2NZDC

Nucleosome core particle containing 145 bp of dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdC00
3X1SA 3R45A 5B2IC 5B0YD 3VH6T 2FJ7A 4H9PB 4J8WD 1KX4B 1P3PA 5CPIC 3X1VC 4YS3D 3UT9B 5B1LD 5GSUB 5B40A 3X1VD 1ZLAB 4G91C 5BT1C 3RELC 3AV2D 2F8NK 1TAFA 3WKJA 2AROC 2CWEA 3LZ1B 3REHA 5B31A 3REJA 3X1VB 2BYMA 4H9QA 1P3PC 4DRAA 2F8NH 4Z66B 3W97A 4X23C 3REKC 5BO0B 2F8NA 5AVBB 4WU8C 1P3KC 4KGCA 3B0BA 5CPKD 5B24B 1P3MC 3MVDA 3MGQA 1KX3D 1M18A 5GT0A 4JJND 3AV1A 4XUJA 4XUJB 4Z66D 3KXBD 5BS7A 3C1CC 5B1MA 2F8NB 3UTAD 5AV8B 3W97B 5AVBA 3X1TC 3NQUB 4Z66A 3MVDC 4YM6D 4KGCD 5B31B 1ID3A 3AZJD 3X1VA 3LZ1A 1HQ3C 3B6GC 1KU5A 4NE3A 3LZ0C 3REJB 3AZJC 5CPJB 1P3LD 3WA9C 4EO5B 4ZUXA 5AV9D 1KX5B 5B31D 3WAAC 5AVCB 2IO5B 4AWLC 5B33B 5B31C 3LZ1D 4Z66C 3UT9A 3KUYD 4WU9A 1P3FA 3AV2A 3C1BA 2PYOA 3AFAC 4J8VC 5B32G 2YFVA 3AFAD 3REIA 4QLCD 5BT1D 4H9RB 1P34C 4X23B 3REKB 5B33D 3WTPE 1P34D 3MGSD 3V9RB 3AZLC 1BH9B 1HQ3D 1P3MA 3O62A 5B24D 1F66C 3B6GD 5B0YA 1AOIC 3WA9D 5GT3A 2BYKA 4XZQC 3KUYA 4R8PB 2CV5A 5B1MC 3A6NA 3V9RA 1P3GC 2HIOD 5B2ID 4Z5TC 5AV9B 5B31G 3AZID 3X1UC 4WNNA 3KWQD 3AN2A 3X1TB 2YFVB 4H9SC 3WTPD 3W99B 3AZGA 3AZND 1M19A 3WTPC 3AV2B 4R8PC 2HIOA 2IO5C 3VH5A 3RELA 2PYOC 1P3OD 2JSSA 5CPKC 5GSUD 3UTBA 1EQZC 2NZDD 3X1UD 4ZBJB 4J8UA 5B24C 3MGRB 3LELB 3LELA 4J8UB 5CPJA 3MNNB 4AWLB 3AV2C 1BH8A 3UTAC 3W96A 3TU4B 2HIOC 1P3ID 4KUDD 4CAYA 3UTBB 1P3GA 5GT3D 3MVDD 4HGAB 1M19B 5AVBD 3REHC 4WU9D 1Q9CA 2LY8A 4H9OB 3AN2B 4X23D 3REKD 5AV6D 1ID3C 5B1MB 5G49A 4R8PA 2NZDC 4UUZB 3WTPA 1P3BC 3X1TD 1P3BD 1KX4D 5DNMD 5B2JB 3KUYB 1P3LA 5B0YB 3AN2D 1U35C 3X1UA 3AN2C 5AV6C 4KGCB 5B33C 3O62B 3MGSC 5GT0C 3AZLD 3AV1C 1P3IB 4KUDB 4LD9B 4H9SA 4J8VD 1P3BB 4X23A 3REKA 3W97C 3C1BB 1M1AC 3KWQA 3REIB 3W96D 3REHD 3WA9A 5B1MD 5AV6B 1P34B 4KGCC 5AY8B 1TAFB 3WKJB 4WU9B 3B6FB 1KX5A 3MGSA 5B0ZB 5CPJC 4XZQD 1TZYB 1P3AB 3W96C 3UTAA 5BNVA 5KDMB 5AVCC 1P34A 1KX3B 5AVCD 3KWQB 3AZKC 5GT0D 3AV1D 3X1SC 5AV6A 3MGPA 3NQUA 5DNNA 1AOID 3B0CT 4R8PD 2FJ7C 5CPIA 1U35B 1P3BA 5JRGB 5C3IC 4YM6B 4WU8A 1P3KA 5E5AC 3KWQC 5GT0B 3AV1B 5B2JA 1P3PD 1JFIA 3AZIB 1M18B 1HTAA 1A7WA 5DNNC 4NE5A 3LELC 1M1AB 3MVDB 3LJAB 1P3OC 4WU8D 1P3KD 5GT3C 4XUJD 4YM6A 1N1JB 4Z5TD 5JRGA 5CHLB 5AVBC 3UTBC 2BYMB 1S32C 4M6BA 1WWIA 4J8WB 3AYWC 3LELD 5DNMA 5DNNB 3REHB 1M18D 3VH5T 3W96B 1KX5C 5JA4B 3B0CW 5B2JD 4CAYB 2PYOD 4XUJC 4CSRA 3MNNA 4QLCB 5KDMA 5E5AD 3AZJA 3A6ND 2AROB 5AV5D 3A6NC 3AZNB 1M1AD 5B0ZA 1ZLAA 4E44A 2FJ7B 4J8UC 3R45B 3RELB 1P3PB 3B6FA 3AZGB 3MGPC 1P3IC 4KUDC 3X1SB 5E5AB 2HIOB 3LZ0B 1F66B 1H3OB 5CPJD 2HUEB 4JJNA 5B32D 1U35D 3REIC 1R4VA 5B1LA 4XZQB 3W98D 3WAAB 3AZFB 1ID3D 3AYWA 3AZLA 2BYKB 2CV5B 5GT3B 3AZKD 5BNXA 1WWSA 3B6FC 3X1UB 2NZDB 3W97D 5B32B 5B32A 5AV8D 5GXQD 1KX4C 5AV5C 2NZDA 1AOIA 3AFAA 3REID 3WTPB 4G91B 5G49B 3AZGD 3AZFA 4JJNB 3NQJA 4Z2MG 1H3OA 3AZKB 4LD9C 4H9OA 5AV8C 1F66A 3C1BC 1P3GD 3MNNC 3W98C 5AVCA 5FUGB 4ZUXB 3TU4C 3X1SD 3AZJB 5B2IB 4QLCA 3AZNC 2AROA 4CSRB 1M18C 5GSUC 1EQZD 5DNMB 4KHAB 3B0DB 1HQ3A 1P3MD 3B6GA 3UTBD 5JA4A 3AZGC 4J8WA 5BS7C 2F8ND 1KX3C 4ZBJC 2YFWB 4YS3A 3KXBC 5GXQB 3X1TA 3LJAA 2RVQD 3MGRD 4WNNB 2NQBA 5AV8A 3C1BD 3AZIA 4ZUXD 5AV9A 4H9NA 2L5AA 4J8XB 4E45A 3REJD 3TU4D 4J8XA 4Z5TB 3AYWD 4WU8B 1P3KB 1EQZA 3MGQB 3LZ0D 3W99D 4HGAC 1KX5D 1U35A 1BFMA 5B24A 3W99C 5CP6A 3AZEA 3AZHA 5GXQA 5F99C 5F99D 3MGPB 5AV9C 5BO0A 4KHAA 3MGQD 1KX3A 2HUEC 5B40C 4H9QB 2F8NG 4J8WC 3KUYC 3KXBA 5BNVB 4YS3C 1P3FB 3B6FD 1ZLAC 4J8XD 4G92B 4WV4B 4ZUXC 3UTAB 4QLCC 3O62C 5B33A 3MGSB 3REJC 1TZYA 1P3AA 5B32C 1KX4A 3KXBB 5GSUA 5B40B 5AY8A 3WA9B 1F66D 3MNND 4J8UD 5CPID 4H9PA 5CPKA 4G92C 3LJAD 3AZKA 1ID3B 3RELD 4DRBA 3NQJB 4LD9A 3AZEB 5GXQC 3AZHB 3MGQC 1TZYC 1P3AC 3AZIC 1M19C 3AFAB 1P3IA 3C1CA 5CP6B 5B0YC 4KUDA 3AZMC 1P3LB 4J8XC 5F99B 3AZMD 1B67A 2CV5C 1EQZB 4H9NB 4LD9D 3AZED 3AZHD 4UUZA 4Z5TA 3O62D 3AZLB 2FJ7D 2NQBB 3AZEC 3AZHC 3WAAA 2RVQC 2AROD 3MGRC 5AV5A 2YFWA 3UT9D 3AZMB 3B0DC 4YS3B 1P3FC 5JRGC 3LZ0A 5AY8C 4JJNC 4YM6C 1P3GB 1HQ3B 3B6GB 3C1CD 5DNND 3TU4A 3AZNA 1M19D 3UT9C 1P3FD 5B2IA 1BH8B 3MGRA 3WKJD 5AY8D 1P3OB 1P3OA 3WAAD 3W98B 1S32D 4WU9C 5FUGA 3W98A 1F1EA 5B40D 5B0ZC 5B2JC 5CP6C 3W99A 4Z2MH 5DNMC 4NFTA 3VH6W 5C3IB 5JRGD 1N1JA 1ULYA 3LZ1C 3AZMA 4WZSB 4J8VA 5AV5B 1M1AA 1ZLAD 3A6NB 1AOIB 5B1LC 1S32A 5CP6D 4EO5C 1JFIB 3MGPD 3KSYA 4NE6A 1P3LC 5F99A 3LJAC 5BNXB 3WKJC 3C1CB 3VH6A 1BH9A 2NQBC 1B6WA 1S32B 1TZYD 1P3AD 5B0ZD 1P3MB 3AYWB 5CPIB 5B1LB 3VH5W 4XZQA 4J8VB 5E5AA 3AZFC 4H9RA 2PYOB 2CV5D 5CPKB 3AZFD 2NQBD
chains in the Genus database with same CATH superfamily
3X1SA 3R45A 5B2IC 5B0YD 3A1KA 3VH6T 2FJ7A 4H9PB 4J8WD 1KX4B 1P3PA 5CPIC 3X1VC 4YS3D 3UT9B 5B1LD 5GSUB 5B40A 3X1VD 1ZLAB 4G91C 5BT1C 3RELC 3AV2D 2F8NK 1TAFA 3WKJA 2AROC 2CWEA 3LZ1B 3IP4C 3REHA 5B31A 3REJA 3X1VB 2BYMA 4H9QA 2Y2IA 1P3PC 4DRAA 2F8NH 4Z66B 3W97A 4X23C 3REKC 5BO0B 2F8NA 1T3UA 5AVBB 4WU8C 1P3KC 4KGCA 3B0BA 5CPKD 5B24B 1P3MC 3MVDA 3MGQA 1KX3D 1M18A 5GT0A 4JJND 3AV1A 4XUJA 4XUJB 4Z66D 3KXBD 5BS7A 3C1CC 5B1MA 2F8NB 3UTAD 5AV8B 3W97B 5AVBA 3X1TC 3NQUB 4Z66A 3MVDC 1Z2CB 3P5JB 4YM6D 4KGCD 5B31B 1ID3A 2JCHA 3AZJD 3X1VA 3LZ1A 1HQ3C 3B6GC 1KU5A 4NE3A 3LZ0C 3REJB 3AZJC 5CPJB 2ZY5A 1P3LD 4DQYB 3WA9C 4EO5B 4ZUXA 5AV9D 1KX5B 5B31D 3WAAC 5AVCB 2IO5B 4AWLC 5B33B 5B31C 3LZ1D 4Z66C 3UT9A 3KUYD 4WU9A 1P3FA 3AV2A 3C1BA 2PYOA 3AFAC 4J8VC 5B32G 2YFVA 3AFAD 3REIA 4QLCD 5BT1D 4H9RB 1P34C 4X23B 3REKB 4UPKA 5B33D 3WTPE 1P34D 3MGSD 3V9RB 3AZLC 1BH9B 3AL0C 1HQ3D 1P3MA 3O62A 5B24D 1F66C 3B6GD 5B0YA 2UWXA 1AOIC 3WA9D 5GT3A 2BYKA 4XZQC 3KUYA 4R8PB 2CV5A 5B1MC 3A6NA 3V9RA 1P3GC 2HIOD 5B2ID 4Z5TC 5AV9B 5B31G 2G5HC 3AZID 3X1UC 4WNNA 3KWQD 3AN2A 3X1TB 2YFVB 4H9SC 2XD1A 3WTPD 3W99B 3AZGA 3AZND 1M19A 3WTPC 3AV2B 2Y2QA 4R8PC 2HIOA 2IO5C 3VH5A 3RELA 2PYOC 1P3OD 2JSSA 5CPKC 5GSUD 3UTBA 1EQZC 2NZDD 3X1UD 4ZBJB 4J8UA 5B24C 2Y2MA 3MGRB 2W8SA 3LELB 3LELA 4J8UB 5CPJA 3MNNB 4AWLB 3AV2C 1BH8A 3UTAC 3EPHA 3W96A 3TU4B 2HIOC 1P3ID 4KUDD 4CAYA 3UTBB 1P3GA 5GT3D 3MVDD 4HGAB 1M19B 5AVBD 3REHC 4WU9D 1Q9CA 2LY8A 4H9OB 3AN2B 4X23D 3REKD 5AV6D 1ID3C 5B1MB 2Y2LA 5G49A 4R8PA 2NZDC 4UUZB 3WTPA 1P3BC 2XD5A 3X1TD 1P3BD 1KX4D 4WJ3C 5DNMD 5B2JB 3KUYB 1P3LA 5B0YB 3AN2D 1U35C 3X1UA 3AN2C 5AV6C 4KGCB 5B33C 3O62B 3MGSC 5GT0C 3F6TA 3AZLD 3AV1C 1P3IB 4KUDB 4LD9B 4H9SA 4J8VD 1P3BB 4X23A 3REKA 3W97C 3C1BB 1M1AC 3KWQA 3REIB 3W96D 3REHD 3WA9A 5B1MD 5AV6B 1P34B 4KGCC 5AY8B 1TAFB 3WKJB 4WU9B 3B6FB 1KX5A 3MGSA 5B0ZB 5CPJC 4XZQD 1TZYB 1P3AB 3W96C 3UTAA 5BNVA 5KDMB 5AVCC 1P34A 2J8PA 1KX3B 5AVCD 3KWQB 3AZKC 5GT0D 3AV1D 3X1SC 5AV6A 3MGPA 3NQUA 5DNNA 1AOID 3B0CT 4R8PD 2FJ7C 5CPIA 1U35B 1P3BA 5JRGB 5C3IC 4YM6B 4WU8A 1P3KA 5E5AC 3KWQC 5GT0B 3AV1B 5B2JA 1P3PD 1JFIA 3AZIB 1M18B 1HTAA 1A7WA 5DNNC 2ZY3A 4NE5A 3LELC 1M1AB 3MVDB 3LJAB 1P3OC 4WU8D 1P3KD 5GT3C 4XUJD 4YM6A 1N1JB 4Z5TD 5JRGA 5CHLB 2DF4C 5AVBC 3UTBC 2BYMB 1S32C 4M6BA 1WWIA 4J8WB 3AYWC 3LELD 5DNMA 5DNNB 3REHB 1M18D 3VH5T 3W96B 1KX5C 5JA4B 3B0CW 5B2JD 3H0MC 4CAYB 4XUJC 2PYOD 4CSRA 3MNNA 4QLCB 3A1IA 5KDMA 5E5AD 3AZJA 3A6ND 2Y2HA 2AROB 5AV5D 3A6NC 3AZNB 1M1AD 5B0ZA 1ZLAA 4E44A 2FJ7B 4J8UC 3R45B 3RELB 1P3PB 3B6FA 3AZGB 3MGPC 3EG5B 2BG1A 3X1SB 5E5AB 2HIOB 3LZ0B 1P3IC 1F66B 1H3OB 4KUDC 5CPJD 2HUEB 2VQRA 4JJNA 5B32D 1U35D 3EPJA 3REIC 1R4VA 2ZY2A 5B1LA 4XZQB 3W98D 3WAAB 3AZFB 1ID3D 3AYWA 3AZLA 2BYKB 2CV5B 5GT3B 3AZKD 5BNXA 1WWSA 3B6FC 3X1UB 2NZDB 3W97D 5B32B 5B32A 5AV8D 5GXQD 1KX4C 5AV5C 2NZDA 1AOIA 3AFAA 3REID 3WTPB 4G91B 5G49B 3AZGD 3AZFA 4JJNB 3NQJA 4Z2MG 1H3OA 3AZKB 4LD9C 4H9OA 5AV8C 1F66A 3C1BC 1P3GD 3MNNC 3W98C 5AVCA 5FUGB 4ZUXB 3TU4C 3X1SD 3AZJB 3EPKA 5B2IB 4QLCA 3AZNC 2AROA 4CSRB 1M18C 5GSUC 1EQZD 5DNMB 4KHAB 3B0DB 1HQ3A 1P3MD 3B6GA 3UTBD 5JA4A 3AZGC 4J8WA 1W2EA 5BS7C 2F8ND 1KX3C 4ZBJC 2YFWB 4YS3A 3KXBC 5GXQB 3X1TA 3LJAA 2RVQD 3MGRD 4WNNB 2NQBA 5AV8A 3C1BD 3AZIA 4ZUXD 5AV9A 4H9NA 2L5AA 4J8XB 2Y2JA 4E45A 3REJD 3TU4D 4J8XA 4Z5TB 3AYWD 4WU8B 1P3KB 2Y2OA 1EQZA 3MGQB 3LZ0D 3W99D 4HGAC 1KX5D 1U35A 1BFMA 5B24A 3W99C 5CP6A 3AZEA 3AZHA 5GXQA 5F99C 5F99D 2DQNC 3MGPB 5AV9C 5BO0A 2Y2NA 4KHAA 3MGQD 1KX3A 2HUEC 5B40C 4H9QB 2F8NG 4J8WC 3KUYC 3KXBA 5BNVB 4YS3C 2FFFB 1P3FB 3B6FD 1ZLAC 4J8XD 4G92B 4WV4B 4ZUXC 3UTAB 4QLCC 3O62C 5B33A 3MGSB 3REJC 1TZYA 1P3AA 5B32C 1KX4A 3KXBB 1PZRA 5GSUA 5B40B 5AY8A 3WA9B 1F66D 3MNND 4J8UD 5CPID 4H9PA 5CPKA 4G92C 3LJAD 3AZKA 2Y2GA 1ID3B 3RELD 4DRBA 2ZM5A 3NQJB 4LD9A 3AZEB 5GXQC 3AZHB 3MGQC 1TZYC 1P3AC 3AZIC 1M19C 3AFAB 1P3IA 3C1CA 5CP6B 5B0YC 4KUDA 3AZMC 1P3LB 4J8XC 5F99B 3AZMD 1B67A 2CV5C 1EQZB 4H9NB 4LD9D 3AZED 3AZHD 4UUZA 4Z5TA 3O62D 3AZLB 2FJ7D 2NQBB 3AZEC 3AZHC 3WAAA 2G5IC 2RVQC 2AROD 3MGRC 5AV5A 2RIQA 2YFWA 3UT9D 3AZMB 3B0DC 4YS3B 1P3FC 5JRGC 3LZ0A 5AY8C 4JJNC 4YM6C 1P3GB 1HQ3B 3B6GB 3C1CD 5DNND 3TU4A 3FDDA 3AZNA 1M19D 3UT9C 1P3FD 5B2IA 1BH8B 3MGRA 2JE5A 3WKJD 5AY8D 1P3OB 2Y2KA 1P3OA 3WAAD 3W98B 1S32D 4WU9C 5FUGA 3W98A 1F1EA 5B40D 5B0ZC 3KFUG 5B2JC 5CP6C 3W99A 4Z2MH 5DNMC 3H0LC 4NFTA 3VH6W 5C3IB 5JRGD 1N1JA 1ULYA 3LZ1C 3AZMA 4WZSB 4J8VA 5AV5B 1M1AA 1ZLAD 3A6NB 1AOIB 2ZY4A 5B1LC 1S32A 5CP6D 4EO5C 1JFIB 3MGPD 3KSYA 4NE6A 3EPLA 1P3LC 5F99A 3LJAC 5BNXB 3WKJC 3C1CB 3VH6A 1BH9A 2NQBC 1B6WA 1S32B 1TZYD 1P3AD 5B0ZD 1P3MB 3AYWB 5CPIB 2F2AC 5B1LB 3VH5W 4XZQA 4J8VB 3H0RC 5E5AA 3AZFC 4H9RA 2PYOB 2CV5D 5CPKB 3AZFD 2Y2PA 2NQBD
chains in the Genus database with same CATH topology
3X1SA 3R45A 5B2IC 5B0YD 3A1KA 3VH6T 2FJ7A 4H9PB 4J8WD 1KX4B 1P3PA 5CPIC 3X1VC 4YS3D 3UT9B 5B1LD 5GSUB 5B40A 3X1VD 1ZLAB 4G91C 5BT1C 3RELC 3AV2D 2F8NK 1TAFA 3WKJA 2AROC 2CWEA 3LZ1B 3IP4C 3REHA 5B31A 3REJA 3X1VB 2BYMA 4H9QA 2Y2IA 1P3PC 4DRAA 2F8NH 4Z66B 3W97A 4X23C 3REKC 5BO0B 2F8NA 1T3UA 5AVBB 4WU8C 1P3KC 4KGCA 3B0BA 5CPKD 5B24B 1P3MC 3MVDA 3MGQA 1KX3D 1M18A 5GT0A 4JJND 3AV1A 4XUJA 4XUJB 4Z66D 3KXBD 5BS7A 3C1CC 5B1MA 2F8NB 3UTAD 5AV8B 3W97B 5AVBA 3X1TC 3NQUB 4Z66A 3MVDC 1Z2CB 3P5JB 4YM6D 4KGCD 5B31B 1ID3A 2JCHA 3AZJD 3X1VA 3LZ1A 1HQ3C 3B6GC 1KU5A 4NE3A 3LZ0C 3REJB 3AZJC 5CPJB 2ZY5A 1P3LD 4DQYB 3WA9C 4EO5B 4ZUXA 5AV9D 1KX5B 5B31D 3WAAC 5AVCB 2IO5B 4AWLC 5B33B 5B31C 3LZ1D 4Z66C 3UT9A 3KUYD 4WU9A 1P3FA 3AV2A 3C1BA 2PYOA 3AFAC 4J8VC 5B32G 2YFVA 3AFAD 3REIA 4QLCD 5BT1D 4H9RB 1P34C 4X23B 3REKB 4UPKA 5B33D 3WTPE 1P34D 3MGSD 3V9RB 3AZLC 1BH9B 3AL0C 1HQ3D 1P3MA 3O62A 5B24D 1F66C 3B6GD 5B0YA 2UWXA 1AOIC 3WA9D 5GT3A 2BYKA 4XZQC 3KUYA 4R8PB 2CV5A 5B1MC 3A6NA 3V9RA 1P3GC 2HIOD 5B2ID 4Z5TC 5AV9B 5B31G 2G5HC 3AZID 3X1UC 4WNNA 3KWQD 3AN2A 3X1TB 2YFVB 4H9SC 2XD1A 3WTPD 3W99B 3AZGA 3AZND 1M19A 3WTPC 3AV2B 2Y2QA 4R8PC 2HIOA 2IO5C 3VH5A 3RELA 2PYOC 1P3OD 2JSSA 5CPKC 5GSUD 3UTBA 1EQZC 2NZDD 3X1UD 4ZBJB 4J8UA 5B24C 2Y2MA 3MGRB 2W8SA 3LELB 3LELA 4J8UB 5CPJA 3MNNB 4AWLB 3AV2C 1BH8A 3UTAC 3EPHA 3W96A 3TU4B 2HIOC 1P3ID 4KUDD 4CAYA 3UTBB 1P3GA 5GT3D 3MVDD 4HGAB 1M19B 5AVBD 3REHC 4WU9D 1Q9CA 2LY8A 4H9OB 3AN2B 4X23D 3REKD 5AV6D 1ID3C 5B1MB 2Y2LA 5G49A 4R8PA 2NZDC 4UUZB 3WTPA 1P3BC 2XD5A 3X1TD 1P3BD 1KX4D 4WJ3C 5DNMD 5B2JB 3KUYB 1P3LA 5B0YB 3AN2D 1U35C 3X1UA 3AN2C 5AV6C 4KGCB 5B33C 3O62B 3MGSC 5GT0C 3F6TA 3AZLD 3AV1C 1P3IB 4KUDB 4LD9B 4H9SA 4J8VD 1P3BB 4X23A 3REKA 3W97C 3C1BB 1M1AC 3KWQA 3REIB 3W96D 3REHD 3WA9A 5B1MD 5AV6B 1P34B 4KGCC 5AY8B 1TAFB 3WKJB 4WU9B 3B6FB 1KX5A 3MGSA 5B0ZB 5CPJC 4XZQD 1TZYB 1P3AB 3W96C 3UTAA 5BNVA 5KDMB 5AVCC 1P34A 2J8PA 1KX3B 5AVCD 3KWQB 3AZKC 5GT0D 3AV1D 3X1SC 5AV6A 3MGPA 3NQUA 5DNNA 1AOID 3B0CT 4R8PD 2FJ7C 5CPIA 1U35B 1P3BA 5JRGB 5C3IC 4YM6B 4WU8A 1P3KA 5E5AC 3KWQC 5GT0B 3AV1B 5B2JA 1P3PD 1JFIA 3AZIB 1M18B 1HTAA 1A7WA 5DNNC 2ZY3A 4NE5A 3LELC 1M1AB 3MVDB 3LJAB 1P3OC 4WU8D 1P3KD 5GT3C 4XUJD 4YM6A 1N1JB 4Z5TD 5JRGA 5CHLB 2DF4C 5AVBC 3UTBC 2BYMB 1S32C 4M6BA 1WWIA 4J8WB 3AYWC 3LELD 5DNMA 5DNNB 3REHB 1M18D 3VH5T 3W96B 1KX5C 5JA4B 3B0CW 5B2JD 3H0MC 4CAYB 4XUJC 2PYOD 4CSRA 3MNNA 4QLCB 3A1IA 5KDMA 5E5AD 3AZJA 3A6ND 2Y2HA 2AROB 5AV5D 3A6NC 3AZNB 1M1AD 5B0ZA 1ZLAA 4E44A 2FJ7B 4J8UC 3R45B 3RELB 1P3PB 3B6FA 3AZGB 3MGPC 3EG5B 2BG1A 3X1SB 5E5AB 2HIOB 3LZ0B 1P3IC 1F66B 1H3OB 4KUDC 5CPJD 2HUEB 2VQRA 4JJNA 5B32D 1U35D 3EPJA 3REIC 1R4VA 2ZY2A 5B1LA 4XZQB 3W98D 3WAAB 3AZFB 1ID3D 3AYWA 3AZLA 2BYKB 2CV5B 5GT3B 3AZKD 5BNXA 1WWSA 3B6FC 3X1UB 2NZDB 3W97D 5B32B 5B32A 5AV8D 5GXQD 1KX4C 5AV5C 2NZDA 1AOIA 3AFAA 3REID 3WTPB 4G91B 5G49B 3AZGD 3AZFA 4JJNB 3NQJA 4Z2MG 1H3OA 3AZKB 4LD9C 4H9OA 5AV8C 1F66A 3C1BC 1P3GD 3MNNC 3W98C 5AVCA 5FUGB 4ZUXB 3TU4C 3X1SD 3AZJB 3EPKA 5B2IB 4QLCA 3AZNC 2AROA 4CSRB 1M18C 5GSUC 1EQZD 5DNMB 4KHAB 3B0DB 1HQ3A 1P3MD 3B6GA 3UTBD 5JA4A 3AZGC 4J8WA 1W2EA 5BS7C 2F8ND 1KX3C 4ZBJC 2YFWB 4YS3A 3KXBC 5GXQB 3X1TA 3LJAA 2RVQD 3MGRD 4WNNB 2NQBA 5AV8A 3C1BD 3AZIA 4ZUXD 5AV9A 4H9NA 2L5AA 4J8XB 2Y2JA 4E45A 3REJD 3TU4D 4J8XA 4Z5TB 3AYWD 4WU8B 1P3KB 2Y2OA 1EQZA 3MGQB 3LZ0D 3W99D 4HGAC 1KX5D 1U35A 1BFMA 5B24A 3W99C 5CP6A 3AZEA 3AZHA 5GXQA 5F99C 5F99D 2DQNC 3MGPB 5AV9C 5BO0A 2Y2NA 4KHAA 3MGQD 1KX3A 2HUEC 5B40C 4H9QB 2F8NG 4J8WC 3KUYC 3KXBA 5BNVB 4YS3C 2FFFB 1P3FB 3B6FD 1ZLAC 4J8XD 4G92B 4WV4B 4ZUXC 3UTAB 4QLCC 3O62C 5B33A 3MGSB 3REJC 1TZYA 1P3AA 5B32C 1KX4A 3KXBB 1PZRA 5GSUA 5B40B 5AY8A 3WA9B 1F66D 3MNND 4J8UD 5CPID 4H9PA 5CPKA 4G92C 3LJAD 3AZKA 2Y2GA 1ID3B 3RELD 4DRBA 2ZM5A 3NQJB 4LD9A 3AZEB 5GXQC 3AZHB 3MGQC 1TZYC 1P3AC 3AZIC 1M19C 3AFAB 1P3IA 3C1CA 5CP6B 5B0YC 4KUDA 3AZMC 1P3LB 4J8XC 5F99B 3AZMD 1B67A 2CV5C 1EQZB 4H9NB 4LD9D 3AZED 3AZHD 4UUZA 4Z5TA 3O62D 3AZLB 2FJ7D 2NQBB 3AZEC 3AZHC 3WAAA 2G5IC 2RVQC 2AROD 3MGRC 5AV5A 2RIQA 2YFWA 3UT9D 3AZMB 3B0DC 4YS3B 1P3FC 5JRGC 3LZ0A 5AY8C 4JJNC 4YM6C 1P3GB 1HQ3B 3B6GB 3C1CD 5DNND 3TU4A 3FDDA 3AZNA 1M19D 3UT9C 1P3FD 5B2IA 1BH8B 3MGRA 2JE5A 3WKJD 5AY8D 1P3OB 2Y2KA 1P3OA 3WAAD 3W98B 1S32D 4WU9C 5FUGA 3W98A 1F1EA 5B40D 5B0ZC 3KFUG 5B2JC 5CP6C 3W99A 4Z2MH 5DNMC 3H0LC 4NFTA 3VH6W 5C3IB 5JRGD 1N1JA 1ULYA 3LZ1C 3AZMA 4WZSB 4J8VA 5AV5B 1M1AA 1ZLAD 3A6NB 1AOIB 2ZY4A 5B1LC 1S32A 5CP6D 4EO5C 1JFIB 3MGPD 3KSYA 4NE6A 3EPLA 1P3LC 5F99A 3LJAC 5BNXB 3WKJC 3C1CB 3VH6A 1BH9A 2NQBC 1B6WA 1S32B 1TZYD 1P3AD 5B0ZD 1P3MB 3AYWB 5CPIB 2F2AC 5B1LB 3VH5W 4XZQA 4J8VB 3H0RC 5E5AA 3AZFC 4H9RA 2PYOB 2CV5D 5CPKB 3AZFD 2Y2PA 2NQBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S A;  3R45 A;  5B2I C;  5B0Y D;  3VH6 T;  2FJ7 A;  4H9P B;  4J8W D;  1KX4 B;  1P3P A;  5CPI C;  3X1V C;  4YS3 D;  3UT9 B;  5B1L D;  5GSU B;  5B40 A;  3X1V D;  1ZLA B;  4G91 C;  5BT1 C;  3REL C;  3AV2 D;  2F8N K;  1TAF A;  3WKJ A;  2ARO C;  2CWE A;  3LZ1 B;  3REH A;  5B31 A;  3REJ A;  3X1V B;  2BYM A;  4H9Q A;  1P3P C;  4DRA A;  2F8N H;  4Z66 B;  3W97 A;  4X23 C;  3REK C;  5BO0 B;  2F8N A;  5AVB B;  4WU8 C;  1P3K C;  4KGC A;  3B0B A;  5CPK D;  5B24 B;  1P3M C;  3MVD A;  3MGQ A;  1KX3 D;  1M18 A;  5GT0 A;  4JJN D;  3AV1 A;  4XUJ A;  4XUJ B;  4Z66 D;  3KXB D;  5BS7 A;  3C1C C;  5B1M A;  2F8N B;  3UTA D;  5AV8 B;  3W97 B;  5AVB A;  3X1T C;  3NQU B;  4Z66 A;  3MVD C;  4YM6 D;  4KGC D;  5B31 B;  1ID3 A;  3AZJ D;  3X1V A;  3LZ1 A;  1HQ3 C;  3B6G C;  1KU5 A;  4NE3 A;  3LZ0 C;  3REJ B;  3AZJ C;  5CPJ B;  1P3L D;  3WA9 C;  4EO5 B;  4ZUX A;  5AV9 D;  1KX5 B;  5B31 D;  3WAA C;  5AVC B;  2IO5 B;  4AWL C;  5B33 B;  5B31 C;  3LZ1 D;  4Z66 C;  3UT9 A;  3KUY D;  4WU9 A;  1P3F A;  3AV2 A;  3C1B A;  2PYO A;  3AFA C;  4J8V C;  5B32 G;  2YFV A;  3AFA D;  3REI A;  4QLC D;  5BT1 D;  4H9R B;  1P34 C;  4X23 B;  3REK B;  5B33 D;  3WTP E;  1P34 D;  3MGS D;  3V9R B;  3AZL C;  1BH9 B;  1HQ3 D;  1P3M A;  3O62 A;  5B24 D;  1F66 C;  3B6G D;  5B0Y A;  1AOI C;  3WA9 D;  5GT3 A;  2BYK A;  4XZQ C;  3KUY A;  4R8P B;  2CV5 A;  5B1M C;  3A6N A;  3V9R A;  1P3G C;  2HIO D;  5B2I D;  4Z5T C;  5AV9 B;  5B31 G;  3AZI D;  3X1U C;  4WNN A;  3KWQ D;  3AN2 A;  3X1T B;  2YFV B;  4H9S C;  3WTP D;  3W99 B;  3AZG A;  3AZN D;  1M19 A;  3WTP C;  3AV2 B;  4R8P C;  2HIO A;  2IO5 C;  3VH5 A;  3REL A;  2PYO C;  1P3O D;  2JSS A;  5CPK C;  5GSU D;  3UTB A;  1EQZ C;  2NZD D;  3X1U D;  4ZBJ B;  4J8U A;  5B24 C;  3MGR B;  3LEL B;  3LEL A;  4J8U B;  5CPJ A;  3MNN B;  4AWL B;  3AV2 C;  1BH8 A;  3UTA C;  3W96 A;  3TU4 B;  2HIO C;  1P3I D;  4KUD D;  4CAY A;  3UTB B;  1P3G A;  5GT3 D;  3MVD D;  4HGA B;  1M19 B;  5AVB D;  3REH C;  4WU9 D;  1Q9C A;  2LY8 A;  4H9O B;  3AN2 B;  4X23 D;  3REK D;  5AV6 D;  1ID3 C;  5B1M B;  5G49 A;  4R8P A;  2NZD C;  4UUZ B;  3WTP A;  1P3B C;  3X1T D;  1P3B D;  1KX4 D;  5DNM D;  5B2J B;  3KUY B;  1P3L A;  5B0Y B;  3AN2 D;  1U35 C;  3X1U A;  3AN2 C;  5AV6 C;  4KGC B;  5B33 C;  3O62 B;  3MGS C;  5GT0 C;  3AZL D;  3AV1 C;  1P3I B;  4KUD B;  4LD9 B;  4H9S A;  4J8V D;  1P3B B;  4X23 A;  3REK A;  3W97 C;  3C1B B;  1M1A C;  3KWQ A;  3REI B;  3W96 D;  3REH D;  3WA9 A;  5B1M D;  5AV6 B;  1P34 B;  4KGC C;  5AY8 B;  1TAF B;  3WKJ B;  4WU9 B;  3B6F B;  1KX5 A;  3MGS A;  5B0Z B;  5CPJ C;  4XZQ D;  1TZY B;  1P3A B;  3W96 C;  3UTA A;  5BNV A;  5KDM B;  5AVC C;  1P34 A;  1KX3 B;  5AVC D;  3KWQ B;  3AZK C;  5GT0 D;  3AV1 D;  3X1S C;  5AV6 A;  3MGP A;  3NQU A;  5DNN A;  1AOI D;  3B0C T;  4R8P D;  2FJ7 C;  5CPI A;  1U35 B;  1P3B A;  5JRG B;  5C3I C;  4YM6 B;  4WU8 A;  1P3K A;  5E5A C;  3KWQ C;  5GT0 B;  3AV1 B;  5B2J A;  1P3P D;  1JFI A;  3AZI B;  1M18 B;  1HTA A;  1A7W A;  5DNN C;  4NE5 A;  3LEL C;  1M1A B;  3MVD B;  3LJA B;  1P3O C;  4WU8 D;  1P3K D;  5GT3 C;  4XUJ D;  4YM6 A;  1N1J B;  4Z5T D;  5JRG A;  5CHL B;  5AVB C;  3UTB C;  2BYM B;  1S32 C;  4M6B A;  1WWI A;  4J8W B;  3AYW C;  3LEL D;  5DNM A;  5DNN B;  3REH B;  1M18 D;  3VH5 T;  3W96 B;  1KX5 C;  5JA4 B;  3B0C W;  5B2J D;  4CAY B;  2PYO D;  4XUJ C;  4CSR A;  3MNN A;  4QLC B;  5KDM A;  5E5A D;  3AZJ A;  3A6N D;  2ARO B;  5AV5 D;  3A6N C;  3AZN B;  1M1A D;  5B0Z A;  1ZLA A;  4E44 A;  2FJ7 B;  4J8U C;  3R45 B;  3REL B;  1P3P B;  3B6F A;  3AZG B;  3MGP C;  1P3I C;  4KUD C;  3X1S B;  5E5A B;  2HIO B;  3LZ0 B;  1F66 B;  1H3O B;  5CPJ D;  2HUE B;  4JJN A;  5B32 D;  1U35 D;  3REI C;  1R4V A;  5B1L A;  4XZQ B;  3W98 D;  3WAA B;  3AZF B;  1ID3 D;  3AYW A;  3AZL A;  2BYK B;  2CV5 B;  5GT3 B;  3AZK D;  5BNX A;  1WWS A;  3B6F C;  3X1U B;  2NZD B;  3W97 D;  5B32 B;  5B32 A;  5AV8 D;  5GXQ D;  1KX4 C;  5AV5 C;  2NZD A;  1AOI A;  3AFA A;  3REI D;  3WTP B;  4G91 B;  5G49 B;  3AZG D;  3AZF A;  4JJN B;  3NQJ A;  4Z2M G;  1H3O A;  3AZK B;  4LD9 C;  4H9O A;  5AV8 C;  1F66 A;  3C1B C;  1P3G D;  3MNN C;  3W98 C;  5AVC A;  5FUG B;  4ZUX B;  3TU4 C;  3X1S D;  3AZJ B;  5B2I B;  4QLC A;  3AZN C;  2ARO A;  4CSR B;  1M18 C;  5GSU C;  1EQZ D;  5DNM B;  4KHA B;  3B0D B;  1HQ3 A;  1P3M D;  3B6G A;  3UTB D;  5JA4 A;  3AZG C;  4J8W A;  5BS7 C;  2F8N D;  1KX3 C;  4ZBJ C;  2YFW B;  4YS3 A;  3KXB C;  5GXQ B;  3X1T A;  3LJA A;  2RVQ D;  3MGR D;  4WNN B;  2NQB A;  5AV8 A;  3C1B D;  3AZI A;  4ZUX D;  5AV9 A;  4H9N A;  2L5A A;  4J8X B;  4E45 A;  3REJ D;  3TU4 D;  4J8X A;  4Z5T B;  3AYW D;  4WU8 B;  1P3K B;  1EQZ A;  3MGQ B;  3LZ0 D;  3W99 D;  4HGA C;  1KX5 D;  1U35 A;  1BFM A;  5B24 A;  3W99 C;  5CP6 A;  3AZE A;  3AZH A;  5GXQ A;  5F99 C;  5F99 D;  3MGP B;  5AV9 C;  5BO0 A;  4KHA A;  3MGQ D;  1KX3 A;  2HUE C;  5B40 C;  4H9Q B;  2F8N G;  4J8W C;  3KUY C;  3KXB A;  5BNV B;  4YS3 C;  1P3F B;  3B6F D;  1ZLA C;  4J8X D;  4G92 B;  4WV4 B;  4ZUX C;  3UTA B;  4QLC C;  3O62 C;  5B33 A;  3MGS B;  3REJ C;  1TZY A;  1P3A A;  5B32 C;  1KX4 A;  3KXB B;  5GSU A;  5B40 B;  5AY8 A;  3WA9 B;  1F66 D;  3MNN D;  4J8U D;  5CPI D;  4H9P A;  5CPK A;  4G92 C;  3LJA D;  3AZK A;  1ID3 B;  3REL D;  4DRB A;  3NQJ B;  4LD9 A;  3AZE B;  5GXQ C;  3AZH B;  3MGQ C;  1TZY C;  1P3A C;  3AZI C;  1M19 C;  3AFA B;  1P3I A;  3C1C A;  5CP6 B;  5B0Y C;  4KUD A;  3AZM C;  1P3L B;  4J8X C;  5F99 B;  3AZM D;  1B67 A;  2CV5 C;  1EQZ B;  4H9N B;  4LD9 D;  3AZE D;  3AZH D;  4UUZ A;  4Z5T A;  3O62 D;  3AZL B;  2FJ7 D;  2NQB B;  3AZE C;  3AZH C;  3WAA A;  2RVQ C;  2ARO D;  3MGR C;  5AV5 A;  2YFW A;  3UT9 D;  3AZM B;  3B0D C;  4YS3 B;  1P3F C;  5JRG C;  3LZ0 A;  5AY8 C;  4JJN C;  4YM6 C;  1P3G B;  1HQ3 B;  3B6G B;  3C1C D;  5DNN D;  3TU4 A;  3AZN A;  1M19 D;  3UT9 C;  1P3F D;  5B2I A;  1BH8 B;  3MGR A;  3WKJ D;  5AY8 D;  1P3O B;  1P3O A;  3WAA D;  3W98 B;  1S32 D;  4WU9 C;  5FUG A;  3W98 A;  1F1E A;  5B40 D;  5B0Z C;  5B2J C;  5CP6 C;  3W99 A;  4Z2M H;  5DNM C;  4NFT A;  3VH6 W;  5C3I B;  5JRG D;  1N1J A;  1ULY A;  3LZ1 C;  3AZM A;  4WZS B;  4J8V A;  5AV5 B;  1M1A A;  1ZLA D;  3A6N B;  1AOI B;  5B1L C;  1S32 A;  5CP6 D;  4EO5 C;  1JFI B;  3MGP D;  3KSY A;  4NE6 A;  1P3L C;  5F99 A;  3LJA C;  5BNX B;  3WKJ C;  3C1C B;  3VH6 A;  1BH9 A;  2NQB C;  1B6W A;  1S32 B;  1TZY D;  1P3A D;  5B0Z D;  1P3M B;  3AYW B;  5CPI B;  5B1L B;  3VH5 W;  4XZQ A;  4J8V B;  5E5A A;  3AZF C;  4H9R A;  2PYO B;  2CV5 D;  5CPK B;  3AZF D;  2NQB D; 
#chains in the Genus database with same CATH topology
 3X1S A;  3R45 A;  5B2I C;  5B0Y D;  3A1K A;  3VH6 T;  2FJ7 A;  4H9P B;  4J8W D;  1KX4 B;  1P3P A;  5CPI C;  3X1V C;  4YS3 D;  3UT9 B;  5B1L D;  5GSU B;  5B40 A;  3X1V D;  1ZLA B;  4G91 C;  5BT1 C;  3REL C;  3AV2 D;  2F8N K;  1TAF A;  3WKJ A;  2ARO C;  2CWE A;  3LZ1 B;  3IP4 C;  3REH A;  5B31 A;  3REJ A;  3X1V B;  2BYM A;  4H9Q A;  2Y2I A;  1P3P C;  4DRA A;  2F8N H;  4Z66 B;  3W97 A;  4X23 C;  3REK C;  5BO0 B;  2F8N A;  1T3U A;  5AVB B;  4WU8 C;  1P3K C;  4KGC A;  3B0B A;  5CPK D;  5B24 B;  1P3M C;  3MVD A;  3MGQ A;  1KX3 D;  1M18 A;  5GT0 A;  4JJN D;  3AV1 A;  4XUJ A;  4XUJ B;  4Z66 D;  3KXB D;  5BS7 A;  3C1C C;  5B1M A;  2F8N B;  3UTA D;  5AV8 B;  3W97 B;  5AVB A;  3X1T C;  3NQU B;  4Z66 A;  3MVD C;  1Z2C B;  3P5J B;  4YM6 D;  4KGC D;  5B31 B;  1ID3 A;  2JCH A;  3AZJ D;  3X1V A;  3LZ1 A;  1HQ3 C;  3B6G C;  1KU5 A;  4NE3 A;  3LZ0 C;  3REJ B;  3AZJ C;  5CPJ B;  2ZY5 A;  1P3L D;  4DQY B;  3WA9 C;  4EO5 B;  4ZUX A;  5AV9 D;  1KX5 B;  5B31 D;  3WAA C;  5AVC B;  2IO5 B;  4AWL C;  5B33 B;  5B31 C;  3LZ1 D;  4Z66 C;  3UT9 A;  3KUY D;  4WU9 A;  1P3F A;  3AV2 A;  3C1B A;  2PYO A;  3AFA C;  4J8V C;  5B32 G;  2YFV A;  3AFA D;  3REI A;  4QLC D;  5BT1 D;  4H9R B;  1P34 C;  4X23 B;  3REK B;  4UPK A;  5B33 D;  3WTP E;  1P34 D;  3MGS D;  3V9R B;  3AZL C;  1BH9 B;  3AL0 C;  1HQ3 D;  1P3M A;  3O62 A;  5B24 D;  1F66 C;  3B6G D;  5B0Y A;  2UWX A;  1AOI C;  3WA9 D;  5GT3 A;  2BYK A;  4XZQ C;  3KUY A;  4R8P B;  2CV5 A;  5B1M C;  3A6N A;  3V9R A;  1P3G C;  2HIO D;  5B2I D;  4Z5T C;  5AV9 B;  5B31 G;  2G5H C;  3AZI D;  3X1U C;  4WNN A;  3KWQ D;  3AN2 A;  3X1T B;  2YFV B;  4H9S C;  2XD1 A;  3WTP D;  3W99 B;  3AZG A;  3AZN D;  1M19 A;  3WTP C;  3AV2 B;  2Y2Q A;  4R8P C;  2HIO A;  2IO5 C;  3VH5 A;  3REL A;  2PYO C;  1P3O D;  2JSS A;  5CPK C;  5GSU D;  3UTB A;  1EQZ C;  2NZD D;  3X1U D;  4ZBJ B;  4J8U A;  5B24 C;  2Y2M A;  3MGR B;  2W8S A;  3LEL B;  3LEL A;  4J8U B;  5CPJ A;  3MNN B;  4AWL B;  3AV2 C;  1BH8 A;  3UTA C;  3EPH A;  3W96 A;  3TU4 B;  2HIO C;  1P3I D;  4KUD D;  4CAY A;  3UTB B;  1P3G A;  5GT3 D;  3MVD D;  4HGA B;  1M19 B;  5AVB D;  3REH C;  4WU9 D;  1Q9C A;  2LY8 A;  4H9O B;  3AN2 B;  4X23 D;  3REK D;  5AV6 D;  1ID3 C;  5B1M B;  2Y2L A;  5G49 A;  4R8P A;  2NZD C;  4UUZ B;  3WTP A;  1P3B C;  2XD5 A;  3X1T D;  1P3B D;  1KX4 D;  4WJ3 C;  5DNM D;  5B2J B;  3KUY B;  1P3L A;  5B0Y B;  3AN2 D;  1U35 C;  3X1U A;  3AN2 C;  5AV6 C;  4KGC B;  5B33 C;  3O62 B;  3MGS C;  5GT0 C;  3F6T A;  3AZL D;  3AV1 C;  1P3I B;  4KUD B;  4LD9 B;  4H9S A;  4J8V D;  1P3B B;  4X23 A;  3REK A;  3W97 C;  3C1B B;  1M1A C;  3KWQ A;  3REI B;  3W96 D;  3REH D;  3WA9 A;  5B1M D;  5AV6 B;  1P34 B;  4KGC C;  5AY8 B;  1TAF B;  3WKJ B;  4WU9 B;  3B6F B;  1KX5 A;  3MGS A;  5B0Z B;  5CPJ C;  4XZQ D;  1TZY B;  1P3A B;  3W96 C;  3UTA A;  5BNV A;  5KDM B;  5AVC C;  1P34 A;  2J8P A;  1KX3 B;  5AVC D;  3KWQ B;  3AZK C;  5GT0 D;  3AV1 D;  3X1S C;  5AV6 A;  3MGP A;  3NQU A;  5DNN A;  1AOI D;  3B0C T;  4R8P D;  2FJ7 C;  5CPI A;  1U35 B;  1P3B A;  5JRG B;  5C3I C;  4YM6 B;  4WU8 A;  1P3K A;  5E5A C;  3KWQ C;  5GT0 B;  3AV1 B;  5B2J A;  1P3P D;  1JFI A;  3AZI B;  1M18 B;  1HTA A;  1A7W A;  5DNN C;  2ZY3 A;  4NE5 A;  3LEL C;  1M1A B;  3MVD B;  3LJA B;  1P3O C;  4WU8 D;  1P3K D;  5GT3 C;  4XUJ D;  4YM6 A;  1N1J B;  4Z5T D;  5JRG A;  5CHL B;  2DF4 C;  5AVB C;  3UTB C;  2BYM B;  1S32 C;  4M6B A;  1WWI A;  4J8W B;  3AYW C;  3LEL D;  5DNM A;  5DNN B;  3REH B;  1M18 D;  3VH5 T;  3W96 B;  1KX5 C;  5JA4 B;  3B0C W;  5B2J D;  3H0M C;  4CAY B;  4XUJ C;  2PYO D;  4CSR A;  3MNN A;  4QLC B;  3A1I A;  5KDM A;  5E5A D;  3AZJ A;  3A6N D;  2Y2H A;  2ARO B;  5AV5 D;  3A6N C;  3AZN B;  1M1A D;  5B0Z A;  1ZLA A;  4E44 A;  2FJ7 B;  4J8U C;  3R45 B;  3REL B;  1P3P B;  3B6F A;  3AZG B;  3MGP C;  3EG5 B;  2BG1 A;  3X1S B;  5E5A B;  2HIO B;  3LZ0 B;  1P3I C;  1F66 B;  1H3O B;  4KUD C;  5CPJ D;  2HUE B;  2VQR A;  4JJN A;  5B32 D;  1U35 D;  3EPJ A;  3REI C;  1R4V A;  2ZY2 A;  5B1L A;  4XZQ B;  3W98 D;  3WAA B;  3AZF B;  1ID3 D;  3AYW A;  3AZL A;  2BYK B;  2CV5 B;  5GT3 B;  3AZK D;  5BNX A;  1WWS A;  3B6F C;  3X1U B;  2NZD B;  3W97 D;  5B32 B;  5B32 A;  5AV8 D;  5GXQ D;  1KX4 C;  5AV5 C;  2NZD A;  1AOI A;  3AFA A;  3REI D;  3WTP B;  4G91 B;  5G49 B;  3AZG D;  3AZF A;  4JJN B;  3NQJ A;  4Z2M G;  1H3O A;  3AZK B;  4LD9 C;  4H9O A;  5AV8 C;  1F66 A;  3C1B C;  1P3G D;  3MNN C;  3W98 C;  5AVC A;  5FUG B;  4ZUX B;  3TU4 C;  3X1S D;  3AZJ B;  3EPK A;  5B2I B;  4QLC A;  3AZN C;  2ARO A;  4CSR B;  1M18 C;  5GSU C;  1EQZ D;  5DNM B;  4KHA B;  3B0D B;  1HQ3 A;  1P3M D;  3B6G A;  3UTB D;  5JA4 A;  3AZG C;  4J8W A;  1W2E A;  5BS7 C;  2F8N D;  1KX3 C;  4ZBJ C;  2YFW B;  4YS3 A;  3KXB C;  5GXQ B;  3X1T A;  3LJA A;  2RVQ D;  3MGR D;  4WNN B;  2NQB A;  5AV8 A;  3C1B D;  3AZI A;  4ZUX D;  5AV9 A;  4H9N A;  2L5A A;  4J8X B;  2Y2J A;  4E45 A;  3REJ D;  3TU4 D;  4J8X A;  4Z5T B;  3AYW D;  4WU8 B;  1P3K B;  2Y2O A;  1EQZ A;  3MGQ B;  3LZ0 D;  3W99 D;  4HGA C;  1KX5 D;  1U35 A;  1BFM A;  5B24 A;  3W99 C;  5CP6 A;  3AZE A;  3AZH A;  5GXQ A;  5F99 C;  5F99 D;  2DQN C;  3MGP B;  5AV9 C;  5BO0 A;  2Y2N A;  4KHA A;  3MGQ D;  1KX3 A;  2HUE C;  5B40 C;  4H9Q B;  2F8N G;  4J8W C;  3KUY C;  3KXB A;  5BNV B;  4YS3 C;  2FFF B;  1P3F B;  3B6F D;  1ZLA C;  4J8X D;  4G92 B;  4WV4 B;  4ZUX C;  3UTA B;  4QLC C;  3O62 C;  5B33 A;  3MGS B;  3REJ C;  1TZY A;  1P3A A;  5B32 C;  1KX4 A;  3KXB B;  1PZR A;  5GSU A;  5B40 B;  5AY8 A;  3WA9 B;  1F66 D;  3MNN D;  4J8U D;  5CPI D;  4H9P A;  5CPK A;  4G92 C;  3LJA D;  3AZK A;  2Y2G A;  1ID3 B;  3REL D;  4DRB A;  2ZM5 A;  3NQJ B;  4LD9 A;  3AZE B;  5GXQ C;  3AZH B;  3MGQ C;  1TZY C;  1P3A C;  3AZI C;  1M19 C;  3AFA B;  1P3I A;  3C1C A;  5CP6 B;  5B0Y C;  4KUD A;  3AZM C;  1P3L B;  4J8X C;  5F99 B;  3AZM D;  1B67 A;  2CV5 C;  1EQZ B;  4H9N B;  4LD9 D;  3AZE D;  3AZH D;  4UUZ A;  4Z5T A;  3O62 D;  3AZL B;  2FJ7 D;  2NQB B;  3AZE C;  3AZH C;  3WAA A;  2G5I C;  2RVQ C;  2ARO D;  3MGR C;  5AV5 A;  2RIQ A;  2YFW A;  3UT9 D;  3AZM B;  3B0D C;  4YS3 B;  1P3F C;  5JRG C;  3LZ0 A;  5AY8 C;  4JJN C;  4YM6 C;  1P3G B;  1HQ3 B;  3B6G B;  3C1C D;  5DNN D;  3TU4 A;  3FDD A;  3AZN A;  1M19 D;  3UT9 C;  1P3F D;  5B2I A;  1BH8 B;  3MGR A;  2JE5 A;  3WKJ D;  5AY8 D;  1P3O B;  2Y2K A;  1P3O A;  3WAA D;  3W98 B;  1S32 D;  4WU9 C;  5FUG A;  3W98 A;  1F1E A;  5B40 D;  5B0Z C;  3KFU G;  5B2J C;  5CP6 C;  3W99 A;  4Z2M H;  5DNM C;  3H0L C;  4NFT A;  3VH6 W;  5C3I B;  5JRG D;  1N1J A;  1ULY A;  3LZ1 C;  3AZM A;  4WZS B;  4J8V A;  5AV5 B;  1M1A A;  1ZLA D;  3A6N B;  1AOI B;  2ZY4 A;  5B1L C;  1S32 A;  5CP6 D;  4EO5 C;  1JFI B;  3MGP D;  3KSY A;  4NE6 A;  3EPL A;  1P3L C;  5F99 A;  3LJA C;  5BNX B;  3WKJ C;  3C1C B;  3VH6 A;  1BH9 A;  2NQB C;  1B6W A;  1S32 B;  1TZY D;  1P3A D;  5B0Z D;  1P3M B;  3AYW B;  5CPI B;  2F2A C;  5B1L B;  3VH5 W;  4XZQ A;  4J8V B;  3H0R C;  5E5A A;  3AZF C;  4H9R A;  2PYO B;  2CV5 D;  5CPK B;  3AZF D;  2Y2P A;  2NQB D; 
#chains in the Genus database with same CATH homology
 3X1S A;  3R45 A;  5B2I C;  5B0Y D;  3A1K A;  3VH6 T;  2FJ7 A;  4H9P B;  4J8W D;  1KX4 B;  1P3P A;  5CPI C;  3X1V C;  4YS3 D;  3UT9 B;  5B1L D;  5GSU B;  5B40 A;  3X1V D;  1ZLA B;  4G91 C;  5BT1 C;  3REL C;  3AV2 D;  2F8N K;  1TAF A;  3WKJ A;  2ARO C;  2CWE A;  3LZ1 B;  3IP4 C;  3REH A;  5B31 A;  3REJ A;  3X1V B;  2BYM A;  4H9Q A;  2Y2I A;  1P3P C;  4DRA A;  2F8N H;  4Z66 B;  3W97 A;  4X23 C;  3REK C;  5BO0 B;  2F8N A;  1T3U A;  5AVB B;  4WU8 C;  1P3K C;  4KGC A;  3B0B A;  5CPK D;  5B24 B;  1P3M C;  3MVD A;  3MGQ A;  1KX3 D;  1M18 A;  5GT0 A;  4JJN D;  3AV1 A;  4XUJ A;  4XUJ B;  4Z66 D;  3KXB D;  5BS7 A;  3C1C C;  5B1M A;  2F8N B;  3UTA D;  5AV8 B;  3W97 B;  5AVB A;  3X1T C;  3NQU B;  4Z66 A;  3MVD C;  1Z2C B;  3P5J B;  4YM6 D;  4KGC D;  5B31 B;  1ID3 A;  2JCH A;  3AZJ D;  3X1V A;  3LZ1 A;  1HQ3 C;  3B6G C;  1KU5 A;  4NE3 A;  3LZ0 C;  3REJ B;  3AZJ C;  5CPJ B;  2ZY5 A;  1P3L D;  4DQY B;  3WA9 C;  4EO5 B;  4ZUX A;  5AV9 D;  1KX5 B;  5B31 D;  3WAA C;  5AVC B;  2IO5 B;  4AWL C;  5B33 B;  5B31 C;  3LZ1 D;  4Z66 C;  3UT9 A;  3KUY D;  4WU9 A;  1P3F A;  3AV2 A;  3C1B A;  2PYO A;  3AFA C;  4J8V C;  5B32 G;  2YFV A;  3AFA D;  3REI A;  4QLC D;  5BT1 D;  4H9R B;  1P34 C;  4X23 B;  3REK B;  4UPK A;  5B33 D;  3WTP E;  1P34 D;  3MGS D;  3V9R B;  3AZL C;  1BH9 B;  3AL0 C;  1HQ3 D;  1P3M A;  3O62 A;  5B24 D;  1F66 C;  3B6G D;  5B0Y A;  2UWX A;  1AOI C;  3WA9 D;  5GT3 A;  2BYK A;  4XZQ C;  3KUY A;  4R8P B;  2CV5 A;  5B1M C;  3A6N A;  3V9R A;  1P3G C;  2HIO D;  5B2I D;  4Z5T C;  5AV9 B;  5B31 G;  2G5H C;  3AZI D;  3X1U C;  4WNN A;  3KWQ D;  3AN2 A;  3X1T B;  2YFV B;  4H9S C;  2XD1 A;  3WTP D;  3W99 B;  3AZG A;  3AZN D;  1M19 A;  3WTP C;  3AV2 B;  2Y2Q A;  4R8P C;  2HIO A;  2IO5 C;  3VH5 A;  3REL A;  2PYO C;  1P3O D;  2JSS A;  5CPK C;  5GSU D;  3UTB A;  1EQZ C;  2NZD D;  3X1U D;  4ZBJ B;  4J8U A;  5B24 C;  2Y2M A;  3MGR B;  2W8S A;  3LEL B;  3LEL A;  4J8U B;  5CPJ A;  3MNN B;  4AWL B;  3AV2 C;  1BH8 A;  3UTA C;  3EPH A;  3W96 A;  3TU4 B;  2HIO C;  1P3I D;  4KUD D;  4CAY A;  3UTB B;  1P3G A;  5GT3 D;  3MVD D;  4HGA B;  1M19 B;  5AVB D;  3REH C;  4WU9 D;  1Q9C A;  2LY8 A;  4H9O B;  3AN2 B;  4X23 D;  3REK D;  5AV6 D;  1ID3 C;  5B1M B;  2Y2L A;  5G49 A;  4R8P A;  2NZD C;  4UUZ B;  3WTP A;  1P3B C;  2XD5 A;  3X1T D;  1P3B D;  1KX4 D;  4WJ3 C;  5DNM D;  5B2J B;  3KUY B;  1P3L A;  5B0Y B;  3AN2 D;  1U35 C;  3X1U A;  3AN2 C;  5AV6 C;  4KGC B;  5B33 C;  3O62 B;  3MGS C;  5GT0 C;  3F6T A;  3AZL D;  3AV1 C;  1P3I B;  4KUD B;  4LD9 B;  4H9S A;  4J8V D;  1P3B B;  4X23 A;  3REK A;  3W97 C;  3C1B B;  1M1A C;  3KWQ A;  3REI B;  3W96 D;  3REH D;  3WA9 A;  5B1M D;  5AV6 B;  1P34 B;  4KGC C;  5AY8 B;  1TAF B;  3WKJ B;  4WU9 B;  3B6F B;  1KX5 A;  3MGS A;  5B0Z B;  5CPJ C;  4XZQ D;  1TZY B;  1P3A B;  3W96 C;  3UTA A;  5BNV A;  5KDM B;  5AVC C;  1P34 A;  2J8P A;  1KX3 B;  5AVC D;  3KWQ B;  3AZK C;  5GT0 D;  3AV1 D;  3X1S C;  5AV6 A;  3MGP A;  3NQU A;  5DNN A;  1AOI D;  3B0C T;  4R8P D;  2FJ7 C;  5CPI A;  1U35 B;  1P3B A;  5JRG B;  5C3I C;  4YM6 B;  4WU8 A;  1P3K A;  5E5A C;  3KWQ C;  5GT0 B;  3AV1 B;  5B2J A;  1P3P D;  1JFI A;  3AZI B;  1M18 B;  1HTA A;  1A7W A;  5DNN C;  2ZY3 A;  4NE5 A;  3LEL C;  1M1A B;  3MVD B;  3LJA B;  1P3O C;  4WU8 D;  1P3K D;  5GT3 C;  4XUJ D;  4YM6 A;  1N1J B;  4Z5T D;  5JRG A;  5CHL B;  2DF4 C;  5AVB C;  3UTB C;  2BYM B;  1S32 C;  4M6B A;  1WWI A;  4J8W B;  3AYW C;  3LEL D;  5DNM A;  5DNN B;  3REH B;  1M18 D;  3VH5 T;  3W96 B;  1KX5 C;  5JA4 B;  3B0C W;  5B2J D;  3H0M C;  4CAY B;  4XUJ C;  2PYO D;  4CSR A;  3MNN A;  4QLC B;  3A1I A;  5KDM A;  5E5A D;  3AZJ A;  3A6N D;  2Y2H A;  2ARO B;  5AV5 D;  3A6N C;  3AZN B;  1M1A D;  5B0Z A;  1ZLA A;  4E44 A;  2FJ7 B;  4J8U C;  3R45 B;  3REL B;  1P3P B;  3B6F A;  3AZG B;  3MGP C;  3EG5 B;  2BG1 A;  3X1S B;  5E5A B;  2HIO B;  3LZ0 B;  1P3I C;  1F66 B;  1H3O B;  4KUD C;  5CPJ D;  2HUE B;  2VQR A;  4JJN A;  5B32 D;  1U35 D;  3EPJ A;  3REI C;  1R4V A;  2ZY2 A;  5B1L A;  4XZQ B;  3W98 D;  3WAA B;  3AZF B;  1ID3 D;  3AYW A;  3AZL A;  2BYK B;  2CV5 B;  5GT3 B;  3AZK D;  5BNX A;  1WWS A;  3B6F C;  3X1U B;  2NZD B;  3W97 D;  5B32 B;  5B32 A;  5AV8 D;  5GXQ D;  1KX4 C;  5AV5 C;  2NZD A;  1AOI A;  3AFA A;  3REI D;  3WTP B;  4G91 B;  5G49 B;  3AZG D;  3AZF A;  4JJN B;  3NQJ A;  4Z2M G;  1H3O A;  3AZK B;  4LD9 C;  4H9O A;  5AV8 C;  1F66 A;  3C1B C;  1P3G D;  3MNN C;  3W98 C;  5AVC A;  5FUG B;  4ZUX B;  3TU4 C;  3X1S D;  3AZJ B;  3EPK A;  5B2I B;  4QLC A;  3AZN C;  2ARO A;  4CSR B;  1M18 C;  5GSU C;  1EQZ D;  5DNM B;  4KHA B;  3B0D B;  1HQ3 A;  1P3M D;  3B6G A;  3UTB D;  5JA4 A;  3AZG C;  4J8W A;  1W2E A;  5BS7 C;  2F8N D;  1KX3 C;  4ZBJ C;  2YFW B;  4YS3 A;  3KXB C;  5GXQ B;  3X1T A;  3LJA A;  2RVQ D;  3MGR D;  4WNN B;  2NQB A;  5AV8 A;  3C1B D;  3AZI A;  4ZUX D;  5AV9 A;  4H9N A;  2L5A A;  4J8X B;  2Y2J A;  4E45 A;  3REJ D;  3TU4 D;  4J8X A;  4Z5T B;  3AYW D;  4WU8 B;  1P3K B;  2Y2O A;  1EQZ A;  3MGQ B;  3LZ0 D;  3W99 D;  4HGA C;  1KX5 D;  1U35 A;  1BFM A;  5B24 A;  3W99 C;  5CP6 A;  3AZE A;  3AZH A;  5GXQ A;  5F99 C;  5F99 D;  2DQN C;  3MGP B;  5AV9 C;  5BO0 A;  2Y2N A;  4KHA A;  3MGQ D;  1KX3 A;  2HUE C;  5B40 C;  4H9Q B;  2F8N G;  4J8W C;  3KUY C;  3KXB A;  5BNV B;  4YS3 C;  2FFF B;  1P3F B;  3B6F D;  1ZLA C;  4J8X D;  4G92 B;  4WV4 B;  4ZUX C;  3UTA B;  4QLC C;  3O62 C;  5B33 A;  3MGS B;  3REJ C;  1TZY A;  1P3A A;  5B32 C;  1KX4 A;  3KXB B;  1PZR A;  5GSU A;  5B40 B;  5AY8 A;  3WA9 B;  1F66 D;  3MNN D;  4J8U D;  5CPI D;  4H9P A;  5CPK A;  4G92 C;  3LJA D;  3AZK A;  2Y2G A;  1ID3 B;  3REL D;  4DRB A;  2ZM5 A;  3NQJ B;  4LD9 A;  3AZE B;  5GXQ C;  3AZH B;  3MGQ C;  1TZY C;  1P3A C;  3AZI C;  1M19 C;  3AFA B;  1P3I A;  3C1C A;  5CP6 B;  5B0Y C;  4KUD A;  3AZM C;  1P3L B;  4J8X C;  5F99 B;  3AZM D;  1B67 A;  2CV5 C;  1EQZ B;  4H9N B;  4LD9 D;  3AZE D;  3AZH D;  4UUZ A;  4Z5T A;  3O62 D;  3AZL B;  2FJ7 D;  2NQB B;  3AZE C;  3AZH C;  3WAA A;  2G5I C;  2RVQ C;  2ARO D;  3MGR C;  5AV5 A;  2RIQ A;  2YFW A;  3UT9 D;  3AZM B;  3B0D C;  4YS3 B;  1P3F C;  5JRG C;  3LZ0 A;  5AY8 C;  4JJN C;  4YM6 C;  1P3G B;  1HQ3 B;  3B6G B;  3C1C D;  5DNN D;  3TU4 A;  3FDD A;  3AZN A;  1M19 D;  3UT9 C;  1P3F D;  5B2I A;  1BH8 B;  3MGR A;  2JE5 A;  3WKJ D;  5AY8 D;  1P3O B;  2Y2K A;  1P3O A;  3WAA D;  3W98 B;  1S32 D;  4WU9 C;  5FUG A;  3W98 A;  1F1E A;  5B40 D;  5B0Z C;  3KFU G;  5B2J C;  5CP6 C;  3W99 A;  4Z2M H;  5DNM C;  3H0L C;  4NFT A;  3VH6 W;  5C3I B;  5JRG D;  1N1J A;  1ULY A;  3LZ1 C;  3AZM A;  4WZS B;  4J8V A;  5AV5 B;  1M1A A;  1ZLA D;  3A6N B;  1AOI B;  2ZY4 A;  5B1L C;  1S32 A;  5CP6 D;  4EO5 C;  1JFI B;  3MGP D;  3KSY A;  4NE6 A;  3EPL A;  1P3L C;  5F99 A;  3LJA C;  5BNX B;  3WKJ C;  3C1C B;  3VH6 A;  1BH9 A;  2NQB C;  1B6W A;  1S32 B;  1TZY D;  1P3A D;  5B0Z D;  1P3M B;  3AYW B;  5CPI B;  2F2A C;  5B1L B;  3VH5 W;  4XZQ A;  4J8V B;  3H0R C;  5E5A A;  3AZF C;  4H9R A;  2PYO B;  2CV5 D;  5CPK B;  3AZF D;  2Y2P A;  2NQB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...