2NZJA

The crystal structure of rem1 in complex with gdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
171
structure length
155
Chain Sequence
b'MALYRVVLLGDPGVGKTSLASLFAGKHEQLGEDVYERTLTVDGEDTTLVVVDTWSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein REM 1
publication title The crystal structure of REM1 in complex with GDP
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 155
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nzjA00
3WNCA 2REOA 5F9HA 2OCBA 3L43A 1BKDR 1T9HA 1EK0A 4MGIR 3JZMA 3EWSA 4YXWA 1ONBA 2DWOA 1S3GA 3UMRA 3LXXA 1TL7C 4DB2A 3OEEA 3CRQA 4KAXA 3K9HA 4WA7A 2BM1A 2A2ZA 5FOWA 1COWA 3FFBA 2VP2A 2VHJA 2V1XA 4PZYA 4G5QA 2ZIAA 3PEVA 5KSYA 4OQLA 3L8ZA 3VR3A 3LA6A 4HUQB 3ASZA 4Q7LA 2JCSA 3IBGA 4B48A 5JJIA 1SXJC 3P4XA 4POAA 1YKSA 1PUJA 2GBLC 3X2SA 2XZOA 1RPZA 3K70B 3IGFA 4PO1A 1NRJB 4TTPA 3FHTA 1Z28A 1P62B 1SXJE 3PXGA 3T5GA 2J0UA 1V43A 1XTQA 2OE2A 3EXAA 4PZZA 2QRZA 4WIAA 3W6OA 3TVDA 1U0LA 1ZIPA 5K8TA 1P6XA 3M1IA 4MYUA 1Z6AA 5AR1A 4M22A 1GAJA 2CLSA 2VHCA 3KJGA 1T0JB 4HDCA 3RHFA 1MO3A 4KODA 3TKLA 4Q21A 2HYDA 4URYR 1A1VA 4ZI3A 1KI6B 3GJ8A 2VP4A 4FN5A 5EXSA 3SNHA 1WF3A 3AUYA 4WXRA 5LB4A 4YMSA 4D4MA 4CW7A 1TQ6A 1PJRA 4LV5B 2BM0A 2B92A 5DSZA 2G0TA 2X19A 3EA5A 1RE0A 2OCPA 1E2JA 3PV0A 4IDNA 1FNNA 2NO0A 4KYUA 4MDFA 2C96A 1WP9A 4HB4A 3QSYA 2H5EA 3GLHE 2IT1A 4TQ9A 4ABYA 1H65A 2V9PA 1VYVA 3DMNA 1B23P 2ASEA 2FN4A 3QXJA 2ZETA 4FXPA 2P3SA 4MGZR 1ZUIA 2QMOA 4NYMR 4JBXA 1I2MA 4IRUB 4QL3A 4V0KA 1W1WA 1X86B 3DMDA 2J0SA 2PZEA 4HDOB 2ZAMA 4IW3B 1Q21A 4MUBA 1LB1B 4MA4A 1GNRA 1D9XA 3SHFA 2G77B 4D6PA 2GILA 2DWPA 2ZJBA 2NTYC 4PAOA 2O8CB 1KI4A 1MT0A 3FMOB 4JL5A 2WPDA 3TR0A 4PXAA 2GRJA 4PC3A 3U3MA 1EXMA 4TLDA 4DT1B 4QC2A 4HAUA 1XTRA 4IXMA 4O2RA 2ZRLA 4A8JA 1C1YA 1VCNA 1YRAA 1NVVQ 3RVBA 1T4GA 2ZRIA 4ZCLA 1G19A 2FA9A 3K0FA 2CDNA 3D3QA 2IYZA 1P61B 3B1WA 2QAGA 4K46A 3VR2A 3VNUA 2FEMA 1CR2A 1TNDA 1LVGA 2ZRCA 1CP2A 4CVNA 4TN1A 1DAFA 1FNMA 5HR5A 2OXRA 1H8HD 2V55B 4FIDA 1OKKD 1OXTA 5L3SA 4JLKA 3A8TA 4WZBE 3PR1A 3B85A 1R5OA 1XEXA 4C30A 3DL0A 4A4DA 4FWTA 4TYPA 4IDQA 1AQYA 5FBLB 3TSWA 5IK2D 3ADDA 1JEEA 1XRJA 2BBTA 3B1XA 3KTAA 2BCGY 1P9WA 4TTQA 3K8YA 3K70D 1CF4A 4MRPA 3AVVA 1N25A 5LBIA 5HKKD 3KKMA 5DN6D 1NJFA 3U3RA 1X6VA 3I61A 3TR5A 2GF0A 3DM9B 4ARZB 3G0HA 3TSZA 4DKXA 2IUTA 4XIGS 4JSYA 1GIAA 1PLLA 3BH6A 3VX4A 1UFQA 3FOZA 1G3QA 3LXRA 1GKIA 4ZDIA 1IY0A 3DEFA 3AEZA 3CONA 3HYTA 3TH5A 4DIDA 4E22A 2J46A 2ONKA 2RGBA 4BWYA 4OK5A 4ESVA 2O8BA 1G8HA 1XMIA 2F1HA 2GJ8A 3FKSD 3A36A 1II0A 3OIWA 3P1JA 3Q72A 5KNDA 1KK0A 1JR3E 3AQ4A 4URUR 1XPUA 4TSFD 2WIBA 1OFTA 2FE4A 1MR3F 3NC1C 5CJPA 5F2EA 4B2PA 2KI5A 3EZ2A 4GL2A 4G0NA 1Q3HA 4QG7A 5AJYA 5EQTA 1FX0A 4DDUA 2GESA 3B13B 2IS6A 1F2UB 1SKQA 4NYJQ 1OIVA 2C03A 1ZU4A 3PUWA 4NCKA 3KKPA 4LHVA 1R7RA 2C8VA 3EARA 4M9XA 3VHLB 3C5CA 1Z6XA 1MV5A 3EW9A 4W5HA 3SOPA 4D81A 4IDHA 4MKGA 4EFMA 5KHOC 3VAAA 1VPLA 2IXFA 2RGXA 5JHHB 4OK3A 4Q1FA 2WICA 2QE7A 4P4SB 4B71A 4YMWA 1XWIA 4DUGD 2XTZA 4NYIR 5FBQB 5KU1A 3WP1B 5DI3A 1KO4A 3I5XA 3B78A 1D2EA 4BLTA 5EE5B 1A2BA 2BBSA 2CE7A 1NG1A 2ZRDA 3SBDA 2ZRFA 4OJKA 1KK2A 1XCPA 4LDJA 2ZXUA 5M04A 5E3HA 2D06A 5EZ6B 1JBKA 1TMKA 4CF7A 2C77A 2FPMA 2DHRA 3CM0A 1W4AA 1E2PA 1TADA 1XPOA 3B60A 4LGMA 1VYUA 2OV2A 3MFYA 2A3RA 2YWGA 3AF2A 1OXXK 5GJCA 2GXSA 1CJUC 2WWHA 1V5WA 1ZNYA 3MWLA 4XD7A 3I72A 1RRPA 3PITA 4DLTA 4G01B 2H92A 4QJ4A 3A4MA 2VHQA 1M34E 4V0OA 5BXQC 3UPUA 1OW3B 2OAP1 2C78A 3GLIB 3G5UA 1OB2A 3KQHA 3CZQA 4LBVA 3K0SA 4DDTA 4TZ0A 4R71A 2WJHA 3RAPR 4B47A 2ZI9A 1G41A 4JLNA 3ECCA 3MJRA 3THYA 2QUZA 1XFAA 4DEXA 3CH5A 3NH9A 1WXQA 2CLDX 4HLUC 2O8DB 3PCRB 4AYWA 1CKEA 4ZIRB 2NPIA 1HUQA 4Q1CA 5K8LA 3R9XA 1ELOA 1NSFA 3OAAD 1K5GA 4TMKA 1GNQA 3A1TA 2H17A 1IBRA 2RB4A 3DPUA 1TU3A 3ZVLA 2EFHB 1NMXA 4WOPA 3GLGE 4HB3A 4A2QA 1I4DD 2JA1A 2H57A 1SXJA 2VSFA 1VCIA 2QORA 2VYFA 2K5UA 2GBLA 3C41J 1GSIA 1IHUA 3NTUA 4M53A 3KQLA 4A6XA 4MYCA 4HZUA 4BFUA 5F9FA 4JVNA 5JSZB 2WKRA 2QPAA 4XJXA 5DHFA 4TL6A 1HQCA 4GRAA 3UWKA 3HJNA 4ESHA 3A1UA 1D6JA 1OH7A 1W5TA 1PVOA 3RC8A 2YYZA 3SU8A 1F3OA 5A4JA 3QKUA 5DH9A 2AX4A 2GJSA 1EWRA 1IY1A 1GP2A 1H8EA 2GJ9A 4JLVA 3H2YA 4D4LA 3PVSA 5E4FA 4Q4HA 3QF4B 2QL6A 1E0AA 3BH0A 2ZUCA 3IILA 5KDLA 4Q4LA 4C4PA 1AM4D 4V03A 1G8YA 2EQBA 2OCAA 3RLFA 3BBPA 1NKTA 3GLHA 3GJ3A 2IYXA 4CEJA 1RJ9B 4PFSA 5JEDA 1FMLA 4HLCA 4XOIA 1UKVY 4EJSC 2DBYA 1G5PA 1KSFX 2OFOA 4F4CA 3U7FB 1BMFA 4LK2A 3TW4A 1L2TA 5IDVA 4RZ3A 1SKYB 3MMPA 4IDPA 1Z83A 3CX6A 1UDWA 1YZUA 2JJ1D 4KU4A 1E79D 1NLFA 1E96A 1KO5A 4Q1BA 1U0JA 5CIQA 2IX3A 2B8TA 2JLZA 1JECA 4P4TA 4O2LA 4PQYA 1SVKA 3C4JA 3VR4A 4HYYA 3IO3A 1IN6A 3L82B 4C0SA 1W0JA 5LD2C 4JLPA 2IHYA 3P27A 5KSZA 2IUSA 1NI3A 3X1XA 4P0TA 4NBSA 1N5LA 1DG1G 1QVAA 1Z08A 4H9GA 4JBYA 3FMPB 2F1JA 1FPMA 4Q7KA 5JJLA 3CNNA 4HB0A 4JS0A 4KHZA 5L3QB 4YMVA 3B2EA 2JLYA 3M6AA 1YJ5A 4FMDB 3WMFA 4CZ2A 4LJ8A 3OF5A 1NN3A 1L8QA 2FNAA 1P7CA 1RKBA 2VF8A 5HE9A 4F93B 1G3RA 1GUAA 1M74A 3LO5A 2P5TB 3QENA 4BFZA 2O8EA 4AKGA 2JLUA 1LFDB 3V4RA 1Q12A 4JLAA 4KSBA 2FFBA 3QPWA 2QU8A 2PT5A 2J59A 2VP9A 1RW4A 3FE2A 1ZJ6A 1NJGA 4NYJR 1G8GA 3EZ7A 4U00A 4D26A 3E1SA 3EAQA 2F1IA 2JDID 2V7QA 5JMTA 2RGEA 3CUEF 1YRBA 4G5RA 4QBHA 4DWJA 3AVTA 4PSVA 2N46A 5HZHA 2QG6A 3VR6A 2HJGA 1DAMA 1JR6A 1KIMA 1E0SA 1Q1QA 4EPTA 2CVFA 1KDRA 1UKYA 3MLEA 2OXCA 1W0KD 1Q22A 4I81A 2XNDD 4V0LA 3OFNA 2XTMA 4GBMA 1U90A 2WSSA 3EZ9A 2QGZA 3P20A 3IHLA 4JLJA 4DHEA 3K9GA 1W2HA 1ZC4A 1X8JA 1KJYA 2C5LA 4Q9LA 5FOTA 4DSTA 3R20A 2Z43A 1LNZA 3ADKA 1JPJA 1W49A 1DAHA 1EGAA 2BBOA 4QFMA 4Z8XA 1IXZA 2REXB 1DVRA 1N3BA 2A5GA 3CX8A 4PX9A 5DE3A 2VO1A 1FW6A 2FSFA 4AURA 4R7ZA 3EZFA 2GCPA 3LBIA 3LX8A 1G8PA 3LW8A 3Q5EA 1XBTA 1GG2A 4CIDA 1P73A 4B2IA 1XTKA 1S9HA 1WA5A 3UG7A 5AUNB 2REBA 2QP4A 2R9VA 2ZS7A 4TMXA 4Q9HA 2BOVA 4DSNA 3DO6A 3DDCA 1Z0KA 3KUCA 2PEZA 3BFKA 4G3XA 4ASUD 3GLFA 4RD1A 2A5YB 5DI9A 4OQNA 1D2MA 1CU1A 4OQXA 1EFRA 1U2RA 3VTKA 4PQRA 2GZAA 3FKQA 2ZRKA 4B3BA 2V6JA 2ZVPX 2HDNB 1NIJA 3FPAA 4KXFB 1ZNWA 5BN3A 4HAZA 4BASA 2XAUA 1DPFA 3F0TA 1RYHA 5KPJA 3WNDA 5FL7A 3V9PA 1N0VC 4P32A 2J7KA 3PQCA 1F5NA 2VEDA 2ZS8A 4R2IA 2O5VA 3RWMB 1E2FA 1G16A 1CJKC 1OH8A 5KO2A 4II7A 2DFLA 1T5IA 4UNQA 3FYHA 4OYHA 4OL0A 1GITA 2OBMA 2VL7A 2QAGC 1Z07A 3X1WA 1QHSA 3N70A 5AJWA 5DLQC 1XTSA 1G7RA 2F3TA 3CF2A 1FMJA 1U98A 1W47A 2FMXA 4KJZA 3ZVRA 1ETUA 5BW8A 1FZQA 1SVMA 721PA 4C0QC 2EWWA 4B3DA 2QNRA 2XJ9A 2BDTA 3SHWA 1T3LA 1KGDA 1Z06A 2CL0X 5SZJA 3RNLA 4GP7A 2C04A 1DADA 1DAKA 2VF7A 3ND8A 4GDFA 1ZM3A 4M1SA 4G5SA 5D3QA 1HTWA 3X1ZA 1WBDA 1VTKA 4D2IA 1P60A 2PCLA 1G18A 3T61A 1G7CA 4BLRA 5AJVB 2OFWA 3KJEA 4NCHA 2CCKA 2GEVA 1KDOA 4C2TA 3MAAC 1OV4A 3PUZA 4AKEA 3C8UA 4LRWA 1AIPA 4HLUA 3V4FA 2A78A 3ADCA 2WIAA 2ZI7A 4HDQB 3IPXA 4O3MA 5IHPA 3R9WA 5JHGB 4KYIB 1XXHE 2IYUA 5F98A 4CGZA 2JLXA 1CRPA 1MRSA 4GT1A 4Q1AA 1BH2A 3GLGA 2C98A 2Z4RA 1NBMA 1XMJA 2QI9C 3U44A 3IEUA 3U3JA 2YV5A 2GCNA 3H84A 2XSZD 2CCGA 2Z5FA 5EE1A 2ZJ5A 2KBEA 4AG5A 3CWZA 4UXJA 1JXOA 1JXMA 4B75A 4V02A 2JLSA 4DCNA 1O87A 2YC2C 4A6PA 2QRNA 2XB2A 1W4CA 3SN6A 3O8RA 3HDTA 4PAQA 1S9DA 4RCYA 1Q0UA 5JECA 2ZUBA 5KTYA 3ONWA 2HEIA 4UNSA 4NKRA 3NHAA 5B2ZA 1W46A 3CF0A 4MGKR 3WRXC 1RIFA 1GTVA 1AZTA 1R8QA 5J4YA 2H1LA 3OEED 4U7DA 2X77A 2FEOA 2XTNA 5L3SB 3LBHA 5TVKA 1U8ZA 5AK0A 2CK3A 5JZVA 2WZQA 2B21A 3ZIAD 4BFWA 5HZKA 2IS1A 1PV4A 3KTAB 5GVRA 1AS3A 1BIFA 1U81A 2Q9BA 2EYUA 3NDPA 1IQPA 1TEVA 1P9NA 4XSGA 4PC1A 4US2R 1YE8A 1A82A 3CIOA 4YDHB 3BB3A 1G4AE 1TF2A 1GFIA 2MSCB 5B57C 1YZQA 3NBZC 1KK3A 5EP4A 4LOAA 4Z54A 3DOFA 3Q7PA 2AR7A 2CE2X 3REFA 1QHXA 3F5FA 1AN0A 4QGFA 4DIEA 2ATXA 1XJ0A 5JLJA 3LQRA 1LV7A 3K70C 4UNPA 2BMFA 1HYQA 2YNMA 3LNCA 1QG4A 1W2GA 5HE8A 5JRZA 5EP2A 2DWQA 6Q21A 2J0VA 3TUZC 3TBKA 1IN4A 1SULA 4MRNA 5CLQA 5FPHA 3CPEA 3TIFA 2X2FA 1N6RA 4MGYR 1WMSA 2FSHA 1US8B 4Q02A 2WWGA 1R5BA 3K53A 2OAQ1 1R10A 4C7OA 2KBFA 5AUQA 2QMEA 1Z6TA 1U8YA 3OESA 3CWQA 4BE7B 3WP0A 3AH8A 3U7GA 2AWNA 4N0DA 4NL4H 4XWAA 3HU2A 4YONB 3DOEA 4LJ5A 1ODFA 4OHXA 2QP9X 2W6JD 4D4JA 4A2PA 2WWXA 3BFVA 4TLAA 1CRQA 1E9CA 2ZAOA 1A7JA 1G64A 2OFXA 2HXSA 2XGJA 1R2QA 2AFHE 1R0XA 4NE2A 1NN5A 1CR0A 3N5CA 4QOSA 1CR4A 4NYIQ 2PZFA 2ZSFA 1QHHA 4EFNA 3P4YA 2CL6X 2J3EA 4HAVA 3FB4A 3SDZA 1N6LA 1KYIA 2XOKD 4PHTA 1P3JA 2ERXA 5DI3B 5EXXA 2FFAA 1HURA 5DIFA 3AKEA 5CM9C 3NHBA 1XTIA 2W2VA 2ZJAA 1I2DA 3T12A 2YOFA 4CEIB 3BGWA 5JJKA 1LY1A 5FTJA 1OIWA 1N6PA 3BORA 1ZM9A 4TTRA 4M1TA 5D3MA 3EPLA 4OKSA 3IHWA 2ODNA 4LJ9A 2ZROA 4EKDA 1QHNA 2ZSDA 1JAHA 3EPHA 1M7HA 2ZSBA 1II9A 4D25A 4EQ6A 2VSOA 3K0AA 1E4VA 2YWFA 4OI4A 1IONA 4GMDA 4IOKA 3EIQA 4LHYA 4RD0A 1HV8A 4EIWA 3BXZA 2BJVA 3SYKA 2JEOA 3DZDA 1YZGA 3BRWD 4RZUA 3GJ4A 4OHWA 4CT4B 3IDQA 5J40A 1VIYA 4JLOA 4KCGA 4S2EA 5EZ5A 4B34A 1NNEA 4TT3A 1KKMA 4JSTA 4B2LA 1TF5A 3I73A 4DLVA 3HU3A 5DYIA 2WAXA 3GFOA 2F43B 1HY3A 3IO5A 3LVQE 4DLWA 4ZDKA 3RS2A 5JS8A 4YMUA 3Q3JB 2FH5B 4Q9JA 4C0KA 3LV8A 4RY2A 5C4GB 2B6HA 3CRRA 1G5TA 5J47A 3U6BA 1Z0AA 1SXJB 3Q5DA 3GJ5A 1P5ZB 2CHGA 3AP1A 1C4OA 4HZUB 2G3YA 3BB1A 2ZRPA 3H4MA 3KJIA 4XTCS 1ZMXA 2AD1A 4IJMA 3EPKA 1CJMA 2YJTD 1XCGB 3QKTA 1GNPA 4QJ5A 2V1UA 2UZIR 1J8YF 2NMVA 1XZQA 2FZ4A 4GI7A 4CDGA 3QY0A 3B9QA 5CLLA 2G88A 2ZSEA 4PSKA 1JALA 5BWMA 1G5RA 1UBFA 5E7MA 2P6NA 1E9SA 2BMEA 2B7BA 1NLYA 3SEAA 1A4RA 2QROA 1NG9A 2EU8A 1VCOA 3U3OA 1NL3A 3A4NA 1XB2A 4LPSA 3VR5A 2R2AA 2BHRA 4M1OA 1CEEA 1MO5A 3TAHA 1JNYA 4HAYA 4YMTA 2RMKA 4CYMA 4ZCIA 3GLHB 2J5XA 4CEJB 2ZR7A 1BYUA 2ATVA 2GAOA 1QVRA 2Q0HA 3IIJA 4GP6A 1Z0FA 3RRMA 2YWHA 2Z83A 2IBMA 1IJEA 3VX3A 2ECKA 1IXRC 2RKOA 1UEIA 3A1WA 4RKEA 3SBEA 2AHOA 1CTQA 2IW3A 3LW7A 4F91B 4IVPA 1G9XA 1BYIA 2RH5A 1Q57A 3U7EB 4Y0VA 2VLIA 4JVMA 4B74A 1M1YE 5L3RA 3WHKA 1XXHA 4BZXA 3ADBA 5EUMA 1E3MA 2FG5A 1AS2A 4XTRA 1TTTA 4P3YA 2GWHA 3C14C 3S1AB 1M8PA 4TZ6A 3C7KA 1DS6A 1QHIA 2ZS9A 1SVWA 3QKRB 5EE3A 3SE0A 4ZV4A 3KQNA 3QVVA 2D4HA 2E87A 3GQBA 1KKLA 2RGGA 3BFXA 3C16C 1UBCA 4MYTA 4HZIA 2KE5A 1BS1A 2HLDD 1KAGA 1RRFA 2QMHA 1QRAA 5FOSA 5H8WA 4PC7A 1XX6A 3KJHA 3WXMA 3D7MA 1UPTA 3QPVA 3B5JA 2A5JA 2JJ8A 1N5IA 2AFIE 2AXPA 3T06B 2V8OA 2VP0A 3OE7D 2VBCA 3BWDD 3R8CA 3RS0A 4Q4AA 5CIWA 2RGAA 3FTQA 4DJTA 4BLPA 4W9MC 3CNLA 1KY3A 4B43A 4DCVA 4BFTA 4YDSA 2PT7A 1QG2A 1E2HA 1K6MA 4Q7MB 4CEHB 4A15A 3GLFE 1T3HA 2RHDA 2BEKA 2H18A 2GNOA 5C4MA 4YLGA 5JS7A 1W44A 1IM2A 2ERYA 4NU0A 2D3WA 1OHHD 4WZAE 5CYPA 1E2EA 4BFYA 2Q21A 4ZDJA 4LYHA 5DISB 3U4QA 5EXPA 1J7KA 2PZGA 2QENA 4BFVA 3THWB 3PEYA 4N1AA 1KK1A 1OT3A 3GLIE 3KFVA 1SXJD 1TU4A 1E2GA 2R62A 1JB1A 3T15A 4ERNA 2O8FB 4P4UA 3O8CA 1OSNA 1K8RA 1LF5A 5JWHA 5FOVA 4DVGA 1H8HA 4US1R 1OFHA 1OKKA 3VKHA 1GILA 2RCNA 2GXUA 2NO7A 1QHYA 3WBKA 2J45A 3ZVNA 4AYTA 4JKYA 4GZMA 2OG2A 3AGPA 2Z6VA 1IN7A 3R9IA 2IYTA 4AG6A 4AC9A 2BC9A 5IK2A 5FUWA 1L4UA 1E32A 1F48A 1QZXA 3RS4A 5HCIA 2ANCA 1HQYE 4AKHA 4FCTA 4NCNA 4Q48A 3KXLA 3W5IA 1FOEB 1H8ED 2VRWA 4LZZA 1K5DA 3R7WB 1DAEA 2CEAA 1E0KA 3AF4A 4KO8A 1DBSA 5HKKA 5DN6A 3W6NA 3LX5A 3ZQ6A 2ORIA 1PZNA 2AK2A 2KJQA 2CBZA 4TMTA 8OHMA 4NONA 3MRSA 4DLXA 1G7SA 3L0SA 4NH0A 1E0JA 4GNKA 2XJ4A 3QE0A 4LJ4A 2OLJA 4AIIA 4FD2A 1MO6A 1AZSC 1VG8A 2IYSA 3TAUA 3DHWC 3CBQA 1G21E 4EPYA 3U3KA 3HP1A 2Q3MA 1ZNZA 1X8LA 1DE0A 2W83A 3HR7A 3QF7A 4UNNA 3FKSA 1XEWX 1ZM7A 1XNJA 2J1LA 4Q4JB 3CH4B 4TYWA 1KI6A 2I1VB 1T8TA 4TSFA 5TMPA 5JRJA 4QRHA 4A0FA 3U6KA 2F9LA 2ZRBA 3LBNA 1S96A 2VHUA 4LJYA 3WHLA 1NBME 1Z3IX 3W8RA 1AKYA 5FI1B 3TNFA 1Z22A 3UXMA 4UNRA 2MSDB 1Z29A 3A1VA 4JL8A 1C9KA 5LPNA 3A6PC 3KKOA 4EAQA 3RSLA 2GXAA 4GPTA 3T1OA 1FFHA 1YVDA 4RD4A 3X1YA 3I62A 1JEDA 3GMTA 2QSYA 2ZRMA 4OHVA 4RFSA 3RS7A 3L2OB 1S4QA 3ZS8A 3QBTA 3MUFA 2WMNB 3AKYA 1Z0DA 4MH0R 1YZTA 5L8VA 3ICQB 1YZNA 5J4LA 2GCOB 2OM2A 4DUGA 1R4AA 2BEJA 4RD6A 2ZE5A 4R2HA 2GA8A 5JI3E 1S8FA 4QHYA 4A92A 1TAGA 2V3CC 2ZYTX 3QOFA 5B58C 3EWAA 3OEHD 2WM9B 4EPVA 1F2TA 2O8CA 5FPKA 4FMCB 3CNOA 2EW1A 2R6AA 4DT1A 5EUQB 4DLUA 2V7QD 3K09C 1T91A 1YZKA 2W00A 3M4YA 5FPSA 2OESA 1N6HA 1ZRHA 2PEYA 1AA9A 1KDPA 3TLXA 1N0UA 3HPQA 3HYRA 2AXNA 1KI1A 4ACAA 1UM8A 1E99A 1UKEA 4G5GA 1GVNB 3E70C 4L16A 4C3ZA 5FBRB 4K8OA 1QHGA 3GLGB 2IYYA 3W9YA 1CR1A 2QTFA 2TMKA 3L0PA 2Q9AA 3U44B 1MOZA 2Y8EA 2ZRGA 5B30A 2WBLC 3PENA 3EA0A 2ANBA 2DCUA 2BJWA 2IXGA 4L4UA 3IQXA 1GL6A 4AKIA 4IOJA 1JJVA 121PA 1E2QA 1W48A 5JBQA 2IEZA 3KKNA 3QKSB 4Q19A 1JR3D 5JWOA 3OAAA 2ODEA 4RCZA 2EFDB 2GTPA 1CBUA 1J8MF 2PCJA 1ZD1A 5FTLA 5JCPA 4Z1MD 5KPDA 1WDTA 2D7CA 3MJHA 3AF0A 2QP3A 3TUIC 1JQJC 3W6PA 2C95A 3RABA 1KSGA 1HA3A 3QIAA 1XD2A 2WWYA 3U61B 1XZPA 2WTUA 2AK3A 3AGQA 4URXR 2ONJA 1S0UA 4PAMA 1XU4A 3CX7A 2UZ3A 1RC8A 2H7VA 4D0LB 1UAAA 1CJTC 1EFRD 5FBWB 5EP3A 1II8A 2PMDA 4DCSA 1E1QA 3K0EA 1Z8FA 3VU9B 1NY6A 1XCMA 4JIMA 2ZQ5A 2ZI5A 4JYCA 1HEIA 1VMAA 3B8HA 4RJLA 4AI6A 4M1YA 1CLUA 2EFEB 4EJSB 4UXHA 5JEEA 2HXYA 4FWIB 4MDEA 4BLOA 3TQCA 4JYBA 2O0KA 2FU5C 1JAIA 3QQ5A 5EE9A 2QBYA 2JJ2D 5CDFE 3PUVA 5C46F 3J81k 1F2UA 3NBXX 4LUCA 1G3IA 4E09A 3MG9A 1E9FA 1R8SA 4L9SA 2J7PD 1GRQA 4HI0E 2HF8A 1X8KA 5J5CA 2J9RA 4BLQA 3SFVA 2HCBA 2QT0A 3PIRA 2NZ8A 5GJBA 3EG5A 3QEJA 4M1KA 3K0CC 2DFKB 4L5BA 3QXCA 1MABB 2A30A 1NLZA 4TLEA 2IYWA 2CNWD 2ZJZA 3GEEA 2MMGA 1E1RD 4P4SA 5FUYA 1ESNA 3NDBB 5FR1A 3VR1A 2FFHA 4MQBA 1W36B 2JIZA 4A36A 2IYQA 3SFZA 3DVLA 2ZRHA 3FHCB 2F6RA 2WJJA 1E98A 1SQ5A 4B6FA 2FV8A 2AKAB 2YZ2A 1NMZA 1Q1EA 3Q7QA 1A5TA 1NVXQ 3UMSA 5DNYB 1ESMA 2F1RA 2FX3A 2W0SA 3L8YA 2IXEA 2L0XA 4Q00A 4AWXA 4UXIA 3SC3A 2HUPA 4GFDA 5IRCD 5FUXA 3QG1A 2ZRJA 4KSCA 3ZZUA 4B3GA 1QHHB 2BV3A 1D8TA 3FHOA 4ZO4A 3CRMA 2WMOB 3SJAA 4W5JA 1ZIOA 4BGDA 4OQMA 3BAFA 2QPTA 4PQFA 1J70A 3W8NA 2I3BA 4PPQA 3GLIA 2J0QA 2J0UB 2YC4C 1FUUA 2HT1A 1G6OA 2IHBA 2WJIA 1SVIA 1VECA 2X1VA 421PA 4D82A 3GEHA 4JZKA 1RRCA 2PMKA 2ODWA 1U0HC 1FUKA 1X1RA 4MRSA 1DEKA 3ND9A 4U02A 2O8DA 2BWJA 2BBWA 4C0AC 4BRUA 2E1RA 3A37A 3FGNA 1KO7A 4UKDA 2GJAA 4WZ6A 3EX7C 4I1SA 3NEYA 4FMDF 2HV8A 3D8BA 2BVNA 3WBJA 2EFCB 4A0RA 1XTJA 3GP8A 4EQ6B 2QY9A 3RC3A 2FJUA 4ZI2A 4UQOA 3TQFA 3TRFA 3U5ZB 1DO2A 1W0KA 2N42A 3B1YA 1SVSA 4GOKA 1MH1A 4OI1A 2XNDA 2OZEA 1T0HB 2WKQA 2CHVA 4LBWA 1Q44A 1TPZA 1ZCAA 3L0IB 3ZVMA 4M2LA 4Q5IA 1KO8A 5KYKA 4WBSA 3TSOA 5JSZA 3CRW1 4JLBA 3UK6A 1EFCA 2WSMA 1Y3AA 1D5CA 5UKDA 1D9ZA 1RZ3A 1UJ2A 4GOXA 1NKSA 1VKJA 4PPFA 3T5DA 5CK4A 1WBBA 3EASA 3M0EA 2DPXA 1Y63A 2W6IA 3G82C 3RDPA 3VKWA 3ZZTA 2P65A 4MKFA 4URVR 4TYQA 3QXSA 4Q03A 2BMDA 2V6IA 2WHXA 5G41A 2NO6A 2QT1A 1FP7A 2ZE7A 1XDBA 4EPXA 1TQ2A 1OYYA 3ICEA 4XH9B 2WWFA 1J99A 2FOLA 2OLKA 4WVFA 1L4YA 1ZAKA 1SZPA 3VKGA 4ON9A 1S3SA 4N0EA 4G5OA 1TQ4A 4ASUA 4QBGB 5KNBA 3NVAA 2ZYVX 4I4LA 5HCNA 5H1YA 5CITA 4QM7A 4A8JB 1Z5ZA 3SS8A 4UJ3A 4IDOA 4Q01A 1OE0A 1AKEA 3K0FB 1CJVC 3A1SA 2XZLA 2LKDA 1VG1A 2OILA 1W36D 2GETA 2Q3HA 2QAGB 4F7WA 1IXSB 4YXWD 1GM5A 3AVYA 1KI8A 1X3SA 4EFLA 4DLYA 1N5KA 2QTHA 1P75A 5TY0A 1KSJA 5GJVC 1ZUHA 1COWD 4RD3A 1FQKA 2FFQA 3KXKA 2HCJB 1E9EA 3GJ6A 3LDAA 1XEXB 3ASYA 3ZZ0A 3GEIA 1F6BA 1EFHA 3HWSA 4RVCA 4P33A 2GDJA 1KO1A 5LDDC 1HT1E 2WKPA 3LFUA 4YC7A 5JI2E 4C0JA 5ANRB 5SZIA 2AN9A 2CMKA 4XWKA 3TVTA 3RRZA 2PJZA 1AQUA 1E2DA 1T5LA 2G1KA 3OIUA 2IF0A 3K9NA 3K09A 2WVJA 2ZU6A 1OB5A 1WE2A 3GD7A 3IUYA 2QQEA 2VA8A 2QTVB 4A82A 1E6CA 3W90A 1N2CE 4EPRA 4I1VA 1XMVA 2GZDA 3BB4A 1GL7A 5DO9A 1S1CA 2J87A 1GDDA 5CB6A 4WAUA 1U99A 4B3CA 2C2HA 4PHGA 3B1VA 4I1UA 2O8BB 1S1MA 2F3RA 2XB4A 1G8FA 3LVRE 1MRNA 4URZR 3LQQA 4EDHA 4LYJA 2EFGA 3U7HB 1LTQA 2IYLD 1P9RA 2OHFA 1ZD9A 4C0LA 3K1JA 5K8IA 1M2OB 3OIVA 4Q4AB 1KJWA 2ZE6A 4H1UA 1FX0B 3AF3A 2DR3A 4OHZA 5EJEA 1E2IA 3FVQA 1QBKC 5FI0B 4D0GA 3IEVA 4B73A 2P5SA 3WNBA 3I5YA 4HB2A 2RAPA 1GRRA 4I99A 1OJLA 5HPYB 4PPGA 5E95A 4B76A 2RGCA 1G17A 4LY6A 2RGNC 3KL4A 1NN1A 2HF9A 4LSGA 1CULC 2NG1A 4FW9A 5BQ5A 4M8NE 1N6NA 2XITA 4IKEA 5F3WB 1EFTA 4A9AA 4IEEA 4LWZA 4OBEA 1A2KC 3NC0C 4MKIA 3ZJYA 4ZKEA 3HU1A 2W2XA 2ZJ8A 4PC6A 3AKCA 3OIYA 5BN4A 3KQUA 5CDFA 1DARA 3AVQA 3A4LA 2WPDD 4ILEA 4OHYA 3WY9A 1GKUB 1P4SA 3FWYA 3ZIAA 4QBIA 4LV8B 2JATA 4PANA 5FPTA 3W3AA 2ZPTX 4Q9IA 3BJIC 4PHFA 4LHZA 5A5GA 3UIEA 1NVUQ 1QF9A 1KMHA 5CM8B 3P26A 1M7GA 2BKUA 3IPYA 5CJ2A 2ZREA 3K0CA 3FDIA 3O8DA 5FOXA 2ORVA 5ELXA 5DGXA 2KWIA 4JJZA 3I1FA 3EC2A 5KNCA 2P6RA 4QGAA 5JCZA 3THYB 4KFTA 1VCMA 1GL9B 4E5UA 4R98A 2MSEB 521PA 4L15A 4JBWA 2WAYA 2ZJOA 2ZYWX 1GRNA 4LC1A 3NWJA 4AYXA 1E9RA 2AWOA 2MMCA 4CRWB 3O8BA 2LCFA 4LJ7A 3AB3A 4C9BA 3B7GA 3OZXA 1NY5A 3QG5A 2X8AA 1P2TA 1KMQA 2GVZC 3E5HA 1UF9A 4IOLA 5LB2A 1B0UA 4DCTA 3BC1A 5EXTA 4F92B 2HYIC 5JFGA 4V0NA 4U5XA 1LW7A 4LBYA 1Z2AA 1N5JA 2GAAA 1W5SA 3NG1A 2C9CA 1DOAA 3Q85A 4V0MA 3TW8B 4Q1EA 4OQFA 2G6BA 4XWOA 2W6JA 1ZM4A 1ZUNB 1E69A 2PLRA 4LI0A 4PR0A 4RFSB 3RANA 1G4UR 2IC5A 4MKHA 4A0GA 4C0HA 4TQUS 5J4KA 3FFAA 3PUXA 1HH4A 4PZLA 3SJZA 3SQXA 2YINC 4KFSA 4M1MA 5FFMA 3U60B 1YZLA 4MUAA 3CPJB 5KDOA 2QPOA 2XOKA 3QJYA 1NMYA 1RVDA 3DM5A 4M9QA 4Q4HB 2LWIA 4O0MA 2X2EA 2A5FA 1SHZA 2PL3A 4OJQA 2QGNA 1F2TB 3THOA 4PSAA 3ZQJA 3CF6R 1XJCA 4NTZA 1GKYA 5FOUA 2R65A 1DTSA 2F55A 4PTLA 3QUSA 2IWRA 2G83A 4GOJA 1FQJA 3L0OA 3GJ7A 1E2NA 1U9IC 2QE7D 1UBEA 2R8RA 1OH6A 1KZ7B 1G20E 1KJZA 3UMFA 4DRZA 3SYLA 3NXSA 3BH7A 1I4TD 3I3SR 2JLQA 3QXXA 4QJ3A 1UADA 3THXA 3QPUA 1JPNA 3H0KA 4LCBA 1OXSC 5SZKB 4J0QA 3SZRA 1Z0IA 2AL7A 2IS2A 2FPLA 2W58A 4QXAA 4RSGA 3BD9A 1BO6A 3I32A 4LV6A 4DXAA 2CL7X 3AVOA 3T1VA 3AVWA 2CJWA 1KTVA 2NO1A 5G40A 1KI9A 2CVHA 4RD2A 4XD7D 5CB8A 3AP2A 2XXAA 4QHSA 3PEUA 5AUOB 2G9NA 5AJXA 3OHMA 4KLNA 1E2MA 4QKQA 3BE4A 1TUEA 2FF7A 3KUDA 1PLJA 3LRPA 4LHXA 3AM1A 4DB4A 1UBGA 1XD2B 3ZD6A 2O8EB 1CS4C 4KITB 3KQKA 4QHTA 1VIAA 3AUXA 1IN8A 1AGPA 1EX7A 1FTSA 3BK7A 1GOTA 2WJGA 3CR8A 5H70A 1Q1ZA 3WMGA 821PA 4UJ5A 1Q1BA 2GK6A 4RZXA 1II8B 3EIHA 2PBRA 3NBFA 4IEIA 3UATA 2DY1A 4US0R 1XMSA 5KUTA 3PG5A 2FPKA 1NN0A 4BEJA 2VHTA 4B6EA 3H1TA 2GKSA 1US8A 1YHNA 2QN6A 4OK6A 3DKPA 2QMUA 2QBYB 2A5DA 4BZQA 1ZNXA 5TV2A 4ACBA 5CYOA 3BIFA 4AD8A 2ZYUX 3SR0A 3VMFA 1KOFA 2DB3A 5EE0A 4BPBA 2QEQA 3NEJA 3W34A 3CW2A 4HSEA 3W3ZB 4E03A 1KNQA 2VTKA 4LX0A 4DLSA 4O25A 1JJ7A 4ZDWA 3ZDQA 1E94E 1R0WA 1W4RA 1YR6A 4HUQA 3D31A 1FP6A 2DYKA 3AP3A 1Z63A 4B35A 5FUVA 1Z2CA 1NSTA 1P72A 1ZM2A 4HATA 3B9PA 2FSIA 1G291 2FGJA 1NP6A 2WJYA 1R5NA 2BMJA 4KFRA 4W7SA 4DEYA 4YQFA 2ZVQX 3ZLJA 1OFIA 2P2LA 1TUIA 1LS6A 5G53C 1OPXA 2A7QA 2VQSA 2NQ2C 3C5HA 4NDZA 4I1OA 3CZPA 5FTKA 3MGCA 4N3NA 4D0NA 5KSOA 4X8OA 4PHHA 2NOAA 3KFXA 3ZGXA 5BYKA 3QBVA 1WB9A 1ANKA 1N6OA 4CEIA 3KB2A 1WRBA 4OI2A 4B32A 3GLFB 5FBVB 2WJVA 3V00A 4HLDA 2ZTSA 3RRYA 4QM6A 4URWR 2HLDA 2Q3FA 1BMFD 2DFTA 1OH5A 4QNMA 5BN5A 2XZPA 3AVPA 5BYJA 2R6DA 2OO7A 4PC2A 1P2VA 1KZGB 2RGNA 2ZR9A 3OE7A 1R6BX 3TK1A 2ZE8A 4KBGA 1G3UA 5G3ZA 4D4KA 3JZAA 3H86A 4FI3C 3VFDA 4TL8A 4QNRA 1PLKA 1GZSA 2JGNA 2ORWA 1W0JD 2GHIA 4F38A 2FWRA 2VP6A 2JLVA 621PA 1S2MA 2CHQA 1SHKA 3NBYC 2JAQA 1FTNA 2BCJQ 2QA5A 3K9LA 2FDCA 2F43A 2ZANA 1XD9A 2IUUA 1OLOA 3JVUA 2YVUA 1OHHA 1XD8A 3W5JA 2OEPA 2O52A 1SKYE 3CO5A 4M0LA 1IJFA 4HUTA 3EPJA 3DKVA 4L9WA 1XPRA 2FGKA 2H16A 2PX0A 4PO8A 4M9SA 4NMMA 4BUJA 2Z0MA 3DZ8A 3I8SA 4DSOA 1Z6GA 3WRYC 1AGRA 4GMXA 1ZD8A 3IQWA 2QSZA 5IT5A 2QQ0A 3IIKA 2WOOA 1RRGA 2IF2A 4E07A 2F7SA 1N6KA 2Z4SA 2AD5A 2ZSAA 1YR9A 1XJQA 2HT6A 1E1QD 2V4ZA 4MRRA 4TYYA 4K81B 2C9OA 2GXQA 4WXPA 4NPHA 2VSXA 3KZ1E 4JVLA 4Q1DA 1VG0B 2QM8A 4NCJA 1NVVR 1KAOA 2I4IA 4IHQA 4DBLC 4TLCA 3ETLA 2W0MA 3OFND 4PPNA 4BEBA 2WSSD 3TGPA 2IS4A 2ZU0C 2ZR0A 1ZBDA 1N6IA 4TMVA 2VIIA 5A0FA 3HPRA 2D62A 1MKYA 5SZHB 5FPYA 1RYFA 2OBLA 4ZPXA 4Q47A 3TUJC 3RSOA 2O0HA 3B6EA 3RYTC 5L3VA 2JLWA 4A1FA 1E9BA 1DAGA 4QBFA 1EESA 1EG7A 3MWKA 5TDHA 1TF7A 3T1QA 1CIPA 5E7IA 2QM7A 5DHAA 4D80A 2OT3B 3CLVA 3GFTA 2C9YA 3AVXA 1OXUA 1NVWQ 1T3SA 2R44A 2R6FA 3RRNA 2OBNA 1KY2A 3BERA 2JIZD 2P67A 3LH5A 1IY2A 1F60A 2LKCA 3LAWA 5AUPB 3SQWA 4JL6A 3QXHA 4TWZA 4C0BA 3BS4A 4DDVA 4ARZA 3S1AA 1XEWY 1AK2A 4C2UA 2WWWA 3I4LA 1E2LA 2G1JA 4IVRA 1P2UA 3QKRA 4LYFA 2R6CA 5IF9A 2D7DA 1EFUA 3F3YA 4FCVA 2ZRAA 4LJ6A 3MSXA 2IA5A 2ZM5A 1SVLA 4M4SA 3EZ6A 1W36C 4LPKA 1O3YA 3VNVA 2P6UA 2GZHA 1DG3A 2FZLA 2GEUA 3LWNA 2C99A 3QVUA 1VHLA 4M1WA 4NP6A 4B3XA 1YR8A 3MWYW 1IN5A 5C18A 4KI0A 5FL7D 2NIPA 1FL9A 2KB0A 4FMBB 3UKDA 5GVSA 1U9IA 3SYNA 3CB4A 2A9KA 3OEHA 1XP8A 2XNSA 4RKFA 2OCYC 2ZJ2A 4CEHA 1EWQA 2WOJA 3RS3A 2RHMA 2SHKA 2ZRNA 1UKZA 4JLDA 1LF0A 3BOSA 4TMZA 4AK9A 4KLZA 1JQLB 4S35A 1ZCBA 4JMPA 5LD2B 4IOMA 4IVQA 1G7TA 5GJWC 4LJAA 3THWA 1ZYUA 3GJ0A 1P2SA 4A2WA 3GJXC 2GF9A 4Q7JB 1OXVA 4Z8YA 1CXZA 4MITA 5TB5A 3F8TA 2JJ1A 4F4JA 4C7OB 1E79A 2O8FA 4JT2A 3I92A 4KVGA 4FMCF 2OSBA 3C15C 1MO4A 2VPPA 5E7JA 4JVSB 3FMIA 3PUYA 1J90A 2B8WA 2XX3A 3NIBA 4HAXA 3T35A 1KHTA 1L7VC 4TQAA 2VP5A 5TARA 3TE6A 1E9AA 2D74A 4JT4A 5AJZA 2W6ID 5KSPA 1KI2A 2ZJYA 1JR3A 3AV0B 4PO9A 2R6GA 4L8GA 2B7CA 3R7WA 4NZYA 4M21A 4Z1MA 3GPLA 3AVUA 3MD0A 3D6TB 3N2EA 4B44A 2XEXA 1JI0A 3TMKA 3UWOA 1XF9A 2IL1A 2BKEA 3WYAA 221PA 3ZD7A 1NBMD 1HT2E 2UKDA 4XVRA 5G3YA 4DC9A 4V0ME 1ZVQA 3E2IA 4LBZA 4IXNA 4AY2A 2FSGA 2ZI6A 1M7BA 1YU9A 4IFBA 1U94A 4QGGA 4HLQB 5B64A 3SI7A 1TQDA 5D3MB 4FCWA 3A58B 3HR8A 2WV9A 4BFXA 4ZIRA 1KMHB 4NCIA 4Q4JA 2JDIA 1KDTA 3X1DA 1ZW6A 4HEJA 3SJCA 3NKVA 4M9ZA 3LLUA 3RWOA 4XSHA 1AJEA 2QZ4A 3EC1A 1YQTA 4DCUA 3K0AB 5DYGA 4JLMA 1VG9B 2E9SA 1KI3A 4BECA 1XEFA 2JJ2A 1TX4B 2J41A 2JASA 1NF3A 2CK3D 2GJKA 2YOGA 4XVQA 4A8JC 3ZH9B 1NIPA 4BFSA 4GZLA 3REGA 1DO0A 2DFNA 1E2KA 4XVUA 2J7PA 3GFPA 3QI2A 3KB1A 1Z0JA 4LYAA 4MRVA 3PEWA 2ZITA 3T34A 2YKGA 4QGHA 3SJBA 1G1MA 2D2EA 4DSUA 1G3MA 4WW0A 1KNXA 4KFUA 5P21A 3WYGA 2H8KA 1VHTA 1OFUX 1PUIA 1Q20A 2CNWA 3N2IA 2F9MA 1E1RA 5GADl 2GCOA 4G1UC 4HAWA 3U2QA 3KXIA 3MCAA 5KDDA 2ZEJA 2NGRA 2N1BA 1UDXA 4MYHA 3EIEA 3Q8XB 3QNUA 3WYFA 3VHXA 4TL7A 1WQ1R 3RS5A 1D2NA 1J2JA 3QF4A 4RZ2A 2IYVA 4CT5A 3FMFA 5JWRA 5K8UA 2ZI3A 2GEDA 3R8FA 4JKIA 1Q3TA 4NYMQ 5EP1A 3NH6A 3KKQA 3ZYCA 1M6NA 1RJ9A 3B82A 1TEXA 4JJKA 1GWNA 2JLRA 1HE1C 2GVDC 1UEJA 2YHSA 2BIFA 4DZZA 1R0ZA 1RFLA 2NO9A 3LLMA 5FTMA 5FL3A 4DLRA 3Q9LA 4BLSA 1IAQA 1HE8B 4Z51A 2AKYA 2G0NA 2PJRA 4F4IA 3LD9A 4Q9KA 4EPWA 3AKDA 4DLZA 5C2JB 2Q9CA 3I8XA 3QEOA 4GSYA 3TJZA 1IOZA 2V54A 1LS1A 2D2FA 2ODBA 2ZUDA 3IKJA 2IWHA 3CR7A 2PLFA 3KDSE 4ITRC 5H68A 5TXGA 4TL9A 3O47A 1WCV1 4X8LA 3P32A 2Q6TA 3QKSA 2KSQA 2GK7A 2P0EA 1QDEA 1W4BA 2PH1A 2VH5R 4Q18A 4Y0AA 4BQSA 1DELA 1W7AA 1I4LD 5FH9A 5L3QA 5C1BA 2QAJA 1DAIA 1Z6YA 1EX6A 2EYQA 1XXHB 1ZP6A 4KVAA 2IYRA 5AWFC 3VQTA 3ZS9A 3THXB 2IEYA 3UG6A 1G6HA 4R9UC 2UVQA 4OI0A 1BOFA 3PFIA 1KI7A 2CCJA 3B1ZA 3CRVA 1YR7A 1E9DA 3MWJA 4X8HA 1ZU5A 4BRWA 4EUNA 1VDZA 2CJWB 3WMEA 4A0HA 4LC0A 1SGWA 4FINA 4TLBA 4B33A 1E4YA 4Q66C 1Z47A 4IFEA 3PJRA 1OIXA 2XXAB 4LHWA 1N0WA 4BZPA 3VU9A 2IK8A 5FTNA 1VYTA 2EVWX 2NZJA 3IIMA 3LY5A 4B3FX 2CLCX 2RGDA 3CKLA 1T8UA 4RFVA 4KV9A 4H1VA 1ZINA 4EJSA 1U8AA 4DDWA 1R0YA 5J4HA 4P31A 1OF1A 2HJVA 2O0JA 2YOHA 3AF1A 2I1QA 3KX2A 1ZC3A 1X1SA 4TYNA 4W5WA 2YWEA 2PX3A 2EWVA 2WWIA 1SVOA 5HTKA 2ZI4A 5KOYA 2CXXA 3IBYA 3GCGA 4ZKDA 2XSZA 4TT3D 4KBFA 3T1TA 3JVVA 1OYWA 4X8MA 2OUKA 2W2TA 1AS0A 4ZCMA 2NPFA 1KSHA 1MABA 5CK5A 5J4VA 4NHOA 3U4QB 1T6NA 4TMWA 5FR2A 3UANA 3CPHA
chains in the Genus database with same CATH superfamily
2O48X 5K1ZA 2OCBA 5K8LA 1BKDR 3ZX4A 1YQ9A 3V1YA 1B41A 4J7AA 1EVLA 1ONBA 2ZJ4A 4G84A 4REMA 1GQRA 1N2CB 4WECA 3LXXA 4P2BA 6GPBA 3BIJA 4DB2A 2C7QA 5ALSA 5BMOA 2BM1A 1JTVA 3HFSA 2CUZA 2X15A 3KZOA 5FOWA 3ZH2A 2WE8A 3JZIA 4AMYA 4DIOA 1P1IA 4GEGA 5K05A 3LK6A 3K20A 4GP9A 1ZJYA 4WESB 3TMYA 4PZYA 3QVLA 4G5QA 4EJMA 1FIUA 3PEVA 3EEYA 3Q10A 2GYWA 1NLUA 1UDRA 4HS4A 3LGXA 4OQLA 3VV2A 3LA6A 5CVEA 3T5BA 3VR3A 3CEHA 2OVFA 1Q6ZA 4U9UA 1FBTA 1Z36A 2G71A 3IBGA 4HD8A 1KZHA 3P4XA 4HAIA 5F1OA 1YKSA 1KJ8A 3G2PA 4UDOA 1T4CA 3NO4A 3AL3A 4EMTA 3IGFA 3OH8A 1PIWA 4HQ0A 3CUWA 4NBTA 2FP4A 1NRJB 2JAPA 1P0CA 1OFVA 3FHTA 4PYNA 1SXJE 2BHNA 1F8FA 2J0UA 3V42A 1GZ7A 1K66A 1XTQA 3WLNA 4KXVA 8GPBA 2OZPA 3IJ5A 5FTWA 4K9OA 2VNSA 2OE2A 3EA4A 4PZZA 1QNFA 4QOIA 1E60A 4DQDA 2ZKIA 4ZT7A 5KWSA 1I14A 1N9KA 3CRZA 1HNNA 1E20A 3DZHA 3VVLA 4MYUA 4Y2JA 3B3GA 2R4QA 2BZ1A 5AR1A 4XWWA 1GAJA 3ISVA 3K8ZA 1T0JB 3EZYA 3W1WA 3W05A 3RHFA 3VISA 4AZ0A 4KUGA 1FZTA 1MO3A 2PH7A 4UBMA 1GPNA 2QVYX 3N3BC 2V7GA 3IAUA 4URYR 1A0OA 4RTJA 9MHTA 4ZOLA 4JR1A 4D4MA 3AUYA 3WBBA 2ZVJA 4ZTBA 3ZCVA 1TQ6A 4LV5B 1Y7IA 1VMEA 1K3TA 2P2SA 3AIKA 3WK7A 4C2AA 2G0TA 4COKA 3G49A 2YJ3A 5EA2A 1A9TA 1RE0A 1NE7A 2OCPA 4BTVA 1E2JA 3PV0A 4IDNA 1FNNA 4P35A 3BTUA 1VC2A 3HZHA 3R4VA 3L8DA 4MVJF 4ZHQB 2C96A 3IKLA 4H7PA 4IZ6A 5EGNA 3QE2A 2HZBA 2UXCB 3GPDG 1QYWA 2B2XA 4RVOA 4ABYA 5AW1A 2XKBA 1N8NA 3ZNNA 1J0CA 1ZGJA 3W7BA 2FZWA 5IDXA 4FXPA 3K3PA 1SKMA 1J0XO 4MGZR 3NATA 3PNYA 3O7WA 4NYMR 4JBXA 1EVIA 4QFDA 5B2FA 1UR5A 5LZ7A 3HMQA 3D6AA 4GSKA 4UUNA 4FPXA 3ZI0A 1W1WA 1X86B 3DMDA 4G09A 3WGGA 3ZV7A 1F0PA 3U4MA 4PS1A 2PZEA 1FBNA 2P4EA 4KXMA 1Q21A 2CWDA 2MU1A 3I1YA 3T1NA 5E2IA 3D0RA 3FG9A 2GILA 4JASB 5B1DA 3BA6A 2ZJBA 1A27A 5D84A 3U7IA 4C22A 1KI4A 2IOYA 3HCBA 1GXSA 5M7EA 2BKXA 4XIYA 4JA0A 3U3MA 4F9EA 1CZOA 4PC3A 1EXMA 2ZSKA 1S7CA 2GI4A 3I6YA 4QC2A 2HWXA 1KYXA 4IXMA 4WINA 2XZDA 2ZR8A 4RZQA 2G28A 3KB6A 1VE3A 3S4YA 5JCJD 1QO7A 4M0MA 3G2NA 4ISCA 1T4GA 1E6WA 4ZCLA 1HMPA 1G19A 2FA9A 2ZTUA 1N1MA 4NXNB 5ECGC 2CDNA 1FLAA 3JZDA 4EECA 2DBRA 2IYZA 4FC7A 1P61B 3B1WA 1ZCFA 3H04A 3PC4A 2O20A 3A0UA 4FZ5A 2ZRCA 3AL2A 3CLSC 4TTVA 1DAFA 1FNMA 3DXZA 3NBAA 1H8HD 4EKGA 2EOAA 1PYGA 2Y0DA 1L5GB 1TZBA 3B85A 2OXTA 4JJ4A 1V8BA 3LPCA 1YTLA 2W2LD 1W581 4C30A 1JHVA 3TSWA 1AQYA 5FBLB 4LFAB 3ADDA 1FYFA 2Y1WA 3OQJA 2PVPA 5BSVA 2I76A 2PL9A 3BFJA 2BCGY 4WOJA 3UV6A 1BD4A 3TLJA 3MPOA 3VC1A 4EEZA 1FSPA 1ABFA 3WOHA 3K70D 3AVVA 3W8DA 3MXOA 2IHTA 1N25A 3WLFA 1PUXA 2BFDA 3KKMA 5DN6D 1NJFA 1CVIA 3U3RA 5EN4A 3I61A 2QTVA 3N2NA 4YT4A 1M2GA 1QZUA 1GG9A 2VZ8A 4DKXA 1RAFA 1U0FA 1QP7A 1Z7WA 3K9FC 4JSYA 4H35A 5BR8B 2O05A 1ZGHA 3FOZA 5BUSA 1OWOA 3DEFA 4B1FA 1YB1A 2XIJA 2BT4A 5AK4A 2CLOB 1C29B 1H2EA 1OZHA 2FN8A 2WT4A 3H7AA 2APJA 4E22A 3V8QA 4DY6A 4BWYA 4F2HA 2H59A 4ZALA 2JBAA 4WNAB 3KQYA 2CEKA 3A36A 4UOZA 2I29A 2JFBA 2QUKA 1KK0A 2K87A 4K87A 1JG1A 2Q0SA 3RVQA 4TSFD 2EX4A 4MIEA 3KDPA 4H4EA 2WIKA 5HIIA 2P7IA 4R16A 5TMEA 1PR2A 3WR5A 4N9QA 3CA8A 2O54A 1G20B 1M2OA 5IG2A 4QG7A 5AJYA 3WDLA 4LF6B 4X71A 2GESA 2W2KB 3H7IA 3RSZA 4ALNA 5JH7A 4WLFA 4XFJA 1SXQA 1FDIA 1OIVA 4E1BA 3KEQA 3PUWA 3AEUB 1MPTA 1KVQA 4UTOA 4KIGA 2XVZA 4H0FA 5HEKA 2V7EA 4UUOA 4EIWA 3PVZA 2C8VA 4FS3A 1FW8A 3I04M 1FP4A 4DF3A 1ZHFA 4E3ZA 1NMSA 4X91A 3T41A 1MV5A 1DBVO 2MYPA 5FRDA 3TWOA 5K0LA 5KOHB 3CZ5A 1JKMA 2RGXA 5JHHB 4JP3A 2O3UA 4G5FA 5B3AA 4UTPA 1UMKA 3LE8A 4NQRA 4P4SB 1LVUA 4YMWA 1G2OA 1E89A 5CNMA 2XTZA 2YMQA 5IBRA 3O8QA 3Q8KA 1ECGA 4YIHA 4KXUA 5DI3A 1C7ZA 1KO4A 3I5XA 4JIGA 2CE7A 3VZQA 2JHCA 3SBDA 1ZICA 4Y2YA 5C1IA 3BWCA 1KK2A 3PF9A 1VHDA 5HFNA 5LQAA 1M0SA 5E3HA 5M04A 2MTBA 4YRZA 2EHJA 1SCDA 2PUJA 2BD0A 4M0PA 3S2UA 1JBKA 4CF7A 5ABPA 2DHRA 3MRTA 5HIKA 1E2PA 4H1WA 1QM5A 1PHRA 1WHSB 4MUGA 1DXHA 3A27A 1MZVA 3FNHA 3QUCA 2OQVA 2Q8NA 1CJUC 5EWLA 1UAYA 2IYNA 1ESCA 3HJRA 4M88A 1EGHA 3I72A 2WD9A 1GAWA 3Q2IA 3HYNA 4HDSB 3HKDA 4ZV9A 4N5MA 1T0UA 2H92A 1TMYA 3A4MA 2OUIA 3OCVA 4QJ4A 4DIBA 3ABOB 4DCCA 2VHQA 3O84A 3G8CA 4H1TA 1W5EA 1Z2EA 4HQLA 4MCIA 5DBEX 1T8WA 3S55A 2QW0X 3R0JA 4IRXA 3L04A 2C78A 2I6GA 2VNIA 3L6EA 1M6YA 2Y67A 3RHTA 4D4IA 3GLIB 1OB2A 4TTAA 1JPVA 2PXXA 3I9LA 1HDYA 3RAPR 2EJBA 1K6XA 4AW9A 4W4TA 2HWUA 2EBFX 4XUDA 4LHSA 2X40A 1YRYE 2W6OA 3LFHA 4OG2A 5DLPA 4DEXA 3CH5A 3NH9A 1WXQA 3ZY4A 1MA3A 3NPAA 3HCDA 2O8DB 1RDFA 1DRVA 1NJSA 5LOVB 3A25A 3DT6A 4ZT6A 1CKEA 1K8QA 4W8HA 3T7AA 5FXMA 2NPIA 2UUOA 1O6BA 2RHRA 3R77A 2Y71A 1OI4A 2Z6QA 2XAAA 3G2QA 3LDHA 3A1TA 1SD1A 4FR0A 4NBRA 3OUTA 4WBNF 4ZCTA 4QG3A 1DX9A 4JEIA 1PGPA 3EZXA 3NJ4A 5HXAA 3LIPA 1PX2A 3H5TA 4TUYF 5IARA 1L6IA 1YSCA 4WOPA 2JA1A 4RQTA 3TTXA 2VSFA 1V3TA 1SB9A 1I3CA 4EF4A 2K5UA 2GBLA 4EKEA 1GSIA 4M53A 1ILEA 4MV9A 4A6XA 3ND5A 2CUKA 3FF4A 3Q3IA 4N54A 3JQAB 1TCUA 4RJJA 5HTOA 4DUZB 4QXRA 2QRUA 3GLQA 3LOQA 5EJAA 1EP2B 4CQNA 1UMBA 4TL6A 2EWMA 4ESHA 4JKOA 1D6JA 4U6SA 1OH7A 1W5TA 3L4BC 4BNXA 4L4RA 1XOIA 4ID9A 5A7HA 2JK0A 3GC6A 3KJNA 1F3OA 1V11A 3SLKA 2FSVC 2G1PA 5DH9A 1Y5MA 3D4BA 3E81A 1G6Q1 1D04A 5LQKA 1L8AA 3VHXB 2VF5X 1TKAA 1YUBA 3QF4B 5B4TA 4ZGWA 4Y2UA 5AVYA 2Z04A 1ZY2A 3NBUA 4DC0A 2ZUCA 5KDLA 4C03A 2CN1A 4Q4LA 4C4PA 4QQRA 4YRRA 1Z4KA 3IEMA 2EQBA 1P0MA 2ATEA 1MVNA 3GJ3A 2O9JA 1CE8B 3UGKA 3ZWAA 5KU7A 2B3TA 4PNEA 1YIAA 2W7TA 1EZZA 3U7FB 4LVUA 4PSCA 4WCFC 1PZHA 4AF6A 5HZMA 2I6XA 2FOIA 1Y6GA 2Q3EA 2QG9A 4RZ3A 4BO9A 5HILA 4YRQA 4BKRA 1JVBA 1TIKA 2WSIA 3MMPA 4MMYB 1KIAA 1TD1A 5IBPA 4QA9A 4GXNA 1QV6A 1UDWA 2JJ1D 2F3UA 3G2IA 3R3SA 1U0JA 3IRVA 4NJMB 2IX3A 3GIWA 1XF1A 4C05A 5DX8A 1VJ1A 1K97A 2AMFA 3GO4A 1TYAE 4F6LA 4FOLA 1JIKA 4C0SA 4XQ0A 4BVKA 4KN5A 2IHYA 1XP5A 1U3TA 5DNDA 1FVOA 3AI2A 5KSZA 1NI3A 1SG0A 5L53A 1MAAA 3X1XA 3I23A 4NBSA 1NUPA 1O6CA 1ZRNA 2ONCA 3CTPA 4H9GA 1IEWA 1V26A 1W76A 3FMPB 2F1JA 1FPMA 1I7SB 4Q7KA 3ZWKA 4HB0A 2Z9DA 4LC9A 8ATCA 1QLHA 4RQUA 6PFKA 1HM5A 3RJ5A 1K92A 3M6AA 1PJ3A 3WYDA 5JMOA 2PUTA 3LLVA 3CKMA 2V9CA 2GBGA 4PBSA 1GUAA 4MR9B 4AKGA 3IOEA 3N58A 4YCNA 3L6UA 2FEXA 1T2CA 2FFBA 3QPWA 2D7JA 4MR8A 2QVXX 5T6MA 2G0AA 3ZW9A 4BB6A 3FE2A 2JF0A 3EEQA 1CRLA 4XA8A 3F2IA 2P4UA 1PJLA 4OOFA 4Y98A 3UK7A 2VJDA 4KO3S 1JIXA 5IVIA 3AJDA 3EAQA 4J7UA 4DWJA 2OHIA 4GLJA 3GQVA 3W5SA 4P82A 2I67A 2N46A 2QG6A 3LUHA 1JVNA 2G67A 1R88A 3S5UA 1Q84A 2GVNA 4JY7A 1EYZA 1XZAA 4RO0A 5I5GA 3MLEA 3PJEA 3V4LA 1XRMA 3HSSA 1ULSA 1UWVA 2P7HA 4I81A 3ACDA 4HR7A 3OFNA 3EFEA 5HX7A 1GR0A 3DBIA 1NWCA 4JLJA 2ZBUA 4IICA 3KM0A 1Y8QA 3K9GA 4MVYA 1O94A 3CO0S 3RAFC 1X8JA 1KJYA 5JV5A 2XRZA 2PX2A 3GGDA 4DSTA 1TZCA 3JAWA 4FKBA 4LOIA 3S1LA 1DBPA 1LNZA 3ADKA 2H3EA 4L72A 4RXUA 1NV9A 2WFLA 4RJ2A 1DAHA 1V45E 4XLLA 3TOSA 5JS1A 1GCIA 1BFDA 1N3BA 2A5GA 3CX8A 5AI8A 3IUBA 3G5TA 2R1TA 3DL7A 3CVWA 3VH4A 1ZPDA 2FSFA 2EZ8A 4MAFA 3O73A 1RLMA 3KJQA 3KPYA 3VTFA 1WKVA 1QUEA 3PUJA 2AFIA 3JYNA 1GSAA 1PT6A 5EUCA 1Y48E 4U7PB 3RTDA 4C21A 3L1HA 3QV2A 3ID6C 4TV8A 4F45A 5IAAA 3KHKA 4L4XA 5JS6A 2DXIA 1AUVA 1GUZA 1XTKA 4B5KA 5BN4B 1S9HA 4CTNA 1W88A 1WMBA 1Z37A 4HOYA 3WKAA 2J9ZB 4UM5A 1PHPA 4R1OA 4CV0A 2REBA 2QP4A 1P8AA 4Q9HA 5ADHA 3L8HA 2BOVA 1U2TA 3ZWPA 1W85A 3WK5A 3DDCA 4D02A 3F3KA 3MMXA 1FSSA 1QGAA 1ZWLA 2PEZA 3D5TA 3QFCA 4LK3A 3SLGA 4ASUD 3GLFA 3A4VA 5ALGA 2PHZA 4HX9A 2A5YB 5JD5A 4BCBA 3M4ZA 4LRUA 3VO2A 5C1OA 2CFIA 4I3GA 5GWXA 4WKBA 4PQRA 3HWRA 1PQ4A 1A3CA 1WU8A 3FKQA 4B3BA 1ONPA 2WA2A 4IDGA 2GT1A 2J5KA 5L3ZA 3KETA 1EMDA 4KXFB 1Y8ZA 5BN3A 1K86A 3D0OA 4BASA 1PV2A 3NEAA 5GONF 2JHGA 2NU8A 2EV9A 5I4IA 1UH5A 2HCFA 2ZBVA 2BFBA 2PUGA 3WNDA 3OFVA 3L5OA 4JHXA 5AP9A 4P32A 2YDXA 1F5NA 3OT1B 3C48A 5DULA 5CD1A 2F4VB 1RMQA 1K8ZB 5IMBA 4KGDA 4QAQA 3KSAC 4FMPA 5C8VA 5I3CA 1I7DA 5K6AA 1E2FA 1IK4A 1CJKC 1SB8A 2C7GA 3LUJA 1G60A 2C07A 2DFLA 4HXGA 2V7UA 1T5IA 2ZZNA 3FYHA 4MJ3A 4Z99A 3GARA 1CK4A 4CR8A 4ICIA 4D4GA 3OO1A 1Q19A 4XASA 2BUCA 3CF2A 5IT9A 1U98A 1YL7A 1W47A 4U2BA 3BBLA 4LXYA 1QH8B 2JFUA 1FZQA 5KKAA 3VDRA 1L7PA 2WU0A 4RTRA 5AW3A 2QNRA 3RUFA 2BDTA 2YRFA 3WB1A 2ACVA 4RUKA 3CLTC 3RUEA 1ZMOA 2XCIA 5SZJA 4HDKB 2H51A 2OHHA 3IERA 5BURA 1Y3BE 2OOSA 4HXFB 4GDFA 3KPJA 3R3ZA 3BULA 5GOTA 3WGVA 5ICEA 4MUNA 2YV1A 4G5SA 1HTWA 1KYTA 1T3ZA 1WBDA 1Q7EA 1JFRA 1H0SA 4DQUA 1NJ2A 3A7EA 5F3RA 4NCHA 2FN3A 3CV3A 4HVAA 2GEVA 3F90A 3R2JA 1ZESA 3MAAC 3PUZA 1H22A 4IEFB 4AKEA 3V4FA 4IKPA 3I39X 4FFOA 1JEOA 2A78A 2HNAA 2WIAA 2H4XA 3EGWA 3RVKA 3GAMA 4HG2A 3DGFC 4QTUB 1C1XB 2C1ZA 3VTAA 1USGA 3V8MA 5IHPA 2PIDA 3TG8A 3R9WA 4ZRDA 4R1NA 1CRPA 1BZYA 1RM5A 2ZT7A 1RWNA 4GT1A 1BH2A 3GLGA 4N49A 2YZNA 2MYNA 1MOQA 5DV9A 2C8LA 4D9GA 4QU0A 3HFJA 1PR5A 2Z5FA 2A92A 5A02A 2ZJ5A 4AG5A 3NANA 3OZVA 1NBEA 4KXYA 4RLFA 5IJXA 2NSYA 3VNBA 2JLSA 4DCNA 2HLHA 4E5KA 4EW2A 2WJ6A 3D1LA 3NHSA 4OP1A 4V0RA 2YC2C 4A6PA 2QRNA 1JYFA 4W7IA 5CB4A 4A0SA 5C8DA 5ITZA 2PUAA 3SN6A 3O8RA 3HDTA 3HZOA 4PAQA 2XB2A 2NT3A 2YJ5A 4P9NA 4OP3A 2ZUBA 1KY5A 1BJTA 3QX7A 1Z0SA 5H4HA 2HIAA 1L7BA 3NHWA 1KXJA 1V6SA 2YL2A 2ENUA 3CF0A 4MGKR 3WRXC 4F1KA 5LFAA 1MC4A 4U7GA 1XQ1A 4HNRA 4W1QA 1M73E 1JA9A 3OEED 4C6SA 2X77A 1D5WA 2OFPA 3E53A 4FUTA 5L3SB 5TVKA 4IS2A 5AK0A 2HIMA 2CK3A 4REQA 2WZQA 2UVPA 5E6UA 1HQKA 4BVLA 2OV8A 2CXUA 4NPCA 1JFVA 3I6BA 4AWAA 4BFWA 1H5UA 1WXWA 5HZKA 4XYBA 3DKIA 5EXEA 3ZOKA 4YT5A 3KTAB 5ALTA 4WKOA 3PQ7A 1DUSA 5DBIA 1AS3A 4KX3A 4WLOA 5G0WA 4C1BA 3M49A 1AKUA 2TS1A 4OQ4A 4XSGA 1P9NA 3WGKA 2NYRA 4ZREA 1CUSA 4US2R 3N0RA 4RDCA 3A4IA 3P9ZA 2XEDA 3W4IA 5TT0A 2J3IA 1G4AE 4KI7A 2DFPA 4M1QA 1U2GC 5B7GA 2WUVA 4ZZ0A 5DFAA 4ZP1A 3OQBA 5EHNA 2I7CA 3JQPA 3RJMA 1V4VA 3LLSA 1FTYA 5EP4A 4LOAA 1MB3A 2JL1A 5JNSA 1QHXA 3F5FA 2A7XA 3IT1A 2AZ4A 3ESYA 4NEQA 1HT0A 1T34A 2PQ6A 4GPIB 5H80A 3NBQA 5JY6A 1UP7A 2QUJA 1F2DA 1T3GA 2VAWA 4UNPA 3DAYA 1WKCA 2BMFA 4EHIA 4ZJPA 3GUHA 3DZKA 4PLFA 5K0CA 1SIOA 4UUMA 1QG4A 4G9BA 5IPFA 5HE8A 1JEJA 2WF5A 3VOBA 3U81A 2DGDA 4MPTA 2DBQA 1SULA 2IDZA 1QQ7A 1YT5A 2VYCA 2Y9MB 3BEDA 3E0XA 4HWKA 2X2FA 1N6RA 1TI7A 1NRIA 4I55B 5FQOA 3T9FA 1US8B 3TIFA 5I4KA 2PE5A 4JQZA 4K05A 3DHYA 2XCSB 3DMPA 4BPRA 1ZJJA 1T36B 3LUDA 1LKZA 2D5LA 1ZI9A 4B8WA 1Z6TA 1U8YA 2DHCA 2GHTA 2J3QA 4I9UA 1L1RA 1OI3A 3B53X 3CWQA 5M29A 5BSWA 4WGGA 4XWAA 4YONB 3ITEA 4GKKB 3DEIA 1TJPB 4GWLA 2W6JD 5IFLA 3HWWA 5I7UA 2WWXA 3PYLA 4B3MB 1N3YA 1WNFA 2NSHA 5CB0A 4LY3A 5JIBA 2OFXA 2HXSA 3BHMA 1D4ZA 1R2QA 4R2JA 2XGJA 1R0XA 3DMFA 1NN5A 5KNCH 4C5BA 1KL7A 3N5CA 5AIAA 5FLYA 5B36A 3G88A 2YRWA 5A4IS 1QHHA 2AI3A 2ODAA 3F6YA 3P4YA 4RC9A 4AG3A 4EFNA 5EZQA 2XYQA 4E70A 1KYIA 1VBKA 1XFDA 1LBQA 2WIDA 3KYJB 1UBJS 5DU2A 4EH1A 5ALQA 1IVSA 4HN9A 4BN0A 4HWGA 1J24A 2EIHA 1CETA 1KOJA 1ZONA 1MJNA 1U3FA 3T12A 1I2DA 4R8SA 4ANFA 3NETA 3ABSB 1CUDA 3A2KA 3EXFA 1NNUA 2IFTA 1C7QA 2YOFA 3ICCA 3M9LA 4DLNA 4DOMA 1YU6A 3TOCA 1EUYA 1N2OA 5FTJA 2FW9A 2DUWA 1M8GA 1IZ7A 4IGKA 1OIWA 4CQLA 2IZ7A 1F4VA 3BORA 1CZUA 4HGPA 5D3MA 5BVGA 2AOTB 1NP7A 4L9AA 2VTBA 4X3OA 4NMXB 4RSHA 5CTAA 1P5RA 4KTVE 4OHUA 5JAMA 2D6FA 3AUKA 5A04A 1JAHA 2H1VA 3VR2D 3CUVA 4GKBA 2AJTA 1XQ6A 3WJAA 2Q45A 3ICVA 2FI1A 3K0AA 4M86A 3IUQA 2R96A 1FUYB 2HPVA 2PR7A 4HQ6A 3T9BA 3MTGA 1AN9A 1NMEA 2B78A 2O6HA 3IQDB 1DIRA 3SYKA 1UIRA 2BPOA 3IR5A 2HQBA 3K1ZA 4PW0A 3IDQA 5J40A 1VLLA 1VIYA 5EZ5A 4R8KA 2ZDQA 4IBOA 4K7JA 3DUFB 1TF5A 3I73A 4K3UA 4DLVA 4R9RA 3MERA 3R9XB 2H1OA 2QDKA 3GFOA 2PT6A 5IVKA 2NO5A 4DLWA 4MOWA 3U17A 5JS8A 5L4SA 3NHMA 1F2VA 1RHUA 3CCBA 2RKBA 3TSCA 4IMRA 2WEKA 5A3RA 4C0KA 4RY2A 1Z8HA 3KSBC 2V7PA 4WXEA 2AMJA 4JXXA 2B6HA 2QTLA 4MHOA 1G5TA 2ZJFA 1J5EB 3OOYA 3LUKA 1SXJB 4I19A 1GZUA 3PXUA 4ECEA 2HSWA 4HGNA 3W2HA 1P5ZB 2H1RA 4PICA 4EBBA 2BF4A 2C1EA 3GRCA 4I46A 2Q7DA 3E3LA 4HZUB 4N65A 4IX9A 5ALLA 3ZHCA 3TXYA 3A11A 2PA3A 5HKAA 2ZBEA 1CEXA 2R5NA 3RTBA 3VPFA 4BX9A 1PZMA 1ZMXA 2VRNA 3KOWA 1DQPA 5SYMA 1Y5LA 2YJTD 3UWMA 1Q83A 4IXWA 5AW2A 3G6WA 3VDQA 1AZLA 2V1UA 2EBHX 3MCUA 2B5VA 3EOBI 2NMVA 1XZQA 2D1YA 1SEVA 3E4DA 3QY0A 1RQGA 1XK6A 3KVOA 4UHHA 4EG6A 2WHPB 1L7MA 4OY3A 3SXUB 1VMDA 3PRJA 4L6AA 3UM9A 1JALA 4RQBA 4E4TA 3S28A 3D2CA 4ER7A 1UBFA 4FLEA 2B8EA 4GYWA 1PG0A 2A8YA 2FKNA 4ZK6A 5M5BA 1FLDA 2Z8YA 1NLYA 3E5MA 1A4RA 4NENB 4WXMA 2EU8A 4ZEXA 3SEAA 3ZQKA 3E9ZA 1X7WA 2BHRA 1PBTA 4M1OA 1YDFA 4UEOA 1FYEA 1JNYA 2BMWA 4HAYA 5F4ZA 5I9NA 3FOEC 3UUWA 5BO5A 3P9KA 1OC2A 4NK4A 4EJ0A 5A62A 1E7SA 2HL6A 2J5XA 2ZR7A 1YK1A 3IV7A 1MJ5A 1QVRA 2O1EA 1Z0FA 3NT2A 4LVCA 3TSAA 5FBZA 5TE9A 4GE0A 1IJEA 3VX3A 3AJ9A 1IXRC 4M8KA 5JD6A 1ECPA 2UZ0A 3M1AA 2EL9A 3WMWA 4YIKA 2H0QA 1H3EA 1YZHA 3DXFA 3UV3A 4D9FA 4L4SA 1UMCA 2C5EA 1W94A 1O94C 3H17A 3LJKA 4B74A 1M1YE 3NI2A 2RAFA 1XXHA 1E3MA 4ZQBA 1Z4MA 2FG5A 2VFAA 4HH3C 4P0QB 4XTRA 4YMIA 5FAXA 3WIOA 4Z5XA 3QI7A 2GWHA 3IUJA 3RIEA 1E6UA 1GY8A 3EFOB 5KYVA 1NFQA 1QHIA 1RJWA 1SVWA 1JQBA 2P2YA 1TLLA 3KHTA 4WOKA 3H9BA 4M89A 3SY8A 3ZY5A 4P4NA 1LBIA 2E87A 2YW9A 1NJ6A 2RGGA 2W71A 2I33A 3G2JA 4OHRA 3C16C 1IH8A 3CRNA 1TW2A 4ZYZA 5A9TA 3RSGA 2HLDD 3CF4G 1KAGA 1RRFA 1OROA 2P2ZA 5FOSA 4I0WB 3CSDA 2DQSA 4PC7A 1XX6A 3KJHA 4U63A 2EAUA 1V2HE 3P0FA 5KOIA 2ZDHA 4Q3NA 4RTSA 3OWXA 4R1MA 2ADOA 1N5IA 2AXPA 1ENYA 3AFMA 3E58A 4LWOA 3RUPA 4IY1A 1G8AA 3JPYA 1TM4E 2AUTA 5H4GA 1IBKB 3E27A 2HD4A 3A2NA 3R3WA 1GDHA 4QBKA 4ZANA 5CIWA 4ZHQF 2B9VA 1GLGA 2RGAA 4ZVOA 1AGXA 1O77A 2FP3A 2OVBA 1D7OA 1OX4B 4DCVA 4KB5A 3FNFA 4YDSA 3ER8A 1Z39A 4QYSA 2RHDA 5DGDA 4LNUB 1ORWA 4TKMA 4RETA 2HY7A 2GNOA 3DNPA 2PX6A 4DWOA 3DQPA 3EPRA 5LXTB 1K7YA 2FB9A 3D02A 1W44A 3TLZA 4ZZ3A 1IM2A 4KPYA 1EHYA 2Q3DA 3BWXA 3O2QB 3ORQA 4DC1A 3I8OA 1PK7A 3TRDA 1DINA 4ZDJA 3U4QA 1LUAA 5EXPA 3K4PA 2X14A 1YNSA 2PZGA 2QENA 4BFVA 1MG0A 1KK1A 2C59A 1FJHA 1BFKA 2GPYA 3OZCA 2O2JA 1KZ6A 5T8KC 2QKYA 3T15A 4CKWA 1T4MA 4ERNA 1JFFA 2O8FB 3GCWA 3JQ8B 1K8RA 2VDVE 4R2WA 1LF5A 4KMMA 5JWHA 3MBOA 3RVMA 3V8NA 2IDMA 4PGFA 3ZN2A 4BXOB 1R6DA 4DLAA 4IDDA 3QFHA 4QJBA 1ZISA 1Z8DA 2GXUA 5F7JA 3RYIB 4XB1A 3WBKA 4BV8A 2J45A 3Q9SA 3ZVNA 4JKYA 3EHEA 2HJSA 2OG2A 1XU7A 2ZYGA 1IN7A 4AG6A 1J06A 2IYTA 2FRVA 3DPSA 3EVCA 1QG6A 2P5UA 3OQPA 1NXVA 4AC9A 5FUWA 1L4UA 5A3SA 4YJ3B 1NQWA 4L8WB 4DM3A 3K32A 1HQYE 2GHQA 4JJIA 1K0UA 3VZSA 4FCTA 2BW0A 4DJFC 4Q48A 1C0EA 1H8ED 2VRWA 2JKVA 2IDKA 4X84A 1Y1SA 1K6EA 5ITWA 4PN3A 5G4KA 2HUNA 2AI2A 1DFGA 2AUMA 3C6ZA 3E9QA 3LX5A 4XB2A 3W6NA 4UM9B 1PZNA 5ECWA 2RIRA 5EIBD 4CQJA 8OHMA 4MEAA 4DUYB 4KO4S 3U4CA 4AMZA 1P1KA 1JFSA 4J94A 2WM2A 3L0SA 5EESA 1E7MA 4NH0A 4DLXA 2NU6A 4PM4A 2AIRA 2LIVA 2XJ4A 4KX5A 4HBZA 4KRGA 4FD2A 1BA2A 4LJ4A 5DRYA 1AZSC 2QUAA 4FHGA 2GJ4A 4I7EA 1NW5A 3PHCA 1G21E 4GWKA 2GBPA 3ZE6A 1IBCA 4KMSA 5K2OA 1QLJA 1X8LA 3HR7A 4HQOA 4UNNA 3ZXYA 4CUZA 1VLZA 2AFHA 1HL7A 1L8XA 1XEWX 2QSJA 2Y1DA 4Q4JB 1CQWA 2G8NA 5FKJA 1MD9A 2CMFA 4YRKA 1KI6A 2QWXA 3V8PA 3S8YA 2PTHA 4FKZA 4QRHA 3U6KA 1PWHA 4LTDA 4DNQA 2H9YA 5JXHA 5KINB 3C3KA 2F9LA 4Q4CA 4JEUA 2C2GA 4XARA 4V2UA 3G9ZA 1JZTA 1H4TA 1TK2A 1YUNA 4F0JA 4ZCRA 1NBME 1Z3IX 3WHIA 1IC6A 1AKYA 2D00A 3CUKA 5FI1B 1Z22A 3L1JA 3OOSA 3UXMA 1E7QA 4UNRA 3F78A 1C9KA 1IE3A 5FPQA 2H52A 1HDCA 3KKOA 1QK5A 3KYBA 3SMQA 3T1OA 1FFHA 1EXWA 1KFEB 1XXLA 2JI9A 4RD4A 5HIMA 3KPVA 7MDHA 1B3BA 2HU2A 4EHAA 1JEDA 1XO1A 3GMTA 1LJLA 4U2KA 3TLYA 1ZHHA 4H7FA 4RFSA 2X6RA 3ENQA 4UUAA 5F4BA 5TT1A 3QBTA 4OM8A 3MUFA 2DTEA 3RVJA 4DHWA 1QTQA 2AXEA 2CFRA 1Z0DA 1Q7GA 2CJXA 4FC6A 4RORA 3DCNA 3GGSA 2H2FA 3P9RA 4MA5A 1ZLYA 5IZCA 4DUGA 2IZZA 5JJ5A 4UEJA 1XCOA 4LGCA 5CEJA 2RK4A 4R6WA 3B6MA 3CISA 3T3GA 3DC7A 4C07A 4CBVA 2ZYTX 3PYMA 2GOYA 3I6ZA 1VE7A 1OU4A 1DCFA 2HRZA 4WXYB 2WYWA 4FMCB 3BL6A 4G0XA 3CNOA 2IPNA 3R9KA 3WLMA 1NMQA 1Y81A 1F9EA 4LXIA 4YRLA 1LQ2A 3WNZA 4DT1A 1D7AA 4XM2A 2H31A 4X24A 1I2AA 1SKBA 3PIIA 1JJIA 1QE0A 1SUCA 4IVNA 4LA4A 3K09C 1BVUA 4HEHA 4WBXC 5A6SB 4B3RB 4R8MA 2OESA 2OBBA 3OPQA 1ZRHA 3E8MA 3L6CA 4UBLA 2B3DA 4BO4A 5EJ5A 4D25A 1YA6A 2XVXA 2AXNA 3M7IA 3DO5A 5BSGA 1KI1A 5BV7A 5FWXA 1SK9A 2IXDA 4J4BA 1HYHA 3X2EA 4DR2B 4IJ6A 4G5GA 3E70C 3GJZA 3GUVA 5LUBA 1LDMA 1QZ3A 1KJIA 1T2DA 3DW3X 3OZAA 4TKZA 3V46A 4MR7A 1CR1A 1JL3A 3U48A 3QK7A 3VZBA 1YB5A 2GPNA 3UK2A 1RXIA 4W5RA 2EJVA 2IH4A 1QC5A 3UT5A 3I5UA 3G1TA 2AYYA 2ZRGA 3BIWA 3TD2A 2PGDA 1EDDA 1HK7A 4TS4A 2MR6A 3P9YA 4V24A 1XHLA 2HA2A 13PKA 1N7JA 1LI5A 1YBFA 2IXGA 3IQXA 1NDUA 4O08A 4AKIA 4CF3A 2WI8A 1TVKA 1FVHA 2AVNA 1L7NA 1K63A 1POXA 1W48A 1Z4OA 2WFMA 5JBQA 1QIGA 2IEZA 5EWJB 5LYJF 1SUSA 4QATA 3BMCB 5H59A 4RCZA 3TO5A 1PR9A 2PCJA 1ZD1A 1BQ3A 2X0JA 4Z1MD 3MJHA 5LA6A 5FWDA 1X0VA 3G0BA 1T5HX 5CVVA 5FNVB 3WQHA 3BILA 4YI3A 3W6PA 3OLCX 3RSQA 1Y3CE 1QB8A 5IANA 3IA2A 1AKWA 2J9FA 3QIAA 3FNQA 5CPBA 2WK1A 2WYOA 2WWYA 2XYGA 2BGKA 1LZKA 1P6QA 2R48A 3OUUA 4QYWA 3NJRA 5JDIA 1LDEA 1U80A 2KLHA 3KPWA 5C1PA 5LOVF 3AV3A 4JCCA 3GRUA 2PD3A 1OGIA 1XU4A 2O06A 2X0RA 3JVDA 3P2JA 3WLAA 3BCHA 2UZ3A 4OBWA 1RC8A 2H7VA 4K1LA 4D0LB 1CJTC 1DV2A 4Y9UA 5FBWB 3ZU3A 1Z6QA 4DNPA 1U7XA 4LHEA 2E21A 1E1QA 3JQ9A 2VJCA 1Z8FA 2PXAA 1XCMA 5CA0B 4JIMA 5D7NA 4E3WA 2ZI5A 3QKIA 1YNOA 4EO9A 1ODKA 3ASUA 3FPEA 5EAIA 3B8HA 4RJLA 4AJKA 3L7NA 4ND6A 4F71A 4DCOA 4M1YA 1CLUA 4UXHA 4MO2A 1O0SA 4MDEA 3V1UA 2Q7OE 2JLAA 3UPDA 2A9QA 4U39A 3T54A 2JJ2D 2WHQA 2QRVA 1CS0A 3J81k 1E5XA 4LUCA 5KQRA 3UYKA 4LF8B 1UJ6A 3KJXA 4PHCA 1FFXA 4YAEA 4C7KA 1GPLA 4Z9YA 4KZPA 2UAGA 2UYYA 1DKOA 1P77A 3AI7A 4QRDA 5ALUA 3WLIA 5TQJA 3IUNA 3PNQA 2NZ8A 3EG5A 2ATIA 2ZXEA 2BMVA 2C4TA 3K0CC 4M1KA 3H42B 2DFKB 4EG0A 4RTNA 2A30A 2O1SA 1KPIA 2IYWA 2HWKA 3PWTA 2ZJZA 1LSUA 5AXAA 4J0HA 1E1RD 2AMVA 3ZDYB 4DDMA 2VAPA 4YP5A 5YASA 1OPRA 4PSUA 2WTXA 2ZBGA 4UE3S 3VR1A 4MQBA 3K6SA 3WA7A 2J4FA 2C83A 4BDSA 2JIZA 4QASA 5KOJB 1CY7A 1P7VA 3TNDA 2X2PA 3FHCB 3M6IA 4BO2A 1QOPB 2GEFA 2RONA 4RM2A 1E5DA 1K6IA 1H2YA 1WKBA 4JYAB 3O3OB 2FV8A 3W2FA 2VJQA 5EIAA 3L8YA 4KMRA 2XR1A 2L0XA 3T7CA 3AG6A 1O96A 3H3XA 1RACA 2HUPA 4UXIA 2FEPA 2WWTA 2ZSIA 1E5VA 5AOVA 2VWGA 2VOJA 3QTLA 3FPCA 2W93A 2C3YA 4IAOA 4B3GA 1D8TA 1PQWA 1Z38A 3PTZA 5C37A 5ESWA 5A1TA 1VJGA 4P84A 1LXCA 1ZIOA 3A6EA 4ND8A 2H9AA 2ZVDA 4B6JA 4C3UA 2QPTA 4PQFA 4ZO9A 3X44A 4Z4IA 1YQXA 3R76A 1CY8A 5AD1A 2NLOA 1YDMA 1NW9B 3KXPA 4J0KA 2BF7A 2HT1A 4EJFA 1XMXA 1G6OA 4R2KA 4E51A