KGCD 5AVBB 3MNNC 3UTAC 3UTBC 3NQUB 1AOIC 3MGPB 3VH5A 5BS7A
chains in the Genus database with same CATH topology
5AVBD 4NFTA 1WWIA 1ID3C 4J8XC 3X1VA 3MGQB 3MGPD 3AL0C 4NE3A 4XUJD 3MGQD 3REKA 1P3IB 3EPLA 2F8NB 5B31C 4WNNB 3WTPC 3MNNB 1KX4C 1AOIB 3V9RB 1P3ID 2F8ND 4UPKA 5GT0A 1KX3C 3FDDA 3MNND 3UTBD 1S32A 4J8XB 1ID3B 1AOID 4Z5TA 3AZNC 3X1SB 3MGSC 2Y2HA 4LD9C 1ID3D 4J8XD 4H9NA 3X1SD 5B31B 3AZGC 3WTPB 3AFAC 1KX4B 1N1JA 3W96B 5B31D 5B0ZA 4Z66C 3WTPD 2JSSA 1KX4D 2BG1A 3AZNB 3W96D 4LD9B 3B6FC 3A1IA 2IO5B 1KU5A 3AZND 1HTAA 5AY8C 3AZGB 2Y2LA 4LD9D 4G92B 3AZIC 3AFAB 5CPJA 4H9QB 2Y2NA 3AZGD 4Z66B 1KX5C 2F8NG 5B2JC 3AFAD 3X1TC 4CSRB 3UT9A 4Z66D 3LZ0A 1JFIA 3VH5W 5AY8B 5CPKC 3AZIB 5AVBA 1T3UA 5AY8D 3MGPA 2NZDC 3AZID 5B2JB 5B40A 4XUJA 3AZEA 3AYWC 3MVDC 4YM6C 5AV6C 1P3AC 1P3BC 5B2JD 1KX5D 5CPKB 1P3IA 5B33A 4WNNA 5C3IC 3B0CT 3AN2C 3MNNA 3UTBA 3UTAA 1AOIA 5CPKD 2NZDB 3VH6T 1ID3A 4J8XA 4QLCC 3W98C 2NZDD 1P3AB 5AV6B 1P3BB 5F99C 3AZMC 5B31A 5C3IB 1P3BD 5AV6D 1P3AD 5AV5B 3WTPA 3AN2B 5B0YC 3WA9C 4JJNC 1KX3A 5AV5D 3AN2D 3AZNA 4H9RB 4KUDC 4QLCB 3MGSA 3W98B 2PYOC 5BNXB 4LD9A 5BO0B 3REJA 5F99B 4QLCD 3AZMB 3W98D 2XD5A 1P3LC 5B0YB 3WA9B 5F99D 4H9QA 3AZMD 4JJNB 4Z66A 5JA4A 4WV4B 2F2AC 4EO5C 5B0YD 2JCHA 4CSRA 4E45A 5AVCC 3RELC 4JJND 2PYOB 3WA9D 2Y2MA 3B6FA 2FJ7C 5AY8A 1B67A 2PYOD 2JE5A 3AZIA 1Z2CB 1P3LB 2Y2PA 3EG5B 2W8SA 1KX5A 3X1TA 1P3LD 3RELB 4EO5B 1P3FC 5AVCB 1TAFA 5B2IA 1M19A 4H9OB 3RELD 2FJ7B 3MGQC 5AVCD 5CPKA 5B32B 5BNVB 2Y2OA 2YFVB 5B1MC 2FJ7D 5B32D 3TU4A 2ZY2A 1M18B 3H0RC 1P3FB 3AYWA 3MVDA 2G5IC 4YM6A 5AV6A 5B24B 2YFWB 3AV2C 1P3AA 1P3BA 4G91B 1M18D 5GSUC 1P3FD 3AV1C 3X1SC 2F8NH 4J8UC 3NQJA 4HGAB 4ZBJC 5B24D 3LELC 3AN2A 5B1MB 5KDMB 5E5AC 2Y2KA 3KWQC 5B1MD 3W96C 2BYMA 1M1AB 4QLCA 3W98A 5GXQA 4AWLC 4X23C 5BNXA 3AV2B 1P3MC 5GSUB 3AV1B 1M1AD 4J8UB 3AZMA 4UUZB 4ZBJB 4H9PB 3AV2D 3LELB 2IO5C 5GSUD 3AV1D 5B0YA 3WA9A 5E5AB 4J8UD 5AV9B 4KHAB 4G92C 4J8WB 2Y2QA 5B32G 3LELD 3KWQB 1BH8B 1P3PB 4KUDA 5E5AD 3MGRC 5AV9D 4AWLB 4X23B 4J8VB 4CAYB 1P3MB 4M6BA 3KWQD 1P3PD 3EPHA 3C1CC 3AZFB 4X23D 4J8VD 4YS3A 3C1BC 1P3MD 3REIA 1P3LA 3F6TA 3A1KA 3AZFD 1P34C 2NQBC 3AZHB 2FFFB 3RELA 2J8PA 5AVCA 3MGRB 3AZHD 4H9OA 3C1CB 2FJ7A 3MGRD 5DNMC 4KGCA 3C1BB 5BNVA 2YFVA 3X1UB 3C1CD 3O62B 3LZ1C 1P34B 2NQBB 3EPJA 3C1BD 3B0BA 4WU8B 3NQUA 1ZLAC 3X1UD 3EPKA 3O62D 3AZJC 1P34D 2NQBD 4WU8D 3MGQA 5DNMB 5B1MA 2Y2IA 4Z2MH 3LZ1B 5DNMD 2F8NA 2BYKB 5AV5C 2G5HC 3V9RA 1ZLAB 3WAAC 2AROB 3AZJB 3LZ1D 3B6GB 3AV2A 5GSUA 1ZLAD 2RVQD 3X1SA 2AROD 3B0CW 3AZJD 1H3OB 3AV1A 4UUZA 3IP4C 3B6GD 3LELA 4WZSB 5E5AA 5CHLB 4KHAA 2HIOB 1KX4A 3KWQA 1BH8A 3W96A 3WAAB 5GT3C 4X23A 2HIOD 4CAYA 1P3MA 3WAAD 3A6NC 2HUEC 4DRAA 3WKJC 3AZGA 4XZQC 3AZLC 4WU9C 3AFAA 2UWXA 5GT3B 3MGRA 4R8PC 2ZY4A 3A6NB 3C1CA 5GT3D 2HUEB 3C1BA 3B0DB 3A6ND 3WKJB 5B32C 4XZQB 5AV8C 3AZLB 4WU9B 3KUYC 3WKJD 4XZQD 4R8PB 3AZLD 4Z5TB 4WU9D 5B2JA 1M18C 3H0MC 4R8PD 2VQRA 4H9NB 4Z5TD 5B24C 4G91C 5AV8B 4E44A 1N1JB 3LZ1A 4HGAC 3KUYB 1ZLAA 5CP6C 2NZDA 5AV8D 3KUYD 1P3GC 1M1AC 1H3OA 4NE6A 5G49B 4ZUXC 3AZKC 5AV5A 1U35C 5CP6B 3WAAA 5B40C 5AV9C 2CV5C 4J8WC 1P3GB 1P3PC 3LZ0B 4H9RA 5CP6D 3P5JB 4J8VC 1P3GD 5BO0A 5B33C 3LZ0D 5F99A 4ZUXB 3AZFC 3W99C 3AZKB 4H9SC 1U35B 4ZUXD 5B40B 5GT3A 4JJNA 3AZKD 2CV5B 4XUJB 3AZEB 3AZHC 1U35D 3A6NA 5BT1D 5JRGC 5B40D 2PYOA 3VH6A 2CV5D 4J8WD 3AZED 2DQNC 5B33B 2ZY3A 4NE5A 1R4VA 3WKJA 1BH9B 3UTBB 4XZQA 3UTAB 3AZLA 3W99B 4WU9A 5B33D 5DNNC 3X1UC 3O62C 3W99D 3UTAD 4R8PA 3KFUG 4DRBA 3W97C 4DQYB 4WU8C 1Q9CA 5JRGB 3REJC 1WWSA 5CPIC 5JRGD 1F66C 5B32A 5AV8A 3KUYA 5DNNB 1KX3B 3WTPE 3W97B 3MGSB 1M18A 3REHC 5DNND 1KX3D 1P3FA 2RVQC 2AROC 3REJB 3KXBC 5B24A 2YFWA 1B6WA 5G49A 3MGSD 1P3OC 3B6GC 3W97D 5CPIB 3REJD 1F66B 5B1LC 3VH5T 1EQZC 5KDMA 5JA4B 5CPID 5CP6A 1P3KC 1F66D 5FUGB 2HIOC 1A7WA 1HQ3C 1P3GA 3REHB 5B2IC 1M19C 3LJAC 1TZYC 1M1AA 3B6FB 3KXBB 1P3OB 3REHD 3B6FD 4J8UA 4ZUXA 5B1LB 3KXBD 3AZKA 2RIQA 4H9PA 2LY8A 1U35A 3VH6W 1P3OD 1EQZB 3TU4C 1KX5B 5B31G 3X1TB 1P3KB 5AV9A 5B1LD 2CV5A 4J8WA 1HQ3B 1P3PA 1TAFB 3KSYA 5BS7C 5B2IB 1M19B 1EQZD 3LJAB 1TZYB 3X1TD 1P3KD 3X1VC 4J8VA 1HQ3D 5B2ID 1M19D 3LJAD 1TZYD 2L5AA 3AZFA 1BH9A 3R45B 3W99A 3H0LC 4H9SA 3REKC 3TU4B 3B0DC 2DF4C 2ZY5A 3AYWB 3AZHA 5GT0C 3MVDB 5GXQC 2CWEA 3TU4D 4YM6B 2F8NK 1S32C 5JRGA 3X1VB 4Z5TC 3AYWD 3MVDD 3NQJB 4YM6D 2Y2JA 2Y2GA 3X1VD 3REKB 5DNNA 3X1UA 3O62A 1F1EA 1P34A 2NQBA 3REKD 2BYMB 3W97A 5GT0B 5GXQB 5B0ZC 4WU8A 1S32B 2ZM5A 5GT0D 5GXQD 4YS3C 1W2EA 5CPIA 1S32D 1F66A 5DNMA 3REIC 1BFMA 5FUGA 2BYKA 5CPJC 4KUDB 3REHA 5B0ZB 3AZJA 2AROA 4Z2MG 3KXBA 3UT9C 4KUDD 3B6GA 1P3OA 5B0ZD 3LZ0C 4YS3B 4KGCC 3REIB 5B1LA 1EQZA 4YS3D 5AVBC 1ULYA 3REID 1P3KA 5CPJB 2HIOA 1HQ3A 3MGPC 3LJAA 1TZYA 5BT1C 4XUJC 5CPJD 2XD1A 3UT9B 3AZEC 4KGCB 1JFIB 1PZRA 3R45A 3UT9D 1P3IC 4WJ3C 4KGCD 5AVBB 3MNNC 3UTAC 3UTBC 3NQUB 1AOIC 3MGPB 3VH5A 5BS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB D;  4NFT A;  1WWI A;  1ID3 C;  4J8X C;  3X1V A;  3MGQ B;  3MGP D;  4NE3 A;  4XUJ D;  3MGQ D;  3REK A;  1P3I B;  2F8N B;  5B31 C;  4WNN B;  3WTP C;  3MNN B;  1KX4 C;  1AOI B;  3V9R B;  1P3I D;  2F8N D;  5GT0 A;  1KX3 C;  3MNN D;  3UTB D;  1S32 A;  4J8X B;  1ID3 B;  1AOI D;  4Z5T A;  3AZN C;  3X1S B;  3MGS C;  4LD9 C;  1ID3 D;  4J8X D;  4H9N A;  3X1S D;  5B31 B;  3AZG C;  3WTP B;  3AFA C;  1KX4 B;  1N1J A;  3W96 B;  5B31 D;  5B0Z A;  4Z66 C;  3WTP D;  2JSS A;  1KX4 D;  3AZN B;  3W96 D;  4LD9 B;  3B6F C;  2IO5 B;  1KU5 A;  3AZN D;  1HTA A;  5AY8 C;  3AZG B;  4LD9 D;  4G92 B;  3AZI C;  3AFA B;  5CPJ A;  4H9Q B;  3AZG D;  4Z66 B;  1KX5 C;  2F8N G;  5B2J C;  3AFA D;  3X1T C;  4CSR B;  3UT9 A;  4Z66 D;  3LZ0 A;  1JFI A;  3VH5 W;  5AY8 B;  5CPK C;  3AZI B;  5AVB A;  5AY8 D;  3MGP A;  2NZD C;  3AZI D;  5B2J B;  5B40 A;  4XUJ A;  3AZE A;  3AYW C;  3MVD C;  4YM6 C;  5AV6 C;  1P3A C;  1P3B C;  5B2J D;  1KX5 D;  5CPK B;  1P3I A;  5B33 A;  4WNN A;  5C3I C;  3B0C T;  3AN2 C;  3MNN A;  3UTB A;  3UTA A;  1AOI A;  5CPK D;  2NZD B;  3VH6 T;  1ID3 A;  4J8X A;  4QLC C;  3W98 C;  2NZD D;  1P3A B;  5AV6 B;  1P3B B;  5F99 C;  3AZM C;  5B31 A;  5C3I B;  1P3B D;  5AV6 D;  1P3A D;  5AV5 B;  3WTP A;  3AN2 B;  5B0Y C;  3WA9 C;  4JJN C;  1KX3 A;  5AV5 D;  3AN2 D;  3AZN A;  4H9R B;  4KUD C;  4QLC B;  3MGS A;  3W98 B;  2PYO C;  5BNX B;  4LD9 A;  5BO0 B;  3REJ A;  5F99 B;  4QLC D;  3AZM B;  3W98 D;  1P3L C;  5B0Y B;  3WA9 B;  5F99 D;  4H9Q A;  3AZM D;  4JJN B;  4Z66 A;  5JA4 A;  4WV4 B;  4E45 A;  5B0Y D;  4CSR A;  4EO5 C;  3REL C;  5AVC C;  3WA9 D;  4JJN D;  2PYO B;  3B6F A;  2FJ7 C;  5AY8 A;  1B67 A;  2PYO D;  3AZI A;  1P3L B;  1KX5 A;  3X1T A;  1P3L D;  3REL B;  4EO5 B;  1P3F C;  5AVC B;  1TAF A;  5B2I A;  1M19 A;  4H9O B;  3REL D;  2FJ7 B;  3MGQ C;  5AVC D;  5CPK A;  5B32 B;  5BNV B;  2YFV B;  5B1M C;  2FJ7 D;  5B32 D;  3TU4 A;  1M18 B;  1P3F B;  3AYW A;  3MVD A;  4YM6 A;  5AV6 A;  5B24 B;  2YFW B;  3AV2 C;  1P3A A;  1P3B A;  4G91 B;  1M18 D;  5GSU C;  1P3F D;  3AV1 C;  3X1S C;  2F8N H;  4J8U C;  3NQJ A;  4HGA B;  4ZBJ C;  5B24 D;  3LEL C;  3AN2 A;  5B1M B;  5KDM B;  5E5A C;  3KWQ C;  5B1M D;  3W96 C;  2BYM A;  1M1A B;  4QLC A;  3W98 A;  5GXQ A;  4AWL C;  4X23 C;  5BNX A;  3AV2 B;  1P3M C;  5GSU B;  3AV1 B;  1M1A D;  4J8U B;  3AZM A;  4UUZ B;  4ZBJ B;  4H9P B;  3AV2 D;  3LEL B;  2IO5 C;  5GSU D;  3AV1 D;  5B0Y A;  3WA9 A;  5E5A B;  4J8U D;  5AV9 B;  4KHA B;  4G92 C;  4J8W B;  5B32 G;  3LEL D;  3KWQ B;  1BH8 B;  1P3P B;  4KUD A;  5E5A D;  3MGR C;  5AV9 D;  4AWL B;  4X23 B;  4J8V B;  4CAY B;  1P3M B;  4M6B A;  3KWQ D;  1P3P D;  3C1C C;  3AZF B;  4X23 D;  4J8V D;  4YS3 A;  3C1B C;  1P3M D;  3REI A;  1P3L A;  3AZF D;  1P34 C;  2NQB C;  3AZH B;  3REL A;  5AVC A;  3MGR B;  3AZH D;  4H9O A;  3C1C B;  2FJ7 A;  3MGR D;  5DNM C;  4KGC A;  3C1B B;  5BNV A;  2YFV A;  3X1U B;  3C1C D;  3O62 B;  3LZ1 C;  1P34 B;  2NQB B;  3C1B D;  3B0B A;  4WU8 B;  3NQU A;  1ZLA C;  3X1U D;  3O62 D;  3AZJ C;  1P34 D;  2NQB D;  4WU8 D;  3MGQ A;  5DNM B;  5B1M A;  2F8N A;  4Z2M H;  3LZ1 B;  5DNM D;  2BYK B;  5AV5 C;  3V9R A;  1ZLA B;  3WAA C;  2ARO B;  3AZJ B;  3LZ1 D;  3B6G B;  3AV2 A;  5GSU A;  1ZLA D;  2RVQ D;  3B0C W;  2ARO D;  3X1S A;  3AZJ D;  1H3O B;  3AV1 A;  4UUZ A;  3B6G D;  3LEL A;  4WZS B;  5E5A A;  5CHL B;  4KHA A;  2HIO B;  1KX4 A;  3KWQ A;  1BH8 A;  3W96 A;  3WAA B;  5GT3 C;  4X23 A;  2HIO D;  4CAY A;  1P3M A;  3WAA D;  3A6N C;  2HUE C;  4DRA A;  3WKJ C;  3AZG A;  4XZQ C;  3AZL C;  4WU9 C;  3AFA A;  5GT3 B;  3MGR A;  4R8P C;  3A6N B;  3C1C A;  5GT3 D;  2HUE B;  3C1B A;  3B0D B;  3A6N D;  3WKJ B;  5B32 C;  4XZQ B;  5AV8 C;  3AZL B;  4WU9 B;  3KUY C;  3WKJ D;  4XZQ D;  4R8P B;  3AZL D;  4Z5T B;  4WU9 D;  5B2J A;  1M18 C;  4R8P D;  4H9N B;  4Z5T D;  5B24 C;  4G91 C;  5AV8 B;  4E44 A;  1N1J B;  3LZ1 A;  4HGA C;  3KUY B;  1ZLA A;  5CP6 C;  2NZD A;  5AV8 D;  3KUY D;  1P3G C;  1M1A C;  1H3O A;  4NE6 A;  5G49 B;  4ZUX C;  3AZK C;  5AV5 A;  1U35 C;  5CP6 B;  3WAA A;  5B40 C;  5AV9 C;  2CV5 C;  4J8W C;  1P3G B;  1P3P C;  3LZ0 B;  4H9R A;  5CP6 D;  4J8V C;  1P3G D;  5BO0 A;  5B33 C;  3LZ0 D;  5F99 A;  4ZUX B;  3AZF C;  3W99 C;  3AZK B;  4H9S C;  1U35 B;  4ZUX D;  5B40 B;  5GT3 A;  4JJN A;  3AZK D;  2CV5 B;  4XUJ B;  3AZE B;  3AZH C;  1U35 D;  3A6N A;  5BT1 D;  5JRG C;  5B40 D;  2PYO A;  3VH6 A;  2CV5 D;  4J8W D;  3AZE D;  5B33 B;  4NE5 A;  1R4V A;  3WKJ A;  1BH9 B;  3UTB B;  4XZQ A;  3UTA B;  3AZL A;  3W99 B;  4WU9 A;  5B33 D;  5DNN C;  3X1U C;  3O62 C;  3W99 D;  3UTA D;  4R8P A;  4DRB A;  3W97 C;  4WU8 C;  1Q9C A;  5JRG B;  3REJ C;  1WWS A;  5CPI C;  5JRG D;  1F66 C;  5B32 A;  5AV8 A;  3KUY A;  5DNN B;  1KX3 B;  3WTP E;  3W97 B;  3MGS B;  1M18 A;  3REH C;  5DNN D;  1KX3 D;  1P3F A;  2RVQ C;  2ARO C;  3REJ B;  3KXB C;  5B24 A;  2YFW A;  1B6W A;  5G49 A;  3MGS D;  1P3O C;  3B6G C;  3W97 D;  5CPI B;  3REJ D;  1F66 B;  5B1L C;  3VH5 T;  1EQZ C;  5KDM A;  5JA4 B;  5CPI D;  5CP6 A;  1P3K C;  1F66 D;  5FUG B;  2HIO C;  1A7W A;  1HQ3 C;  1P3G A;  3REH B;  5B2I C;  1M19 C;  3LJA C;  1TZY C;  1M1A A;  3B6F B;  3KXB B;  1P3O B;  3REH D;  3B6F D;  4J8U A;  4ZUX A;  5B1L B;  3KXB D;  3AZK A;  4H9P A;  2LY8 A;  1U35 A;  3VH6 W;  1P3O D;  1EQZ B;  3TU4 C;  1KX5 B;  5B31 G;  3X1T B;  1P3K B;  5AV9 A;  5B1L D;  2CV5 A;  4J8W A;  1HQ3 B;  1P3P A;  1TAF B;  3KSY A;  5BS7 C;  5B2I B;  1M19 B;  1EQZ D;  3LJA B;  1TZY B;  3X1T D;  1P3K D;  3X1V C;  4J8V A;  1HQ3 D;  5B2I D;  1M19 D;  3LJA D;  1TZY D;  2L5A A;  3AZF A;  1BH9 A;  3R45 B;  3W99 A;  4H9S A;  3REK C;  3TU4 B;  3B0D C;  3AYW B;  3AZH A;  5GT0 C;  3MVD B;  5GXQ C;  2CWE A;  3TU4 D;  4YM6 B;  2F8N K;  1S32 C;  5JRG A;  3X1V B;  4Z5T C;  3AYW D;  3MVD D;  3NQJ B;  4YM6 D;  3X1V D;  3REK B;  5DNN A;  3X1U A;  3O62 A;  1F1E A;  1P34 A;  2NQB A;  3REK D;  2BYM B;  3W97 A;  5GT0 B;  5GXQ B;  5B0Z C;  4WU8 A;  1S32 B;  5GT0 D;  5GXQ D;  4YS3 C;  5CPI A;  1S32 D;  1F66 A;  5DNM A;  3REI C;  1BFM A;  5FUG A;  2BYK A;  5CPJ C;  4KUD B;  3REH A;  5B0Z B;  3AZJ A;  2ARO A;  4Z2M G;  3KXB A;  3UT9 C;  4KUD D;  3B6G A;  1P3O A;  5B0Z D;  3LZ0 C;  4YS3 B;  4KGC C;  3REI B;  5B1L A;  1EQZ A;  4YS3 D;  5AVB C;  1ULY A;  3REI D;  1P3K A;  5CPJ B;  2HIO A;  1HQ3 A;  3MGP C;  3LJA A;  1TZY A;  5BT1 C;  4XUJ C;  5CPJ D;  3UT9 B;  3AZE C;  4KGC B;  1JFI B;  3R45 A;  3UT9 D;  1P3I C;  4KGC D;  5AVB B;  3MNN C;  3UTA C;  3UTB C;  3NQU B;  1AOI C;  3MGP B;  3VH5 A;  5BS7 A; 
#chains in the Genus database with same CATH topology
 5AVB D;  4NFT A;  1WWI A;  1ID3 C;  4J8X C;  3X1V A;  3MGQ B;  3MGP D;  3AL0 C;  4NE3 A;  4XUJ D;  3MGQ D;  3REK A;  1P3I B;  3EPL A;  2F8N B;  5B31 C;  4WNN B;  3WTP C;  3MNN B;  1KX4 C;  1AOI B;  3V9R B;  1P3I D;  2F8N D;  4UPK A;  5GT0 A;  1KX3 C;  3FDD A;  3MNN D;  3UTB D;  1S32 A;  4J8X B;  1ID3 B;  1AOI D;  4Z5T A;  3AZN C;  3X1S B;  3MGS C;  2Y2H A;  4LD9 C;  1ID3 D;  4J8X D;  4H9N A;  3X1S D;  5B31 B;  3AZG C;  3WTP B;  3AFA C;  1KX4 B;  1N1J A;  3W96 B;  5B31 D;  5B0Z A;  4Z66 C;  3WTP D;  2JSS A;  1KX4 D;  2BG1 A;  3AZN B;  3W96 D;  4LD9 B;  3B6F C;  3A1I A;  2IO5 B;  1KU5 A;  3AZN D;  1HTA A;  5AY8 C;  3AZG B;  2Y2L A;  4LD9 D;  4G92 B;  3AZI C;  3AFA B;  5CPJ A;  4H9Q B;  2Y2N A;  3AZG D;  4Z66 B;  1KX5 C;  2F8N G;  5B2J C;  3AFA D;  3X1T C;  4CSR B;  3UT9 A;  4Z66 D;  3LZ0 A;  1JFI A;  3VH5 W;  5AY8 B;  5CPK C;  3AZI B;  5AVB A;  1T3U A;  5AY8 D;  3MGP A;  2NZD C;  3AZI D;  5B2J B;  5B40 A;  4XUJ A;  3AZE A;  3AYW C;  3MVD C;  4YM6 C;  5AV6 C;  1P3A C;  1P3B C;  5B2J D;  1KX5 D;  5CPK B;  1P3I A;  5B33 A;  4WNN A;  5C3I C;  3B0C T;  3AN2 C;  3MNN A;  3UTB A;  3UTA A;  1AOI A;  5CPK D;  2NZD B;  3VH6 T;  1ID3 A;  4J8X A;  4QLC C;  3W98 C;  2NZD D;  1P3A B;  5AV6 B;  1P3B B;  5F99 C;  3AZM C;  5B31 A;  5C3I B;  1P3B D;  5AV6 D;  1P3A D;  5AV5 B;  3WTP A;  3AN2 B;  5B0Y C;  3WA9 C;  4JJN C;  1KX3 A;  5AV5 D;  3AN2 D;  3AZN A;  4H9R B;  4KUD C;  4QLC B;  3MGS A;  3W98 B;  2PYO C;  5BNX B;  4LD9 A;  5BO0 B;  3REJ A;  5F99 B;  4QLC D;  3AZM B;  3W98 D;  2XD5 A;  1P3L C;  5B0Y B;  3WA9 B;  5F99 D;  4H9Q A;  3AZM D;  4JJN B;  4Z66 A;  5JA4 A;  4WV4 B;  2F2A C;  4EO5 C;  5B0Y D;  2JCH A;  4CSR A;  4E45 A;  5AVC C;  3REL C;  4JJN D;  2PYO B;  3WA9 D;  2Y2M A;  3B6F A;  2FJ7 C;  5AY8 A;  1B67 A;  2PYO D;  2JE5 A;  3AZI A;  1Z2C B;  1P3L B;  2Y2P A;  3EG5 B;  2W8S A;  1KX5 A;  3X1T A;  1P3L D;  3REL B;  4EO5 B;  1P3F C;  5AVC B;  1TAF A;  5B2I A;  1M19 A;  4H9O B;  3REL D;  2FJ7 B;  3MGQ C;  5AVC D;  5CPK A;  5B32 B;  5BNV B;  2Y2O A;  2YFV B;  5B1M C;  2FJ7 D;  5B32 D;  3TU4 A;  2ZY2 A;  1M18 B;  3H0R C;  1P3F B;  3AYW A;  3MVD A;  2G5I C;  4YM6 A;  5AV6 A;  5B24 B;  2YFW B;  3AV2 C;  1P3A A;  1P3B A;  4G91 B;  1M18 D;  5GSU C;  1P3F D;  3AV1 C;  3X1S C;  2F8N H;  4J8U C;  3NQJ A;  4HGA B;  4ZBJ C;  5B24 D;  3LEL C;  3AN2 A;  5B1M B;  5KDM B;  5E5A C;  2Y2K A;  3KWQ C;  5B1M D;  3W96 C;  2BYM A;  1M1A B;  4QLC A;  3W98 A;  5GXQ A;  4AWL C;  4X23 C;  5BNX A;  3AV2 B;  1P3M C;  5GSU B;  3AV1 B;  1M1A D;  4J8U B;  3AZM A;  4UUZ B;  4ZBJ B;  4H9P B;  3AV2 D;  3LEL B;  2IO5 C;  5GSU D;  3AV1 D;  5B0Y A;  3WA9 A;  5E5A B;  4J8U D;  5AV9 B;  4KHA B;  4G92 C;  4J8W B;  2Y2Q A;  5B32 G;  3LEL D;  3KWQ B;  1BH8 B;  1P3P B;  4KUD A;  5E5A D;  3MGR C;  5AV9 D;  4AWL B;  4X23 B;  4J8V B;  4CAY B;  1P3M B;  4M6B A;  3KWQ D;  1P3P D;  3EPH A;  3C1C C;  3AZF B;  4X23 D;  4J8V D;  4YS3 A;  3C1B C;  1P3M D;  3REI A;  1P3L A;  3F6T A;  3A1K A;  3AZF D;  1P34 C;  2NQB C;  3AZH B;  2FFF B;  3REL A;  2J8P A;  5AVC A;  3MGR B;  3AZH D;  4H9O A;  3C1C B;  2FJ7 A;  3MGR D;  5DNM C;  4KGC A;  3C1B B;  5BNV A;  2YFV A;  3X1U B;  3C1C D;  3O62 B;  3LZ1 C;  1P34 B;  2NQB B;  3EPJ A;  3C1B D;  3B0B A;  4WU8 B;  3NQU A;  1ZLA C;  3X1U D;  3EPK A;  3O62 D;  3AZJ C;  1P34 D;  2NQB D;  4WU8 D;  3MGQ A;  5DNM B;  5B1M A;  2Y2I A;  4Z2M H;  3LZ1 B;  5DNM D;  2F8N A;  2BYK B;  5AV5 C;  2G5H C;  3V9R A;  1ZLA B;  3WAA C;  2ARO B;  3AZJ B;  3LZ1 D;  3B6G B;  3AV2 A;  5GSU A;  1ZLA D;  2RVQ D;  3X1S A;  2ARO D;  3B0C W;  3AZJ D;  1H3O B;  3AV1 A;  4UUZ A;  3IP4 C;  3B6G D;  3LEL A;  4WZS B;  5E5A A;  5CHL B;  4KHA A;  2HIO B;  1KX4 A;  3KWQ A;  1BH8 A;  3W96 A;  3WAA B;  5GT3 C;  4X23 A;  2HIO D;  4CAY A;  1P3M A;  3WAA D;  3A6N C;  2HUE C;  4DRA A;  3WKJ C;  3AZG A;  4XZQ C;  3AZL C;  4WU9 C;  3AFA A;  2UWX A;  5GT3 B;  3MGR A;  4R8P C;  2ZY4 A;  3A6N B;  3C1C A;  5GT3 D;  2HUE B;  3C1B A;  3B0D B;  3A6N D;  3WKJ B;  5B32 C;  4XZQ B;  5AV8 C;  3AZL B;  4WU9 B;  3KUY C;  3WKJ D;  4XZQ D;  4R8P B;  3AZL D;  4Z5T B;  4WU9 D;  5B2J A;  1M18 C;  3H0M C;  4R8P D;  2VQR A;  4H9N B;  4Z5T D;  5B24 C;  4G91 C;  5AV8 B;  4E44 A;  1N1J B;  3LZ1 A;  4HGA C;  3KUY B;  1ZLA A;  5CP6 C;  2NZD A;  5AV8 D;  3KUY D;  1P3G C;  1M1A C;  1H3O A;  4NE6 A;  5G49 B;  4ZUX C;  3AZK C;  5AV5 A;  1U35 C;  5CP6 B;  3WAA A;  5B40 C;  5AV9 C;  2CV5 C;  4J8W C;  1P3G B;  1P3P C;  3LZ0 B;  4H9R A;  5CP6 D;  3P5J B;  4J8V C;  1P3G D;  5BO0 A;  5B33 C;  3LZ0 D;  5F99 A;  4ZUX B;  3AZF C;  3W99 C;  3AZK B;  4H9S C;  1U35 B;  4ZUX D;  5B40 B;  5GT3 A;  4JJN A;  3AZK D;  2CV5 B;  4XUJ B;  3AZE B;  3AZH C;  1U35 D;  3A6N A;  5BT1 D;  5JRG C;  5B40 D;  2PYO A;  3VH6 A;  2CV5 D;  4J8W D;  3AZE D;  2DQN C;  5B33 B;  2ZY3 A;  4NE5 A;  1R4V A;  3WKJ A;  1BH9 B;  3UTB B;  4XZQ A;  3UTA B;  3AZL A;  3W99 B;  4WU9 A;  5B33 D;  5DNN C;  3X1U C;  3O62 C;  3W99 D;  3UTA D;  4R8P A;  3KFU G;  4DRB A;  3W97 C;  4DQY B;  4WU8 C;  1Q9C A;  5JRG B;  3REJ C;  1WWS A;  5CPI C;  5JRG D;  1F66 C;  5B32 A;  5AV8 A;  3KUY A;  5DNN B;  1KX3 B;  3WTP E;  3W97 B;  3MGS B;  1M18 A;  3REH C;  5DNN D;  1KX3 D;  1P3F A;  2RVQ C;  2ARO C;  3REJ B;  3KXB C;  5B24 A;  2YFW A;  1B6W A;  5G49 A;  3MGS D;  1P3O C;  3B6G C;  3W97 D;  5CPI B;  3REJ D;  1F66 B;  5B1L C;  3VH5 T;  1EQZ C;  5KDM A;  5JA4 B;  5CPI D;  5CP6 A;  1P3K C;  1F66 D;  5FUG B;  2HIO C;  1A7W A;  1HQ3 C;  1P3G A;  3REH B;  5B2I C;  1M19 C;  3LJA C;  1TZY C;  1M1A A;  3B6F B;  3KXB B;  1P3O B;  3REH D;  3B6F D;  4J8U A;  4ZUX A;  5B1L B;  3KXB D;  3AZK A;  2RIQ A;  4H9P A;  2LY8 A;  1U35 A;  3VH6 W;  1P3O D;  1EQZ B;  3TU4 C;  1KX5 B;  5B31 G;  3X1T B;  1P3K B;  5AV9 A;  5B1L D;  2CV5 A;  4J8W A;  1HQ3 B;  1P3P A;  1TAF B;  3KSY A;  5BS7 C;  5B2I B;  1M19 B;  1EQZ D;  3LJA B;  1TZY B;  3X1T D;  1P3K D;  3X1V C;  4J8V A;  1HQ3 D;  5B2I D;  1M19 D;  3LJA D;  1TZY D;  2L5A A;  3AZF A;  1BH9 A;  3R45 B;  3W99 A;  3H0L C;  4H9S A;  3REK C;  3TU4 B;  3B0D C;  2DF4 C;  2ZY5 A;  3AYW B;  3AZH A;  5GT0 C;  3MVD B;  5GXQ C;  2CWE A;  3TU4 D;  4YM6 B;  2F8N K;  1S32 C;  5JRG A;  3X1V B;  4Z5T C;  3AYW D;  3MVD D;  3NQJ B;  4YM6 D;  2Y2J A;  2Y2G A;  3X1V D;  3REK B;  5DNN A;  3X1U A;  3O62 A;  1F1E A;  1P34 A;  2NQB A;  3REK D;  2BYM B;  3W97 A;  5GT0 B;  5GXQ B;  5B0Z C;  4WU8 A;  1S32 B;  2ZM5 A;  5GT0 D;  5GXQ D;  4YS3 C;  1W2E A;  5CPI A;  1S32 D;  1F66 A;  5DNM A;  3REI C;  1BFM A;  5FUG A;  2BYK A;  5CPJ C;  4KUD B;  3REH A;  5B0Z B;  3AZJ A;  2ARO A;  4Z2M G;  3KXB A;  3UT9 C;  4KUD D;  3B6G A;  1P3O A;  5B0Z D;  3LZ0 C;  4YS3 B;  4KGC C;  3REI B;  5B1L A;  1EQZ A;  4YS3 D;  5AVB C;  1ULY A;  3REI D;  1P3K A;  5CPJ B;  2HIO A;  1HQ3 A;  3MGP C;  3LJA A;  1TZY A;  5BT1 C;  4XUJ C;  5CPJ D;  2XD1 A;  3UT9 B;  3AZE C;  4KGC B;  1JFI B;  1PZR A;  3R45 A;  3UT9 D;  1P3I C;  4WJ3 C;  4KGC D;  5AVB B;  3MNN C;  3UTA C;  3UTB C;  3NQU B;  1AOI C;  3MGP B;  3VH5 A;  5BS7 A; 
#chains in the Genus database with same CATH homology
 5AVB D;  4NFT A;  1WWI A;  1ID3 C;  4J8X C;  3X1V A;  3MGQ B;  3MGP D;  3AL0 C;  4NE3 A;  4XUJ D;  3MGQ D;  3REK A;  1P3I B;  3EPL A;  2F8N B;  5B31 C;  4WNN B;  3WTP C;  3MNN B;  1KX4 C;  1AOI B;  3V9R B;  1P3I D;  2F8N D;  4UPK A;  5GT0 A;  1KX3 C;  3FDD A;  3MNN D;  3UTB D;  1S32 A;  4J8X B;  1ID3 B;  1AOI D;  4Z5T A;  3AZN C;  3X1S B;  3MGS C;  2Y2H A;  4LD9 C;  1ID3 D;  4J8X D;  4H9N A;  3X1S D;  5B31 B;  3AZG C;  3WTP B;  3AFA C;  1KX4 B;  1N1J A;  3W96 B;  5B31 D;  5B0Z A;  4Z66 C;  3WTP D;  2JSS A;  1KX4 D;  2BG1 A;  3AZN B;  3W96 D;  4LD9 B;  3B6F C;  3A1I A;  2IO5 B;  1KU5 A;  3AZN D;  1HTA A;  5AY8 C;  3AZG B;  2Y2L A;  4LD9 D;  4G92 B;  3AZI C;  3AFA B;  5CPJ A;  4H9Q B;  2Y2N A;  3AZG D;  4Z66 B;  1KX5 C;  2F8N G;  5B2J C;  3AFA D;  3X1T C;  4CSR B;  3UT9 A;  4Z66 D;  3LZ0 A;  1JFI A;  3VH5 W;  5AY8 B;  5CPK C;  3AZI B;  5AVB A;  1T3U A;  5AY8 D;  3MGP A;  2NZD C;  3AZI D;  5B2J B;  5B40 A;  4XUJ A;  3AZE A;  3AYW C;  3MVD C;  4YM6 C;  5AV6 C;  1P3A C;  1P3B C;  5B2J D;  1KX5 D;  5CPK B;  1P3I A;  5B33 A;  4WNN A;  5C3I C;  3B0C T;  3AN2 C;  3MNN A;  3UTB A;  3UTA A;  1AOI A;  5CPK D;  2NZD B;  3VH6 T;  1ID3 A;  4J8X A;  4QLC C;  3W98 C;  2NZD D;  1P3A B;  5AV6 B;  1P3B B;  5F99 C;  3AZM C;  5B31 A;  5C3I B;  1P3B D;  5AV6 D;  1P3A D;  5AV5 B;  3WTP A;  3AN2 B;  5B0Y C;  3WA9 C;  4JJN C;  1KX3 A;  5AV5 D;  3AN2 D;  3AZN A;  4H9R B;  4KUD C;  4QLC B;  3MGS A;  3W98 B;  2PYO C;  5BNX B;  4LD9 A;  5BO0 B;  3REJ A;  5F99 B;  4QLC D;  3AZM B;  3W98 D;  2XD5 A;  1P3L C;  5B0Y B;  3WA9 B;  5F99 D;  4H9Q A;  3AZM D;  4JJN B;  4Z66 A;  5JA4 A;  4WV4 B;  2F2A C;  4EO5 C;  5B0Y D;  2JCH A;  4CSR A;  4E45 A;  5AVC C;  3REL C;  4JJN D;  2PYO B;  3WA9 D;  2Y2M A;  3B6F A;  2FJ7 C;  5AY8 A;  1B67 A;  2PYO D;  2JE5 A;  3AZI A;  1Z2C B;  1P3L B;  2Y2P A;  3EG5 B;  2W8S A;  1KX5 A;  3X1T A;  1P3L D;  3REL B;  4EO5 B;  1P3F C;  5AVC B;  1TAF A;  5B2I A;  1M19 A;  4H9O B;  3REL D;  2FJ7 B;  3MGQ C;  5AVC D;  5CPK A;  5B32 B;  5BNV B;  2Y2O A;  2YFV B;  5B1M C;  2FJ7 D;  5B32 D;  3TU4 A;  2ZY2 A;  1M18 B;  3H0R C;  1P3F B;  3AYW A;  3MVD A;  2G5I C;  4YM6 A;  5AV6 A;  5B24 B;  2YFW B;  3AV2 C;  1P3A A;  1P3B A;  4G91 B;  1M18 D;  5GSU C;  1P3F D;  3AV1 C;  3X1S C;  2F8N H;  4J8U C;  3NQJ A;  4HGA B;  4ZBJ C;  5B24 D;  3LEL C;  3AN2 A;  5B1M B;  5KDM B;  5E5A C;  2Y2K A;  3KWQ C;  5B1M D;  3W96 C;  2BYM A;  1M1A B;  4QLC A;  3W98 A;  5GXQ A;  4AWL C;  4X23 C;  5BNX A;  3AV2 B;  1P3M C;  5GSU B;  3AV1 B;  1M1A D;  4J8U B;  3AZM A;  4UUZ B;  4ZBJ B;  4H9P B;  3AV2 D;  3LEL B;  2IO5 C;  5GSU D;  3AV1 D;  5B0Y A;  3WA9 A;  5E5A B;  4J8U D;  5AV9 B;  4KHA B;  4G92 C;  4J8W B;  2Y2Q A;  5B32 G;  3LEL D;  3KWQ B;  1BH8 B;  1P3P B;  4KUD A;  5E5A D;  3MGR C;  5AV9 D;  4AWL B;  4X23 B;  4J8V B;  4CAY B;  1P3M B;  4M6B A;  3KWQ D;  1P3P D;  3EPH A;  3C1C C;  3AZF B;  4X23 D;  4J8V D;  4YS3 A;  3C1B C;  1P3M D;  3REI A;  1P3L A;  3F6T A;  3A1K A;  3AZF D;  1P34 C;  2NQB C;  3AZH B;  2FFF B;  3REL A;  2J8P A;  5AVC A;  3MGR B;  3AZH D;  4H9O A;  3C1C B;  2FJ7 A;  3MGR D;  5DNM C;  4KGC A;  3C1B B;  5BNV A;  2YFV A;  3X1U B;  3C1C D;  3O62 B;  3LZ1 C;  1P34 B;  2NQB B;  3EPJ A;  3C1B D;  3B0B A;  4WU8 B;  3NQU A;  1ZLA C;  3X1U D;  3EPK A;  3O62 D;  3AZJ C;  1P34 D;  2NQB D;  4WU8 D;  3MGQ A;  5DNM B;  5B1M A;  2Y2I A;  4Z2M H;  3LZ1 B;  5DNM D;  2F8N A;  2BYK B;  5AV5 C;  2G5H C;  3V9R A;  1ZLA B;  3WAA C;  2ARO B;  3AZJ B;  3LZ1 D;  3B6G B;  3AV2 A;  5GSU A;  1ZLA D;  2RVQ D;  3X1S A;  2ARO D;  3B0C W;  3AZJ D;  1H3O B;  3AV1 A;  4UUZ A;  3IP4 C;  3B6G D;  3LEL A;  4WZS B;  5E5A A;  5CHL B;  4KHA A;  2HIO B;  1KX4 A;  3KWQ A;  1BH8 A;  3W96 A;  3WAA B;  5GT3 C;  4X23 A;  2HIO D;  4CAY A;  1P3M A;  3WAA D;  3A6N C;  2HUE C;  4DRA A;  3WKJ C;  3AZG A;  4XZQ C;  3AZL C;  4WU9 C;  3AFA A;  2UWX A;  5GT3 B;  3MGR A;  4R8P C;  2ZY4 A;  3A6N B;  3C1C A;  5GT3 D;  2HUE B;  3C1B A;  3B0D B;  3A6N D;  3WKJ B;  5B32 C;  4XZQ B;  5AV8 C;  3AZL B;  4WU9 B;  3KUY C;  3WKJ D;  4XZQ D;  4R8P B;  3AZL D;  4Z5T B;  4WU9 D;  5B2J A;  1M18 C;  3H0M C;  4R8P D;  2VQR A;  4H9N B;  4Z5T D;  5B24 C;  4G91 C;  5AV8 B;  4E44 A;  1N1J B;  3LZ1 A;  4HGA C;  3KUY B;  1ZLA A;  5CP6 C;  2NZD A;  5AV8 D;  3KUY D;  1P3G C;  1M1A C;  1H3O A;  4NE6 A;  5G49 B;  4ZUX C;  3AZK C;  5AV5 A;  1U35 C;  5CP6 B;  3WAA A;  5B40 C;  5AV9 C;  2CV5 C;  4J8W C;  1P3G B;  1P3P C;  3LZ0 B;  4H9R A;  5CP6 D;  3P5J B;  4J8V C;  1P3G D;  5BO0 A;  5B33 C;  3LZ0 D;  5F99 A;  4ZUX B;  3AZF C;  3W99 C;  3AZK B;  4H9S C;  1U35 B;  4ZUX D;  5B40 B;  5GT3 A;  4JJN A;  3AZK D;  2CV5 B;  4XUJ B;  3AZE B;  3AZH C;  1U35 D;  3A6N A;  5BT1 D;  5JRG C;  5B40 D;  2PYO A;  3VH6 A;  2CV5 D;  4J8W D;  3AZE D;  2DQN C;  5B33 B;  2ZY3 A;  4NE5 A;  1R4V A;  3WKJ A;  1BH9 B;  3UTB B;  4XZQ A;  3UTA B;  3AZL A;  3W99 B;  4WU9 A;  5B33 D;  5DNN C;  3X1U C;  3O62 C;  3W99 D;  3UTA D;  4R8P A;  3KFU G;  4DRB A;  3W97 C;  4DQY B;  4WU8 C;  1Q9C A;  5JRG B;  3REJ C;  1WWS A;  5CPI C;  5JRG D;  1F66 C;  5B32 A;  5AV8 A;  3KUY A;  5DNN B;  1KX3 B;  3WTP E;  3W97 B;  3MGS B;  1M18 A;  3REH C;  5DNN D;  1KX3 D;  1P3F A;  2RVQ C;  2ARO C;  3REJ B;  3KXB C;  5B24 A;  2YFW A;  1B6W A;  5G49 A;  3MGS D;  1P3O C;  3B6G C;  3W97 D;  5CPI B;  3REJ D;  1F66 B;  5B1L C;  3VH5 T;  1EQZ C;  5KDM A;  5JA4 B;  5CPI D;  5CP6 A;  1P3K C;  1F66 D;  5FUG B;  2HIO C;  1A7W A;  1HQ3 C;  1P3G A;  3REH B;  5B2I C;  1M19 C;  3LJA C;  1TZY C;  1M1A A;  3B6F B;  3KXB B;  1P3O B;  3REH D;  3B6F D;  4J8U A;  4ZUX A;  5B1L B;  3KXB D;  3AZK A;  2RIQ A;  4H9P A;  2LY8 A;  1U35 A;  3VH6 W;  1P3O D;  1EQZ B;  3TU4 C;  1KX5 B;  5B31 G;  3X1T B;  1P3K B;  5AV9 A;  5B1L D;  2CV5 A;  4J8W A;  1HQ3 B;  1P3P A;  1TAF B;  3KSY A;  5BS7 C;  5B2I B;  1M19 B;  1EQZ D;  3LJA B;  1TZY B;  3X1T D;  1P3K D;  3X1V C;  4J8V A;  1HQ3 D;  5B2I D;  1M19 D;  3LJA D;  1TZY D;  2L5A A;  3AZF A;  1BH9 A;  3R45 B;  3W99 A;  3H0L C;  4H9S A;  3REK C;  3TU4 B;  3B0D C;  2DF4 C;  2ZY5 A;  3AYW B;  3AZH A;  5GT0 C;  3MVD B;  5GXQ C;  2CWE A;  3TU4 D;  4YM6 B;  2F8N K;  1S32 C;  5JRG A;  3X1V B;  4Z5T C;  3AYW D;  3MVD D;  3NQJ B;  4YM6 D;  2Y2J A;  2Y2G A;  3X1V D;  3REK B;  5DNN A;  3X1U A;  3O62 A;  1F1E A;  1P34 A;  2NQB A;  3REK D;  2BYM B;  3W97 A;  5GT0 B;  5GXQ B;  5B0Z C;  4WU8 A;  1S32 B;  2ZM5 A;  5GT0 D;  5GXQ D;  4YS3 C;  1W2E A;  5CPI A;  1S32 D;  1F66 A;  5DNM A;  3REI C;  1BFM A;  5FUG A;  2BYK A;  5CPJ C;  4KUD B;  3REH A;  5B0Z B;  3AZJ A;  2ARO A;  4Z2M G;  3KXB A;  3UT9 C;  4KUD D;  3B6G A;  1P3O A;  5B0Z D;  3LZ0 C;  4YS3 B;  4KGC C;  3REI B;  5B1L A;  1EQZ A;  4YS3 D;  5AVB C;  1ULY A;  3REI D;  1P3K A;  5CPJ B;  2HIO A;  1HQ3 A;  3MGP C;  3LJA A;  1TZY A;  5BT1 C;  4XUJ C;  5CPJ D;  2XD1 A;  3UT9 B;  3AZE C;  4KGC B;  1JFI B;  1PZR A;  3R45 A;  3UT9 D;  1P3I C;  4WJ3 C;  4KGC D;  5AVB B;  3MNN C;  3UTA C;  3UTB C;  3NQU B;  1AOI C;  3MGP B;  3VH5 A;  5BS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...