2NZJA

The crystal structure of rem1 in complex with gdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
171
structure length
155
Chain Sequence
MALYRVVLLGDPGVGKTSLASLFAGKHEQLGEDVYERTLTVDGEDTTLVVVDTWSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of REM1 in complex with GDP
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTP-binding protein REM 1
total genus 52
structure length 155
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nzjA00
2AD1A 2GCOA 2JLZA 4IDHA 3UXMA 3VAAA 4AWXA 4NCKA 4CRWB 4O3MA 3I73A 5DIFA 2CCKA 3NBFA 1X3SA 2DWQA 5KDDA 1CR1A 3B1ZA 4YXWA 4XIGS 2C8VA 1XU4A 1KO8A 1ZD1A 2C03A 4BECA 4GDFA 2OBNA 5TDHA 2J7PD 3H2YA 1S4QA 5JJLA 2NGRA 1VCNA 4QBHA 2QQ0A 4AKEA 2ZRGA 3H84A 3B8HA 5BYKA 2O0KA 2IYZA 1HT2E 1PLJA 2QPOA 2QY9A 2ZUCA 1Z22A 3KXIA 3QNUA 5D3MB 2Y8EA 1GSIA 1NBMD 1SXJC 4L15A 1BKDR 4ZIRA 3O8DA 4IXNA 4MRRA 2ZQ5A 3PVSA 4AC9A 3GP8A 1AGPA 5LB4A 3U44B 1NG9A 3OIYA 4AI6A 3GLHE 1OYWA 2CL6X 3A1UA 4QGHA 2WPDA 2O8CA 3KX2A 2ZJYA 2FEOA 2IWHA 2PJRA 1YKSA 5FFMA 3SQWA 5FOSA 2ERYA 4TL8A 2V55B 4KLNA 3NVAA 2IS6A 1Z08A 1NN5A 1W0JA 1UKZA 5DI3A 4EJSB 4TQUS 3QF7A 3L8ZA 4PQFA 3NWJA 1KYIA 1J2JA 3W6PA 4CEHB 1R0WA 5FUWA 3TAHA 1XD2B 3RS7A 1RPZA 2VP2A 1NNEA 3B9QA 2KI5A 3F0TA 1EWRA 1WRBA 4OQNA 3R9IA 1KZGB 1ESMA 1E98A 2Q3HA 2ZANA 2W00A 2BBOA 2ZE5A 3ASZA 2AX4A 2W2TA 4NMMA 5E7IA 4H9GA 4HATA 2BV3A 5DN6D 5JJKA 5K8UA 2WPDD 2ZJ8A 1KDOA 4DDUA 4OQLA 4TLAA 4RFSA 4RZ3A 4BPBA 4U5XA 3HR7A 4AYTA 1S96A 1WE2A 4I81A 4TMXA 5CJPA 2QP4A 1ELOA 1GKYA 4OI4A 4XOIA 1BIFA 2C78A 4IKEA 5DI9A 3RNLA 3RWMB 1Q20A 4Q1DA 5H68A 3SHWA 3SYNA 3VNVA 1OFIA 2YKGA 1UFQA 4M22A 2JLXA 1F5NA 3JZMA 3T34A 3MWLA 1XBTA 2RHDA 4IDPA 3LBNA 2AKYA 4II7A 4NYJQ 3VX3A 2CL0X 2JJ2A 3K0FA 3AB3A 4M9ZA 4B3XA 3BFXA 3KKNA 1KY3A 4ZI2A 2H18A 2C9YA 4DHEA 2NPIA 3SS8A 4NCHA 4YXWD 1OXTA 3CNLA 4FMCB 4MYUA 3B9PA 2VRWA 2O8CB 1E2GA 4ZKEA 1O87A 5BN4A 2EFDB 1Z8FA 1FUUA 1K6MA 3ZVNA 1XB2A 2VYFA 2ZSBA 1G9XA 2VP0A 2V7QA 2XITA 2ZSAA 4RD6A 4QM6A 1X8KA 4Q4HA 2HT6A 3KTAA 1GIAA 3NEJA 1JJ7A 1KJWA 1CTQA 2P5TB 1KSGA 3A8TA 2B92A 3WBKA 2V1UA 3CPHA 3VR4A 1GG2A 5ANRB 4GPTA 5FBRB 3BGWA 3CKLA 3SBDA 1IY1A 2FSIA 4NHOA 2F3TA 4RZUA 4YLGA 2CVFA 3L2OB 2R6CA 3MWJA 4K8OA 2ZJOA 5JLJA 3ADCA 2QE7A 4LHVA 2XOKD 5F98A 5FI1B 1TL7C 3SHFA 4DLUA 1K5GA 5EXTA 1OB2A 2EU8A 2QNRA 4TQ9A 1M74A 1Z06A 2HCBA 2A5DA 5KYKA 2YWGA 1KTVA 1TX4B 3V4FA 2WWFA 2LWIA 1WBDA 4RSGA 2H1LA 1UKVY 1ZAKA 3P1JA 5A5GA 2JLWA 4B3GA 1OXSC 1E0AA 4TT3A 2QRNA 3SOPA 2ZROA 3ZS8A 4PO1A 1ETUA 2QPAA 4OK3A 3U7FB 4DCSA 4QXAA 4KVGA 4PC7A 4QL3A 3LBIA 2FE4A 1JAHA 1CXZA 3CX7A 3IDQA 3K09C 3N70A 4JYCA 4Q1FA 4A0GA 1DELA 1LF0A 3PCRB 1E1RA 1BH2A 4US1R 1KO4A 3B1WA 1NMZA 2I1QA 1RRFA 4FWIB 4B6FA 2BCGY 4U02A 5FBLB 3R8FA 1XD9A 1E2HA 1Q44A 1CU1A 2W6IA 1N2CE 4LDJA 2J41A 4ASUD 3EPJA 4ACBA 1RYHA 2FSGA 4ZKDA 3GMTA 1TF5A 3CF6R 1P3JA 2PZEA 5DHAA 1RKBA 1W2GA 4AIIA 3EIQA 4S35A 2HCJB 1FP6A 4DDTA 3THWA 2YINC 2BEKA 4TTPA 3L43A 4MGZR 1DO2A 1J90A 1P9NA 2BJVA 4OQFA 2HYIC 4V0OA 4A8JA 2VO1A 2EQBA 3M1IA 1OYYA 4Q4JB 3WHLA 4TYNA 4NKRA 4D4LA 2HEIA 4C2UA 2AK3A 2DR3A 2QROA 2QM7A 3ADBA 2QM8A 2WAXA 2VBCA 1P2TA 3B1XA 4LCBA 1PZNA 3OEHA 4Q1EA 1W47A 2ODNA 4TMZA 5AUOB 3C16C 1YR8A 4ESHA 1NN3A 4M8NE 4G3XA 3L0PA 4KJZA 3SFZA 1CP2A 1E9EA 3P20A 4PANA 4NE2A 1US8B 2GZDA 2ZI6A 5FR1A 1YR6A 1GFIA 2OT3B 2ZI5A 2ZI9A 1G21E 1CRQA 4QGAA 3B1VA 4NTZA 2X2EA 2GF9A 4C0JA 4DDWA 4BWYA 1IHUA 2NZ8A 2OLKA 2VSXA 1SKYB 1UADA 2GETA 4HYYA 5DSZA 2P6NA 4MGYR 2H8KA 4HDOB 3K8YA 2QAGA 4JYBA 4KYUA 4Z8XA 3N2IA 3I1FA 5IK2A 4ABYA 3CIOA 3IHLA 4Z1MA 3EIEA 2FZ4A 1J70A 2RGCA 3PFIA 2XSZA 4R2IA 5DHFA 2B8WA 4XVQA 1SQ5A 1Y3AA 3LAWA 1Z29A 2VHQA 3B78A 3QXXA 4PHGA 3GLGA 1YZKA 4HB2A 1OJLA 5TB5A 1W36B 3C5HA 5LDDC 2PCJA 2FFQA 5SZKB 3C41J 4DVGA 3BD9A 3WNDA 1SVWA 2FFAA 3U3JA 3AUXA 4PC2A 1GOTA 2N1BA 1Z0FA 1VYTA 3LW8A 3AP2A 3B85A 1R8SA 1TF7A 1ZM3A 4BZQA 3KQHA 2QG6A 4KI0A 1QHYA 1E1RD 5G40A 1AGRA 2OFOA 1LS1A 2F1HA 4QC2A 3THXB 4E03A 1W46A 2JCSA 5E3HA 1KJYA 1SVMA 1N6NA 1YZLA 3K1JA 4LJAA 3K9GA 4Q47A 3O47A 4AK9A 1ZC3A 3V00A 2ZRMA 1C4OA 1HA3A 4HLUA 2HF8A 1ZUHA 5KOYA 3ADDA 4A0HA 3U7GA 5DE3A 4AYWA 1N0UA 3DPUA 1E2DA 1SVKA 2EFHB 4B6EA 1DAGA 4V02A 2JGNA 2Z6VA 1ANKA 1JPJA 3B1YA 3NEYA 4P33A 2ZE7A 3AVUA 2NG1A 5CYPA 2GAOA 1IM2A 4V0MA 1DOAA 2IYQA 1COWA 3AF4A 4M1OA 2BMJA 4P4SB 4KXFB 1CULC 1VG1A 2YNMA 4TLBA 2LKCA 1XMJA 1N6OA 3QUSA 4K46A 1OHHA 5L3RA 5EE0A 3AVQA 4M9QA 5DN6A 5HKKD 2NZJA 2GTPA 4Q7JB 3UG7A 4CEJA 3FMOB 1U2RA 3CX6A 2AWNA 4PO8A 3QVVA 3GJ0A 1E2EA 4LC1A 3NBZC 1SVIA 3OIUA 1X86B 2WSMA 3M0EA 3G82C 2DCUA 1G8HA 3EZ7A 3PUYA 2KWIA 1XPOA 3W6OA 3CRMA 2QT1A 4E22A 3QKSA 1E0SA 2NIPA 3OIVA 3THYA 3CH4B 5B64A 5FI0B 2ATVA 4YC7A 1R8QA 2FGJA 1O3YA 2VSOA 4TT3D 2MMCA 2R9VA 4KVAA 3DOFA 3X1XA 4C0LA 2GJ8A 4LBYA 1TADA 4TLCA 1SXJD 5FOVA 5FOUA 3UWKA 3CNNA 4D0LB 2J45A 1F60A 3U44A 1W36D 1UDXA 1BS1A 1KI6A 4G5QA 4H1UA 3SYKA 4Q4HB 1G3IA 4TSFA 4S2EA 2RGNC 2ZJ5A 5GADl 2RGNA 1IN4A 8OHMA 1T0JB 1NBMA 1MV5A 5HKKA 3PUWA 2W2XA 2ZEJA 2NO6A 5B57C 2NO1A 5DI3B 3PEYA 4EPYA 2FDCA 3LFUA 2GWHA 2D3WA 4HZUA 3U3KA 2CL7X 2WWGA 1HURA 1SXJB 1Q3TA 2C96A 4HUQA 2F7SA 3EAQA 3RS0A 4QJ3A 2MMGA 3CH5A 3H0KA 5KTYA 1K8RA 2AN9A 5D3QA 3VX4A 4TZ6A 2CHQA 3PXGA 3UK6A 1P73A 3K9LA 5AWFC 3NIBA 3T61A 1OT3A 3LX8A 3SDZA 2KBEA 3FFBA 2GJSA 5C1BA 4IVRA 5FBWB 4RCZA 1OXUA 3CUEF 2CE7A 3V9PA 3OEHD 2IYLD 4XVRA 3GEHA 1SHKA 2ZYVX 3AF0A 1Z83A 1CR4A 2AWOA 4AG6A 2ZS9A 1VIYA 3TUIC 3I62A 1G5RA 1II8B 1T9HA 2QMEA 2ZPTX 5IDVA 4B34A 1F2UA 1F2TB 2PLFA 4EPWA 2O8EB 2O8DA 2DFKB 4GZMA 2NO7A 2NQ2C 1E9CA 4KV9A 4M1SA 1R2QA 2H16A 3BH6A 4Q19A 4BFTA 1DAEA 1H8ED 3U6BA 2GXSA 3BE4A 2Z43A 4PPFA 4LBVA 4ILEA 4JVSB 3GFOA 5HZHA 3Q8XB 1FW6A 2WSSA 3GJ4A 5EZ5A 4C2TA 3IIKA 1KI6B 1RZ3A 4GMXA 3IEVA 1OLOA 1NF3A 2V6IA 3CF2A 4B71A 4KAXA 3SFVA 3KQLA 4BLOA 1KIMA 2QQEA 1GNRA 4UNNA 4CW7A 4QKQA 2ORIA 4UXIA 1LVGA 4FWTA 2FN4A 1V5WA 4MA4A 4JLMA 4D2IA 4EFMA 1RRGA 2HXSA 4F92B 1MRSA 1G16A 4LSGA 4OHXA 4R98A 4HZUB 2OBMA 1VYVA 2P67A 1ZM2A 2CK3D 3P4YA 1MR3F 1Q1ZA 1H65A 1N6IA 1T4GA 1GKUB 2ZRDA 4Q7MB 4ITRC 1XEXA 1XZQA 2FFHA 3ZH9B 1YE8A 4D6PA 3Q85A 2ZRJA 3UMSA 2QTVB 1GNQA 1VYUA 3EG5A 2DFNA 2GEDA 3LO5A 1Y63A 5LD2C 3D31A 4ERNA 4B3DA 1G3MA 2DPXA 2C95A 3I72A 2VH5R 4AURA 2OAP1 4N0EA 3ZS9A 1XZPA 3BOSA 4URVR 1NP6A 1I4LD 1FOEB 4BE7B 1SKYE 3I8SA 3TSZA 2XOKA 2VA8A 2W0MA 2X19A 1G7TA 1KK2A 3KKMA 2P65A 5DGXA 4E5UA 1S3SA 2DBYA 1D2NA 2V9PA 4I1SA 2F43A 3FKQA 4IOJA 6Q21A 2WWXA 3EZ9A 1RC8A 1A7JA 3DHWC 2WKPA 3MLEA 3Q5EA 4JKYA 3BFKA 3DZDA 3HPRA 4QJ4A 2P6RA 1AS3A 3KQKA 1T3LA 1GL9B 2D06A 1E32A 3SNHA 4F7WA 5F2EA 1G8GA 1U99A 5H8WA 5J40A 3SZRA 1E1QD 3A1VA 3THWB 2FSHA 2R65A 1EWQA 4P0TA 4WBSA 3SJCA 2TMKA 3EWAA 4UJ3A 3EPLA 1E94E 1XF9A 2W0SA 3TH5A 1CLUA 5HPYB 4RKFA 2P0EA 4GMDA 4F91B 2C5LA 2EFGA 2GCOB 3QENA 1ZUIA 4LJ8A 4PC1A 4TTRA 2C9OA 2RAPA 2QBYA 1GL6A 3TSWA 3OAAD 3NH9A 1Z6YA 1KI9A 2VF8A 5C46F 3OIWA 1LV7A 2JJ1D 4OI1A 5HE9A 1U98A 5DISB 1BMFD 2OG2A 3EZ6A 2OZEA 2WJIA 1P9RA 3RC3A 1ZIOA 1EGAA 1XJQA 2IF2A 3EA0A 4A8JC 3MG9A 1JQJC 4LYAA 2YYZA 4IRUB 1S1MA 2QA5A 1WMSA 4KITB 2WWHA 2W83A 3FMPB 1G19A 3KKQA 1KI1A 2CXXA 2QMUA 4QHTA 2XXAB 1XTRA 2WKRA 3QE0A 3R7WA 2ZE8A 4WXPA 2ZUBA 1P2UA 4M21A 3Q5DA 3NKVA 1S9DA 2NO9A 1W36C 4BFSA 4ZIRB 1VCOA 2F6RA 2ODEA 3B60A 1GAJA 4KCGA 1TF2A 2CCJA 2IA5A 4EPTA 3WNCA 1T91A 2VHJA 2X8AA 1FPMA 1G6OA 4OHYA 4YONB 4XH9B 3GLHA 4B3CA 1FX0A 3SI7A 3WY9A 2KJQA 4FN5A 3MFYA 1VHLA 2O8BB 2ZRCA 1G7CA 4A92A 4A6PA 2ZM5A 1ZMXA 2QEQA 2IT1A 3K0FB 3RYTC 4U7DA 4M9XA 2VP6A 1GWNA 4NP6A 2F1JA 2J5XA 3VKGA 3EPKA 5CB6A 2Z4SA 5JHGB 3IQWA 1F2TA 4HLCA 4BGDA 2O8EA 1XD2A 1TUEA 1TTTA 2OXRA 4EIWA 1OF1A 3IIMA 1FMLA 3R20A 2IEZA 2W6JD 4M1WA 3KB1A 3PITA 5F9HA 3QQ5A 1A5TA 3X1YA 2Q0HA 1ZNWA 2B21A 2GAAA 4ZPXA 1N6PA 2HJVA 1EK0A 3CR7A 3QKRB 4LRWA 4MQBA 2O8FA 3VR3A 3K0AA 1CEEA 1K5DA 4ZDJA 5J4HA 3RRYA 2HV8A 2V1XA 3T5GA 4MH0R 1LTQA 1Z3IX 2JATA 2J7KA 4Q4JA 3VU9A 5IRCD 1QVRA 4OYHA 3R8CA 3NHBA 2IYYA 3BB3A 3HR8A 2GVZC 3VMFA 621PA 3BORA 5JHHB 4GOXA 1I4DD 4MRPA 1VPLA 5AJZA 5E95A 4QNMA 2DYKA 4D4JA 2CCGA 3PUZA 2F3RA 3MMPA 3E5HA 1NVUQ 1XJ0A 4CVNA 3EX7C 2J0UA 3VKHA 1XTIA 3KB2A 1IN7A 3TNFA 1XWIA 3ZDQA 2YOHA 2JJ8A 4IJMA 1AIPA 1N3BA 1US8A 1OKKD 2UKDA 1M7GA 1E2NA 1DBSA 4M0LA 1JEDA 1G18A 4V0ME 3U4QA 4DIEA 1R0XA 1N6HA 3N2EA 2EYQA 1YR9A 3AP3A 1RE0A 4RD3A 421PA 1U94A 4A9AA 1ZW6A 4PXAA 2G77B 4DT1A 2OEPA 2RGAA 2FEMA 1YU9A 2Q3MA 3GLHB 3IIJA 5HR5A 2C77A 1KOFA 3AVPA 4TLEA 1UBGA 3Q7QA 2R62A 1OXXK 1JXMA 1MH1A 2QP3A 3C5CA 4D4MA 5EUQB 2HF9A 1NVXQ 4KLZA 2Q21A 3A4NA 1RFLA 4YQFA 4HAYA 1MO6A 4BEBA 1SVSA 2ONJA 1E2MA 2PJZA 2H5EA 2GDJA 5EZ6B 1XD8A 3W5IA 4Y0VA 3QI2A 4B47A 1W4CA 1YZUA 1KGDA 5BYJA 2BWJA 2WJJA 3HU1A 1U0HC 2DFLA 1QHXA 5P21A 2RGEA 4QG7A 4TN1A 2CEAA 4HEJA 4RKEA 4X8OA 4DWJA 3IHWA 4EFLA 3RSOA 4F4CA 1COWD 2K5UA 1KNQA 3FHCB 4GI7A 3BFVA 4G5OA 4LYJA 3KKPA 3W90A 2WJYA 2D74A 4LBZA 3W5JA 4B3FX 1SGWA 1HV8A 1ZM9A 4JL5A 4P4SA 4Q7LA 3D3QA 3JVVA 2HLDD 4MKGA 4M9SA 2QMHA 3IO3A 1JJVA 1KHTA 2GK7A 2CLDX 4NU0A 1HEIA 2OFXA 3NBYC 2WOOA 1JB1A 4EKDA 4C9BA 2ZSFA 1T8TA 2F1RA 3KTAB 2SHKA 2FG5A 3QKUA 2WOJA 5EXSA 3WBJA 1RIFA 1I2DA 2J0UB 5JBQA 1XMSA 3U2QA 3ICQB 1YVDA 2WWIA 2IX3A 4F4IA 4ON9A 2AD5A 4DJTA 2R6FA 2GZAA 3UPUA 3PR1A 1E9RA 3AUYA 2A5GA 3K70C 2WZQA 3QXSA 3AKCA 3G0HA 3U61B 2OSBA 1H8EA 3KUDA 1E3MA 5EE9A 1E9AA 3EC1A 3CBQA 3GPLA 1KK3A 2F9MA 4JLAA 3PIRA 1RVDA 1J8MF 3H1TA 3IILA 3DOEA 4I1UA 4EUNA 4IEIA 2Z5FA 5JRZA 2GK6A 4PZYA 4DT1B 2XNDA 2WV9A 2ZI4A 1HE1C 5H70A 1SXJA 3MWYW 2FU5C 1OHHD 4D0NA 4JKIA 3TAUA 5L3QA 2CNWD 2OXCA 1KY2A 2O52A 3SJBA 1W44A 4TYQA 2VP5A 2EWWA 1Z2CA 5M04A 4ZDKA 3MJRA 1VHTA 4B73A 1UPTA 2ZU6A 4BLQA 1NMYA 3ICEA 3BK7A 4JT4A 1ZNZA 4EFNA 1NBME 1DS6A 2ZRLA 3HJNA 2N46A 1G7SA 1GL7A 2PT5A 2PH1A 4JVNA 2J0QA 2GEVA 1TUIA 1U0LA 1A4RA 1VIAA 2IYVA 5AJWA 3VNUA 1LS6A 5G41A 1G1MA 3J81k 2FH5B 4DSUA 2HDNB 1XTSA 2J46A 5SZIA 5FR2A 5KDLA 2GESA 1P61B 2RCNA 1PUJA 3QOFA 3K0AB 1MO5A 1KJZA 2IYSA 1YRBA 1GZSA 2GJAA 4IDOA 3THOA 3VHLB 3AKYA 2RH5A 2GZHA 4IVPA 3B82A 4W5HA 2NMVA 4DLRA 4RD2A 221PA 3K9HA 1OV4A 2FPLA 2UVQA 4MGKR 5CM9C 4ZCLA 2A5JA 4DLZA 4UXHA 1CR0A 5J4LA 1IQPA 3W34A 4Q4LA 2ZR9A 2VPPA 1GTVA 2OCYC 2O8DB 3SN6A 1L2TA 1ZD9A 2X1VA 2QAJA 2XGJA 2R44A 3RLFA 5J4YA 1D9XA 3GLFA 1NLZA 2GA8A 4MKHA 4US0R 2QGZA 3VFDA 1KKLA 4C30A 1GVNB 4G1UC 1WCV1 4E09A 3GJ8A 2JLYA 2J7PA 2W6ID 2AK2A 5L3QB 4QOSA 5LD2B 1IY2A 4PAMA 3N5CA 4Q66C 4QRHA 3MAAC 4DUGD 1P62B 3S1AA 2IUSA 1E9SA 5JECA 5JZVA 1L7VC 1KSJA 1BO6A 3PEWA 3OF5A 3QPWA 3KQNA 2QMOA 3QG1A 3NDBB 4DKXA 5HCIA 5BWMA 1JXOA 1FX0B 2O0JA 4PO9A 4C3ZA 3IBGA 4I99A 2JLUA 2ZJ2A 3I3SR 2GRJA 4IFEA 4UJ5A 2QPTA 4DSTA 3L0IB 3UG6A 4RVCA 5AJXA 1KAGA 1R0ZA 5CJ2A 3C4JA 4QFMA 1XEFA 1DE0A 1KI2A 5CK4A 4BLRA 3T12A 2D7CA 2G83A 2BM0A 3F8TA 3DVLA 4LGMA 5AUNB 1DAFA 2RGDA 4LV8B 2IXEA 4XVUA 2VP4A 5AJYA 5F9FA 2CJWB 2IW3A 2ZI3A 4JLVA 2A2ZA 2WWWA 3CPEA 2FOLA 2VHUA 1FNNA 4O2RA 2BDTA 4EPRA 1JNYA 2QE7D 4FMBB 4XD7A 1G41A 3EZ2A 1NVWQ 2ZE6A 1QG4A 2ORVA 3U6KA 1A2BA 1EX7A 3MUFA 2W2VA 4V0NA 1NN0A 4C0AC 2CLSA 1G20E 1KSFX 2CBZA 4TZ0A 5CDFE 1EG7A 1ZNXA 4X8LA 3SR0A 1E99A 4R71A 4LJ4A 1MT0A 3ASYA 4IFBA 3WNBA 3WYAA 3D7MA 2KB0A 2E1RA 1BYIA 2BOVA 2EVWX 121PA 2WHXA 1OFHA 2ZRBA 3CLVA 1N5LA 2V54A 2ZRAA 5GJCA 2DY1A 5EP2A 3CNOA 3CONA 4UNSA 3KQUA 3CX8A 2JASA 4MRSA 2ODWA 2IYXA 1OXVA 2VEDA 3HDTA 4JMPA 4Q00A 1ZCAA 4Y0AA 4BUJA 4HB0A 4XWAA 2EW1A 2N42A 2RHMA 5EXPA 4WW0A 4XWOA 3E70C 2J87A 1Q0UA 2P6UA 4GZLA 3OHMA 3WYFA 3BRWD 4WZAE 4RCYA 2B6HA 3SJZA 5K8IA 4J0QA 2IS4A 3A1WA 4DSOA 2OILA 2XJ4A 1JEEA 4ASUA 1G5TA 3D6TB 1NG1A 3LH5A 4HLQB 5TXGA 2BBTA 5AUQA 1NSTA 3M6AA 4WZ6A 1NIJA 1YRAA 3ZIAA 3AF3A 2ZRHA 1XTQA 4KBGA 3I4LA 2P2LA 5UKDA 3CW2A 4HSEA 2X2FA 1HUQA 1ZIPA 3FPAA 1XMIA 3P26A 1P5ZB 3TBKA 4ESVA 1CKEA 4HAZA 1OH8A 1JR3D 4URXR 4C0KA 2GNOA 1AZTA 3CRRA 1OE0A 3QPVA 1G4UR 1OW3B 1WA5A 3GJ6A 4IOKA 1W5SA 1XEWX 4NONA 2Q9AA 2R2AA 2PX0A 2PZFA 3IQXA 4LJ9A 5J47A 1BOFA 2FJUA 2JIZD 5GVSA 4YMWA 3K0SA 4LZZA 2IEYA 5IHPA 2ZTSA 4R9UC 2XB4A 3KL4A 1EFUA 1R0YA 2V6JA 1EFRA 1Q57A 1QHGA 3U7HB 1KI4A 2GVDC 4G5RA 2YJTD 5JWHA 4D81A 1NLFA 1OFUX 4Q9LA 2O8FB 4E07A 2R6DA 2OLJA 3GEEA 2OCAA 4Q9IA 4FCVA 5KSPA 3QBTA 3AVWA 3U4QB 2ZR7A 3T5DA 2KSQA 1VG9B 1T5LA 4LX0A 2D2FA 2JLSA 4HLDA 4IXMA 1FNMA 1U9IA 4POAA 1D8TA 3U3RA 4C0HA 1D2EA 3FMFA 1JECA 1FQJA 4URUR 1FTNA 1ZP6A 4XJXA 2GCNA 3OZXA 4KSCA 4O0MA 4HUQB 3AVOA 1GUAA 1D9ZA 2IYUA 1Z28A 4RZXA 2KBFA 1R4AA 3ZQ6A 3REFA 2BBWA 2XSZD 4PZLA 4RJLA 3Q72A 3LA6A 5J5CA 3IO5A 3QKSB 4BFYA 2Q9CA 1EFRD 4M53A 4L8GA 3B13B 4ZCMA 4FCTA 4NPHA 4I1OA 1M2OB 1OPXA 3IPXA 4LY6A 4A2WA 2NOAA 4LWZA 1XCGB 1XXHE 2C99A 3SJAA 4CGZA 3SE0A 4CT5A 4L9WA 1GITA 1M7BA 1NL3A 3CRW1 2UZ3A 3QG5A 4HAWA 5JWOA 3RRMA 4A15A 4KFUA 1NMXA 4M1KA 3AVYA 1CR2A 3LBHA 1N5JA 4L4UA 1VMAA 4TYPA 5EJEA 3IEUA 1AKEA 3HU2A 3A36A 4PPGA 4UKDA 1JR6A 3LD9A 4KFRA 3TVDA 3WXMA 2BIFA 2OV2A 2XNDD 4MUAA 4WA7A 2PCLA 5EP4A 1L4YA 5IT5A 1G8YA 5JS7A 4BRUA 1DG1G 2XZPA 2HT1A 5TY0A 3ZIAD 2BM1A 4TQAA 1J7KA 4BQSA 1VECA 3IPYA 4PSVA 2WWYA 1XPUA 4Q03A 1AA9A 3CZPA 2XB2A 3UKDA 1UBCA 2JEOA 2ORWA 3REGA 1JQLB 3DMDA 1NKTA 4PAOA 2R6GA 2WJVA 4DLSA 3OE7A 1E4VA 3PENA 2FGKA 2RGBA 1JPNA 1Q22A 5DH9A 2CDNA 2FZLA 4PFSA 4MKIA 5EP3A 1XCMA 1UBFA 3KJHA 1G8PA 3ONWA 3NDPA 5GJVC 3QXHA 5KSYA 2A78A 3DKPA 3CB4A 1YR7A 1KNXA 2AHOA 3RSLA 5CLLA 4NBSA 5HE8A 2ZXUA 3EWSA 3DO6A 4NYMQ 3EIHA 4QNRA 2ZS8A 4DBLC 1QVAA 3PUVA 1W49A 3DM5A 2QTFA 3TIFA 4PHHA 1MABB 4URWR 1UKYA 5FTJA 2MSEB 4B3BA 1FQKA 1SVLA 2MSCB 2WTUA 3QEJA 4HDQB 4WOPA 3QKRA 3AVVA 1E79A 2R8RA 3TMKA 1TU4A 1XDBA 4M2LA 1IN6A 2QN6A 2ANCA 2PMKA 4MRVA 2D2EA 3RAPR 2AL7A 5A4JA 2H17A 4HB3A 2ZRKA 3NC1C 4AG5A 4L9SA 3EPHA 3NG1A 2WBLC 4P31A 2A7QA 1IXSB 1DG3A 3CM0A 3QF4A 4A6XA 1DARA 3KKOA 3O8CA 4YMTA 1QF9A 4DB2A 4QGGA 1PLKA 3NTUA 2W58A 5DLQC 3VHXA 3ZD7A 1XPRA 4BZXA 2GCPA 1QG2A 4UNPA 2QUZA 3SBEA 1XTJA 4Z51A 2C9CA 2RMKA 1KDRA 4Z1MD 4I4LA 1WDTA 2QSZA 5TARA 3A1SA 3K0CA 1CF4A 2ZSEA 2A9KA 2F43B 3A58B 2C04A 3OEED 5JSZA 2RGGA 1Z6XA 1AN0A 5KNBA 3T35A 2JJ1A 1TEVA 2KE5A 4N1AA 5DNYB 1DAIA 2AR7A 1PLLA 4PTLA 4G0NA 3WRXC 4R2HA 3LRPA 1AM4D 3D8BA 2ANBA 3NHAA 5FL7A 5GJBA 2IWRA 2IXFA 1NJFA 3BXZA 4OL0A 3GJ3A 4BFUA 4DIDA 3GLIA 4GFDA 5FUVA 4YDHB 3THYB 3A37A 4A0RA 1NLYA 4BFVA 3RRZA 3TUZC 1KK0A 1VG8A 3W6NA 3PV0A 4H1VA 1S2MA 4EQ6B 4GL2A 1G3QA 2QRZA 5JEEA 2H92A 2ZETA 2FFBA 5FPKA 1VTKA 1XCPA 1L8QA 2OUKA 2YWEA 3VR5A 3TQCA 5ELXA 4LUCA 5GJWC 2J0SA 1GM5A 5GVRA 1JR3E 1N6KA 3AM1A 5CDFA 1Q12A 2RKOA 5BW8A 3GEIA 4G01B 3KJEA 2G88A 1H8HA 5B2ZA 4US2R 5L3VA 2UZIR 3AQ4A 4KU4A 5AR1A 2GBLC 2ZJBA 4DEXA 4V03A 4N0DA 2WAYA 1QHIA 4OI0A 3ZYCA 4Q5IA 1YZNA 4FXPA 1KO7A 4GP7A 4JIMA 2CJWA 2G0NA 4C7OA 2G3YA 3RS3A 1B23P 4W9MC 1JALA 1X8JA 4NCNA 3T15A 1A82A 4O2LA 4A2PA 3I32A 2Z0MA 3PJRA 3ZQJA 1QRAA 1ZM7A 1W48A 3B5JA 3DKVA 4D4KA 3GJXC 1PUIA 2ZU0C 4C0BA 1IBRA 5G53C 1KMHA 2A5FA 4LJYA 1TMKA 1QDEA 2HXYA 2XXAA 2CNWA 4B76A 4OHVA 4TL6A 5C4GB 2GJKA 2YWHA 4FMDF 3VU9B 1Z0KA 1D6JA 3EZFA 1T3SA 1UDWA 1E4YA 1TU3A 4FMDB 1W0KA 3OESA 3C7KA 4DEYA 4NCIA 4A2QA 1V43A 4TMKA 3KZ1E 3DM9B 3I5XA 3W8NA 3AH8A 4JSYA 1F2UB 2E9SA 3AF2A 3FKSD 2QORA 4G5GA 4NH0A 1P4SA 3TSOA 1EFTA 2QP9X 5D3MA 1OIVA 3W3AA 4QBFA 2HUPA 5CITA 4WXRA 1OH5A 1ZC4A 2AFHE 2GEUA 1EXMA 2B8TA 4ZDWA 2NTYC 1FTSA 4KODA 1RW4A 3FHTA 1GRQA 1NY5A 1QHHA 1U0JA 2MSDB 3R9WA 3ETLA 1R5BA 4PC6A 4V0LA 5L8VA 1G17A 1Z0JA 2P3SA 3M4YA 4BLPA 3IUYA 3W8RA 1ONBA 4Q18A 4IHQA 1U8AA 2IHBA 3GCGA 4P32A 3RS4A 2REBA 2IYRA 3TGPA 4F4JA 4BASA 4FCWA 5H1YA 2I4IA 1RJ9A 1E96A 2IF0A 4WZBE 5LPNA 3CPJB 3QSYA 1HY3A 1KSHA 1SVOA 3FGNA 3TE6A 4ARZA 4Q9HA 3ZD6A 1GNPA 5JMTA 1W7AA 3A1TA 4BZPA 1DADA 1VKJA 1IAQA 2B7BA 1R6BX 2CVHA 4LC0A 4PSAA 2ZR0A 3BH7A 5FPHA 5BQ5A 2FF7A 3T1QA 3MGCA 1H8HD 2YWFA 4W7SA 4HB4A 3I5YA 2JLVA 2WMNB 2Q9BA 4IOLA 1II0A 3I61A 1M7HA 5CIQA 3WP0A 3U5ZB 1GKIA 1R5OA 1SULA 4OI2A 3VQTA 1E6CA 2BC9A 4RZ2A 4XSHA 1AK2A 5AK0A 3BC1A 4JL8A 1E69A 2EFCB 4MYHA 1C9KA 4EDHA 2AXNA 4F38A 3Q9LA 4QHYA 4DCUA 2BHRA 5EUMA 4UNRA 4TTQA 3OFND 1MO4A 1KI7A 3U3OA 3QJYA 4TYYA 4LPKA 4PPQA 1AJEA 5KNCA 4M1MA 2W6JA 1OH6A 5FL3A 3A6PC 1UBEA 4HAUA 1YZGA 2PX3A 3GLGB 5KSZA 1X6VA 4TLDA 2OCPA 2GILA 3EXAA 1OH7A 4G5SA 4A1FA 1NIPA 3SYLA 1MRNA 2AFIE 2ASEA 3AGQA 5EQTA 1GILA 1KZ7B 2XNSA 3FHOA 5KPDA 3MRSA 2IYWA 4X8HA 2P5SA 4CIDA 1OKKA 3E1SA 2ZSDA 2ODBA 4XWKA 2QGNA 1FP7A 1E2FA 4OK5A 4B75A 4LV5B 4IDNA 1UEIA 3K70D 1S0UA 1LW7A 1W4BA 2ATXA 2ONKA 1EX6A 4XD7D 2YZ2A 3B7GA 3CF0A 3OE7D 5EP1A 4NYMR 4Q9KA 2PZGA 5LBIA 2XJ9A 5CYOA 3EA5A 3CWQA 2AXPA 2CLCX 2ZRIA 3FE2A 1DAKA 4JBWA 1E2QA 5JRJA 1CS4C 1ZRHA 1R10A 721PA 1W5TA 4BEJA 2IS1A 2R6AA 4HDCA 3EW9A 1JI0A 3FDIA 3LVQE 1JAIA 3LQRA 1E2PA 4F93B 2GHIA 2OFWA 1TQ2A 2I1VB 2PL3A 1KO5A 4R7ZA 3R7WB 1B0UA 4FI3C 3TW8B 1QHNA 2QZ4A 4HI0E 5IK2D 2CE2X 4KSBA 3RS2A 1TQDA 4TYWA 1FFHA 3HYRA 4A36A 2JIZA 2YC2C 3UMRA 3VR6A 3WHKA 2FV8A 1E79D 2QU8A 3GFTA 1KMHB 4EPXA 1ZU5A 5FOWA 2CHVA 1CIPA 4HAVA 4DRZA 3U3MA 3AKDA 4DUGA 4TMVA 2PLRA 4OHWA 4TMTA 5KO2A 4RD0A 1PV4A 1NKSA 2IC5A 5JWRA 2OAQ1 3U7EB 2GXQA 4YDSA 5TV2A 2YOFA 3ZLJA 2VP9A 1XMVA 2EYUA 2RB4A 3T06B 4DCNA 1Z6GA 2ECKA 2WIAA 1AS0A 4Q7KA 4CT4B 4A0FA 5JCZA 4JJKA 4LHWA 1T8UA 4AKGA 2ZYUX 1IN5A 1Z6AA 2H57A 1P7CA 1E2IA 3GFPA 4FMCF 3ZZ0A 1AS2A 1LFDB 2ZYWX 4GBMA 1EFCA 4IOMA 2J59A 5E7JA 2A30A 1XFAA 1W1WA 1KK1A 1Q1EA 1XRJA 5CM8B 2G1KA 1HT1E 1ZM4A 1ZD8A 1F48A 3AF1A 3JZAA 3QF4B 5FTNA 1BYUA 3G5UA 4CEHA 1S1CA 2PEYA 1OB5A 2WKQA 2QBYB 1R5NA 1Z63A 4HLUC 4YMSA 4WAUA 5TVKA 2WMOB 3B2EA 3X2SA 1E9DA 1XNJA 1NVVQ 2GJ9A 3P32A 5E7MA 1DVRA 2OE2A 1OIXA 5FBVB 4M1YA 4DLXA 1EESA 4JVMA 1G3RA 2FA9A 2JLRA 4ZV4A 4W5WA 4PQYA 1MOZA 2QTHA 2IS2A 4ZCIA 4P4TA 4RY2A 2QENA 3AV0B 2WJHA 1P72A 3KFXA 2I3BA 2FSFA 1Q1QA 5FPYA 5HTKA 3BIFA 3LY5A 3GLFE 1HH4A 4JLJA 2JA1A 2ZITA 4LHYA 2H7VA 1ZCBA 1JR3A 2PEZA 3KJGA 3F5FA 4DCTA 1NSFA 5CLQA 5JCPA 4HAXA 1IJFA 2IUTA 1HQCA 3AVXA 1DO0A 2WSSD 3NXSA 2EWVA 3V4RA 1WF3A 3UWOA 3DDCA 3QKTA 4D80A 1CBUA 1GRRA 2G1JA 1Z0DA 3GJ5A 5BN3A 5KUTA 3F3YA 2QAGC 1II9A 4QBIA 4JLDA 1DEKA 2O8BA 2WVJA 4L16A 3SU8A 4OJKA 4TL7A 4QHSA 3TRFA 2OCBA 4MDFA 3BAFA 2QAGB 2NPFA 3RC8A 4EAQA 3AEZA 4CF7A 1P6XA 1SKQA 3MWKA 5JFGA 2BBSA 2HJGA 2F1IA 3DL0A 2GF0A 4B33A 4DZZA 4QBGB 1TAGA 3L82B 5JS8A 1ZINA 3HWSA 4Q9JA 1KO1A 2IK8A 2A5YB 1WP9A 3BJIC 1DAHA 2ZUDA 4LHXA 3WMFA 5EXXA 2XZOA 3ZVMA 3LWNA 2IUUA 3LW7A 5FH9A 1S3GA 1D2MA 4BLSA 4JZKA 2FPMA 4BFWA 1ZYUA 5C2JB 2J1LA 2D4HA 2JJ2D 1JBKA 2AKAB 4JT2A 1S9HA 1XJCA 3X1ZA 5KDOA 3LLUA 4MUBA 1N25A 3PEUA 2GBLA 4MKFA 1N6LA 2YC4C 1IOZA 1CJUC 1R7RA 4B74A 2JDID 1E2KA 3QXCA 1UM8A 1HE8B 1T5IA 5SZJA 1XXHB 5L3SB 1W2HA 1CJMA 4D0GA 2V4ZA 2BEJA 1Z5ZA 4LJ6A 4BFZA 3TR5A 2OO7A 3GLGE 2X77A 4B48A 1RYFA 1P2VA 3L0OA 4EQ6A 4ARZB 4Z54A 2QL6A 3NC0C 3CZQA 1Z0IA 4NL4H 3O8RA 1AKYA 1U8ZA 4NYIR 2ZRFA 4LI0A 4PZZA 4D26A 2WICA 1G3UA 4C0QC 4Q1AA 2LKDA 4IW3B 4PAQA 1AQUA 3QPUA 5CK5A 3FB4A 3QEOA 1WQ1R 1AZSC 4IDQA 5FPSA 2D7DA 4MYTA 3RWOA 3PUXA 2OM2A 3K09A 2VSFA 1X1SA 1OFTA 2ZIAA 3LX5A 1P9WA 5CIWA 1QZXA 2BKUA 5J4VA 5B58C 3MD0A 3BH0A 3QIAA 4LJ7A 5J4KA 2ZJAA 4DLVA 1GDDA 4B35A 2PBRA 1E0KA 3TQFA 3VR1A 1GRNA 1NI3A 5DYIA 4D25A 4KO8A 3C8UA 2YVUA 3RABA 1G291 3ECCA 2A3RA 3I92A 5C4MA 2ZI7A 3OFNA 3QY0A 4Z8YA 4PPNA 4BLTA 1J99A 3UMFA 3K0CC 4OQMA 5HZKA 1N0VC 2WIBA 4LPSA 1Q21A 1E9FA 3RDPA 4GOJA 3ADKA 521PA 5KNDA 4OQXA 1Z2AA 3Q7PA 1G5PA 4JLNA 4Q21A 4WIAA 4PX9A 4X8MA 5TMPA 4BRWA 1ODFA 5F3WB 4CEIA 5KU1A 1OIWA 1QHSA 2FPKA 4RFSB 4HUTA 2YHSA 2VIIA 4XTRA 3KXLA 2PMDA 5JEDA 5B30A 5IF9A 4AD8A 4B43A 4W5JA 1A2KC 1E0JA 1M34E 3EARA 1ZJ6A 4Q4AB 1G6HA 1L4UA 2EFEB 2C98A 4AKHA 5K8LA 4XSGA 1W4RA 3A4LA 4B2LA 1SHZA 1DAMA 1TPZA 2ERXA 3LDAA 2BMFA 4Q02A 2J9RA 3GLIB 5JJIA 1XEXB 1G8FA 1LF5A 1G4AE 1M6NA 4LK2A 3K70B 3ZZTA 4OHZA 1UKEA 4LJ5A 2VTKA 3PQCA 2BMDA 4CZ2A 4GRAA 1WXQA 4Q01A 4Q48A 4DC9A 3FYHA 2PT7A 4JLPA 3VKWA 4NZYA 2J3EA 5KHOC 1LB1B 1VCIA 3TLXA 1IJEA 1S8FA 5SZHB 3ND9A 4A4DA 1D5CA 3KFVA 4ACAA 3PEVA 4B2PA 4DSNA 4A8JB 3T1OA 3LNCA 1Z0AA 3CRVA 3MCAA 3UATA 1M1YE 1MO3A 2DWPA 3C15C 3CR8A 2VLIA 4B32A 1TNDA 2J0VA 3FOZA 2IYTA 3K53A 4JLKA 2B7CA 2ZAMA 2ZVQX 2ZYTX 3TVTA 4JLBA 4C7OB 4XTCS 3BB4A 4LYHA 3SEAA 1E2LA 2O5VA 4AY2A 3X1DA 1F3OA 3RS5A 4M1TA 1AQYA 5G3YA 5A0FA 4DLYA 1C1YA 4C4PA 3FWYA 1MABA 1LY1A 3T1TA 3MSXA 3KJIA 5AJVB 3ZGXA 3HU3A 3U60B 5KSOA 1X8LA 2Q3FA 3A4MA 4LYFA 4DDVA 1I4TD 2IHYA 4CEJB 5EE3A 4Q4AA 1ZUNB 1XEWY 4KFSA 4DXAA 4DLTA 4OK6A 821PA 3VR2A 1N6RA 1CRPA 4FINA 1Z07A 3LXRA 2VL7A 5FOXA 4TWZA 3IGFA 2WJGA 2RGXA 1UEJA 1HQYE 3AP1A 5DO9A 4KFTA 3ND8A 4B2IA 4O25A 4BFXA 2IBMA 3AVTA 3FVQA 1KI3A 1SXJE 1W0JD 4DLWA 1G64A 3GLFB 4UQOA 2ZRPA 4NCJA 2G6BA 1MKYA 1OSNA 3ZVLA 2GXAA 1XP8A 1KAOA 2G0TA 1N5IA 2VHTA 4AYXA 3BS4A 1QHHB 2ZRNA 5FUYA 3VTKA 4P4UA 4GSYA 4RD4A 3IBYA 5DYGA 1U9IC 2VF7A 2V3CC 3HYTA 3WRYC 2V8OA 3CWZA 3NH6A 3TJZA 3S1AB 1Z47A 3ZZUA 4M4SA 4TSFD 1U90A 4FD2A 1U8YA 3L8YA 1VCMA 5CB8A 1P2SA 3RVBA 1T3HA 4N3NA 3EASA 1CJTC 1W4AA 2XEXA 3WMEA 2F55A 3WP1B 4JS0A 1WB9A 2GXUA 3LLMA 3GQBA 1IN8A 3H4MA 2XTNA 2REXB 4U00A 4IVQA 3T1VA 2FMXA 3EC2A 4UXJA 1YHNA 3GD7A 5KPJA 1TQ6A 3NBXX 4DB4A 4JJZA 1NJGA 4PC3A 3W9YA 2QT0A 1CJKC 3BB1A 3B6EA 4MRNA 1EFHA 3FFAA 2ZREA 3K0EA 1IONA 1PJRA 2QI9C 1YJ5A 1NN1A 1KI8A 1RRPA 2XX3A 3Q3JB 2G9NA 2JLQA 2E87A 2BKEA 4QGFA 3AGPA 4PHFA 3GLIE 2D62A 1P60A 4LV6A 4TMWA 3TR0A 5E4FA 1RJ9B 1SZPA 2DFTA 2XAUA 4QJ5A 4KHZA 5JI2E 5C18A 1KDTA 3JVUA 4ZI3A 1UAAA 4TL9A 2WM9B 3KXKA 3QVUA 1KDPA 1ZU4A 4I1VA 1N0WA 4NYJR 3K9NA 2DHRA 4OKSA 4RD1A 1P75A 3E2IA 3R9XA 2BJWA 1NVVR 5AUPB 2V7QD 1WBBA 2OESA 3P4XA 3FKSA 4PHTA 1Q1BA 3FTQA 3CRQA 4PSKA 3ZJYA 2JDIA 4D82A 3LV8A 3L0SA 4OJQA 3AKEA 1CJVC 5FPTA 2OHFA 3C14C 4KBFA 2Q6TA 2XTMA 4CYMA 3OAAA 4LOAA 1Q3HA 1N5KA 4YMVA 2REOA 4PR0A 1FMJA 1J8YF 4LHZA 5FTMA 1GP2A 4GP6A 4C0SA 3QBVA 4WVFA 4JBXA 3WMGA 4EJSA 2XZLA 2HYDA 2L0XA 4FIDA 2F9LA 1TQ4A 2HLDA 4JBYA 4NDZA 3UIEA 3P27A 3QXJA 4EPVA 2VQSA 2ZVPX 3BWDD 4ZDIA 2C2HA 1DTSA 1LNZA 3KDSE 4B44A 1PVOA 1KMQA 1FZQA 3HP1A 3SC3A 3HPQA 5EE5B 4YMUA 2YOGA 5BN5A 2ZJZA 3RANA 4JLOA 1W0KD 3IKJA 5HCNA 2DB3A 5JSZB 4UNQA 4P3YA 2CHGA 5FBQB 1ZNYA 2CMKA 2ZS7A 3UANA 5FTLA 5JI3E 3WYGA 1ZBDA 5K8TA 4AKIA 5FL7D 1T6NA 1NRJB 1BMFA 4URZR 4MDEA 2LCFA 2FWRA 4QM7A 2FNAA 2FX3A 1YQTA 4L5BA 3THXA 1XTKA 3CO5A 1HTWA 4CEIB 1UJ2A 1I2MA 4A82A 2VHCA 3DZ8A 1YZTA 1U81A 1YZQA 4GNKA 2GKSA 2BMEA 1X1RA 1Z6TA 4GT1A 2CK3A 4MGIR 2DWOA 2Z4RA 3OEEA 4EJSC 1FL9A 2O0HA 5BXQC 1QBKC 4K81B 3X1WA 4HZIA 1ZVQA 1G7RA 2Z83A 1IY0A 4GOKA 4JSTA 4Q1CA 3W3ZB 4OBEA 4DCVA 1E1QA 1VG0B 2NO0A 1FUKA 1HYQA 1TEXA 1E9BA 3DMNA 1A1VA 4ZO4A 3GJ7A 1XXHA 5L3SA 5G3ZA 4V0KA 3PG5A 2OBLA 4URYR 4PQRA 2YV5A 4JVLA 3ZVRA 4JL6A 1UF9A 3SQXA 4LBWA 3LQQA 4FW9A 3TK1A 3O8BA 3RRNA 3BERA 4NYIQ 3FMIA 5EE1A 2XTZA 3TUJC 1VDZA 2IL1A 2QSYA 3TW4A 1T0HB 3LXXA 3DEFA 4MYCA 3BBPA 4IEEA 3LVRE 1XX6A 1E2JA 1II8A 4KYIB 5LB2A 1NY6A 2BCJQ 4Q1BA 2IXGA 1F6BA 2ZAOA 3RHFA 5FOTA 1DPFA 3KUCA 1KKMA 3I8XA 4CDGA 1IXRC 1IXZA 4MITA 1ESNA 3MJHA 1M8PA 4RFVA 3TKLA 3H86A 1RRCA 2JAQA 5FUXA 5FTKA 2BVNA
chains in the Genus database with same CATH superfamily
1I3MA 2GCOA 2HN9A 3MS2A 3N8DA 4G1EB 2JLZA 5TT0A 4K26A 1QIEA 2RBGA 5JQGF 3EDMA 4CRWB 3SWWA 3CCFA 1G5QA 1R66A 2WTXA 5JLAA 5K0GA 2HW8A 3RSZA 3I53A 2DWQA 2EIHA 2I71A 1PEAA 1LBTA 1SNYA 3PQEA 3U31A 3RUCA 4YXWA 1N2JA 3Q8MA 1W5FA 1Y48E 2WHRA 4CDMA 2C8VA 1EA5A 1JYFA 1ZD1A 2C03A 1P1HA 2HGZA 3BCHA 3C43A 3FLAA 4QDJA 5FJJA 1JDPA 4GDFA 2OBNA 4ZRNA 2ZJ0A 2TYSB 2FWAA 2CNBA 2J7PD 3H2YA 4HGRA 4QOHA 5TDHA 1FFAA 3MRXA 4PLVA 5HP4A 4KE7A 1NOKA 1RMTA 1BJKA 4JBNA 4MWCA 4AKEA 1A9TA 4BJ5A 2ZB2A 1PD1A 2ACVA 1A9OA 2PMWB 5J59A 4O4IB 3B8HA 2O0KA 4Y7CA 1CNEA 1PLJA 1AUPA 3PWTA 5D3MB 4WOBA 3RUAA 3UN1A 4BWGA 4YT4A 1G59A 4G8JA 4XSVA 5E6SA 2J3HA 1GSIA 3BVPA 4I66A 4WZZA 4KACA 3EF1A 1GT6A 1T5HX 4OKIA 5HGXA 4LJRA 3GJZA 3V8EA 1MGOA 2O23A 4J03A 1ZLXA 2YJ3A 1W88A 2XIQA 3RJ9A 1SG0A 4R9NA 4BN4A 1GA1A 5CA1B 3NYQA 5A04A 5IT4A 2O8CA 2ZJYA 2EFJA 5B2EA 3HADA 1BQEA 2CLFB 2J32A 4MP6A 5CLHA 5F5XA 5GOZA 1F1BA 4X95A 1V7PC 1Y7LA 2X8WA 1RI4A 4RE5A 2C59A 5FFMA 5FOSA 3FOAA 5BN5B 4RH0A 2AN4A 4TL8A 5BW5A 5ULLA 3HY3A 2IS6A 5L7YA 1UKZA 4YRKA 5DI3A 1WUKS 5E38A 4GYWA 2AFIB 2Z1NA 3L8ZA 1EFPA 4FYPA 1J97A 1OBVA 4CM9D 1KYIA 1J2JA 3IODA 3CZ5A 4WOJA 4CEHB 5FUWA 1G6Q1 3OA2A 3ZE0B 4D9FA 1ZJYA 1NNEA 4BNDB 3FTCA 1N7GA 2ISSD 3MOSA 1WRBA 4A1OA 3NPAA 1ESMA 3U26A 3WYCA 2ZANA 4ESEA 4EL0A 3DW1X 1Z34A 4KQHA 4R1PA 2BBOA 2ZE5A 1IMJA 1QGUB 3I0ZA 4U39A 1WPGA 1BHQ1 2AX4A 3DTVA 2HMAA 1OLUA 2XMDA 2PV0A 4B87A 1JQ3A 1CF9A 5DN6D 4ZU3A 3MWEB 1C1XB 1EWVA 3NVMB 4BO0A 2WP0A 1KDOA 4DDUA 1N4AA 4Q3AA 3UHFA 3AF5A 2E37A 4TLAA 3SAJA 4ND6A 3ZY5A 1POWA 4UUPA 4TVKA 1DV1A 1QIGA 1S96A 2FUCA 3DDUA 1WE2A 1ZO8A 3PUHA 4BP3A 3DV9A 5SICE 1OYVA 2OZLA 5CJPA 4PICA 3JX9A 1GKYA 4DLAA 2RDMA 1EVLA 1BIFA 2NXJA 3RYFA 3RNLA 2Q0QA 3RRXA 5L6MB 2C83A 3GAFA 2FPPA 4Q34A 3GVXA 4FGZA 1QTRA 2BTQA 1AMNA 5AH0A 5HHTA 4MVCA 2G7ZA 5EGNA 4IDPA 4II7A 3CZ9A 5I5EA 1OGJA 2OO5C 3OLXA 4UHCA 3VX3A 3TQHA 1FSZA 1PFGA 4B3XA 4U3JB 1EJ2A 1O57A 2JI6A 4WKPA 5DGDA 2IQ5A 1O54A 1WABA 4DHEA 5H9WA 1H1DA 2Y68A 1E1DA 2NPIA 1MX1A 1TPYA 1K2VN 3C3WA 3M1YA 1NW9B 2H1RA 4YXWD 3CNLA 4KNYA 1QSGA 2VRWA 4M0CA 1MPTA 5BUQA 3HM2A 2O0LA 2OVBA 5AVVA 3GGGA 1A8UA 3L6UA 3O9ZA 4L4ZA 4OB7A 3FZYA 4CL2A 1JKJB 4OYLA 1HE3A 3ENVA 1G9XA 2VP0A 4W1RA 4CQMA 4OGWA 1Z5WA 4ENRA 4BQRA 5HWSA 4RD6A 3U7QA 1ZN2A 4Q4HA 1WXIA 3NAZA 5FUQA 3K6SA 2GB4A 3DVAB 1HLGA 3NEJA 2WB2A 4F2GA 1JJ7A 2H1SA 1XZNA 1KSGA 4EAAA 3CR3C 4CLRA 2NNWB 1HO3A 4DUYB 2JIQA 1FNSA 2W8BB 5HDBB 3LYHA 3VR4A 2H9IA 4LE1A 2ICAA 2FEPA 4LY3A 5ANRB 3RRJA 3R3YA 4UFNA 3EXEA 1KU6A 2XXJA 4MWEA 5AVJA 4OB6A 5T8KA 3SBDA 1BMTA 3ENZA 3UNXA 3L2OB 1E3SA 1E7SA 4K8OA 2ZULA 3HI6A 2ZJOA 2ET6A 1Y5RA 2IPLA 3AFNA 3MJTA 3DTVB 4DWOA 4RVDA 4S12A 3S2IA 1DIAA 3AG5A 1W1IA 3QE4A 5FI1B 4P83A 3RT9A 3W5HA 1P0IA 4DLUA 3Q9NA 3B3AA 1P2FA 2J09A 1QH0A 2ID7A 4MWTA 3KXPA 1DWQA 4EABA 2Y4OA 3SZOA 2VDQB 3D2BA 5KYKA 2CVPA 1MFZA 1TX4B 3EDCA 1WUYA 2WWFA 3V4FA 3ZBPA 3B6ZA 4RSGA 3KHSA 1TK3A 2P7IA 1TM1E 3QMMA 1ZIYA 5ABPA 1ZUNA 4LEIA 4PGHA 3T0FA 3TD9A 2QRNA 4IGIA 4R2LA 2NZYA 1YU6A 3ZS8A 4DIKA 1ETUA 2WAAA 3EIXA 1XLVA 3TM4A 2JFOA 2XH8A 5AKIA 4KH0A 4DIFA 1D2RA 4KVGA 1X39A 2PS9A 3ORRA 3LBIA 1CQIB 4Y6OA 5A9SA 3F6PA 5H81A 2WG2A 3N3BC 3IDQA 3LKVA 4JYCA 4UREA 4A0GA 5KREA 1LF0A 3O1HB 1TEZA 2VYVD 2WUWE 4B4WA 3VH2A 1E1RA 3TLBA 3A1EA 2VK2A 4Y1RA 5CFMA 1NMZA 4CQLA 1XG5A 5CNMA 3PNQA 1ESEA 3SYTA 4FWIB 4RY9A 2BCGY 2VJMA 2XCUA 3RVQA 3P9XA 1SG6A 1Q44A 2NU7B 1N2CE 4Z1OA 1GR1A 2JCVA 4ASUD 1XRRA 3KYCB 4IXWA 4IMRA 3UF0A 4ZKDA 1Q1NA 3PQ3A 1Z0SA 3GMTA 1TF5A 5BQPA 3RLIA 4G1CA 1P3JA 2PZEA 4PSCA 3J7AC 1T25A 4KIJA 1N0HA 1ZHHA 2C5AA 4IJ5A 1WV1A 2ZK7A 1HQDA 1T9ZA 3TQIA 5ITZA 4P8RA 2HCJB 1L7QA 4DDTA 4WUVA 2YINC 2D7JA 4DPKA 2G71A 4P4LA 4Q0MA 1BVHA 3SHVA 1DO2A 2PKWA 2PVSA 5ALHA 4Z4FA 4OQFA 4RLFA 3CLSC 2IOYA 2KLHA 2Z3WA 1YRLA 3DO8A 3L02A 3OCZA 2VO1A 2ZIXB 2QJOA 3DXYA 2WJPA 3FPBA 3Q5GA 4K9DA 4KXLA 4OHPA 1BE0A 1OAAA 2HEIA 4EW1A 3RAFC 2BGTA 4EMSA 2OGZA 2L19A 2C7BA 4H15A 4IIGA 1E3EA 1A2QA 2D6FA 4Z4CA 1R4ZA 5EOVA 4Q1EA 3RIHA 4I9HA 4TMZA 5LZ2A 2HUNA 3TMAA 1TEHA 3C16C 1YR8A 1U2GC 2AJLI 3CEMA 3G2NA 4M8NE 2QR3A 4PYNA 4KJZA 3SFZA 3TCNA 3VPSA 1E9EA 5AW2A 1Q95A 3LC2O 1YR6A 4RMHA 1IZ8A 2HA2A 1MAWA 3U48A 4OUDB 1G21E 5CLGA 4E11A 3DLAA 1DZIA 1VE9A 2OBXA 1CFZA 4C0JA 4DDWA 5B3AA 1Y3CE 3MQFA 3SVLA 2C5FA 2C9MA 4M36A 3VDQA 2ADFA 3SDSA 1L8OA 1FK8A 3DE6X 4MV5A 1TCVA 1CHDA 1Q0RA 4TV8B 1VL5A 2P6NA 3BEDA 4DCMA 1OX5A 1G2QA 4HDOB 4R1MA 3W4IA 4ZK2A 4CM7A 1TQ8A 5K9ZA 3QNWA 4YAIA 1GJRA 3I1FA 3W7AA 3O31A 3TLYA 3LPLA 4QUAA 4N82A 2PRSA 2FZ4A 1J70A 5DHFA 4LDQA 2O48X 2EGGA 2FSVC 3BMCA 1PR3A 1C7RA 4G84A 4YIHA 5I4KA 1SQ5A 1U7XA 4FVTA 2BFPA 3GLGA 1K6XA 4PHGA 4H27A 2A1TR 1NPDA 1QYXA 2I1WA 4UCWA 3C5HA 3T5MA 3BD9A 3WNDA 4KOEC 3V9AA 4EEZA 5C80A 3AUXA 4B5KA 4KH1A 3O4VA 4GBJA 4PE5B 2XUKA 3OPMA 4XB1A 3ZNOA 2GHQA 1A8QA 2BMAA 1N5MA 1ZM3A 2SBTA 4WGGA 3WL6A 3I6BA 2QG6A 1UC4B 1U0NA 1E1RD 2WDZA 2YN0A 2OFOA 3NRJA 5G1PA 5G40A 1NW5A 3WJ7A 4E03A 1W46A 3KD2A 1YZLA 1N6NA 2GFHA 1UK7A 4LJAA 5LJIA 1I1HA 1C3OA 5BPHA 4Q47A 4CG0A 4HGYA 5KEIA 3GLRA 1HNXB 2QTZA 1N7IA 4EK9A 4C03A 3BZUA 1L1RA 2WA2A 5ICMA 3PFWO 1H1LB 1CY1A 2B34A 3EXEB 2ZRMA 3ND5A 1HLFA 1AU9A 4JHXA 5GY7A 3K1AA 1LVUA 1ZUHA 6LDHA 1V6CA 3U7GA 2V6GA 3ASVA 5DE3A 1VI6A 4RIEA 1N0UA 3G8AA 5F78A 1IPHA 3RGGA 5ADUS 2ETXA 4MWOA 4B6EA 1DAGA 4V02A 5TQ0B 6AT1A 1SQ0A 1AURA 1SBYA 2EBFX 4PU0A 2JGNA 3NEPX 4CG2A 1FEZA 2JLAA 3DAHA 1ANKA 2HU7A 2QJWA 1S5PA 1ULHA 3B1YA 5KHLB 1XZGA 4WCFA 4ZP1A 4P33A 2Z57A 3MTIA 3QVGA 2XUZA 2EJCA 2X8BA 1LPSA 4DQVA 1I13A 2VDRB 5KMGA 1DOAA 5KYTA 3W4JA 2ZB7A 1ZK4A 4QUBA 4AXXA 1UWKA 4YP9A 4MS1B 4MUEA 4P4SB 4CT0A 2J31A 3AVXA 3DGEC 4JU9A 4O5AA 3EAGA 4RLHA 1VMEA 3ISVA 2OTCA 3I6MA 3PNMA 4ZC8A 4QQ8A 4B8ZA 1N6OA 5C9ZA 1TMGE 1OX6A 5L3RA 3ILSA 2WZDA 5HKKD 3E0XA 3UG7A 4YUAA 2QIOA 4IMIB 3CX6A 4MB0A 4BDSA 1HMYA 5F12A 1E2EA 5JY1A 1RJDA 3RG8A 5CFOA 2WSMA 3M0EA 1UPFA 4MVYA 3R7FA 3STXA 3KLNA 3KPJA 4A3SA 2BGMA 3HYSA 3O3OB 2KWIA 3PUYA 1XPOA 3K4QA 5FPQA 1U7WA 4LTDA 3O3CA 4P7GA 2QT1A 2W71A 4D1YA 4ARAA 4RDHA 1O89A 2NIPA 4IINA 2QRMA 2R751 5IN4A 1QGDA 5B64A 1ODCA 1M67A 2WMDA 2ZYHA 4GO1A 2VSOA 4UHHA 4PCAA 3HV2A 2MMCA 4JEUA 5LCXA 5AKYA 1SXJD 2XUDA 5FOUA 5C1PA 4NK5A 5HUHA 1VSBA 4BE4A 4PNHA 5BW4A 1JR2A 3L84A 3EY4A 2DTDA 1UDXA 2ZSUA 1KI6A 3HCDA 5AKXA 3JYPA 3D6NB 5F5NA 4Q4HB 4C6TB 3K6SB 1M5RA 3K2BA 3KU1A 3KSMA 2DUWA 1KFKB 3WKAA 2ZJ5A 4GOMD 4MNTA 8OHMA 2BI8A 1XWFA 1T0JB 2HADA 1MV5A 2Q07A 3T6KA 1W59A 1XKQA 3PUWA 3PNVA 2C82A 2ZEJA 4RANA 4IMJB 4IXTA 3BD6A 5IYZF 1I4OA 1HZJA 3OQHA 4ZVVA 4EPYA 2FDCA 1PVDA 2Q8NA 2HB6A 3Q0EA 4Q7EA 3LFUA 5F76A 3L6RA 1GR0A 2D3WA 1B93A 3NWEA 3TFWA 1L1QA 3GC6A 3NHLA 2E18A 3IA2A 2F7SA 4EHIA 4QJ3A 3MTEA 4MCJA 3O9VA 1U28C 4KZPA 2VNHA 5KTYA 1V11A 5FLEX 1H23A 1P7YA 1AF7A 3VX4A 3H7IA 4C05A 4NPCA 1U2EA 3QTBA 3CW8X 4FSHA 2XE7A 3IBCA 3EUEA 5D6NA 3R24A 1H9AA 2BHNA 3LX8A 3IIIA 4Z9FA 3SDZA 2RK6A 2EZ8A 3UW3A 2HPVA 3M9LA 3CUEF 5ALEA 1M10A 2G08A 1GG5A 5LM3A 1U5BB 3P0RA 4XVRA 2ZWMA 2HA0A 3GEHA 1RQLA 2ZYVX 1Z83A 5B6PA 2E82A 3TUIC 2AS0A 2YW2A 1VIVA 1T13A 2C2BA 2IYEA 5COAA 3NKLA 1II8B 1YZVA 3DMRA 4ND5A 2WT4A 3NXKA 4P3NA 4B34A 1I7QB 1FDTA 2IV2X 5K3FB 4KV9A 1OOEA 4HX2A 4CLOA 1UJ6A 3G2IA 3QU9A 4PS0A 4M8KA 4BUZA 2AXEA 1ETHA 1DAEA 1X7XB 1CIJA 2IHJA 3L7NA 1EEHA 2D0PB 4ZVSA 5E2IA 4CKXA 3BE4A 2IGTA 4E13A 4YMIA 4A6DA 5LOVF 4KNVA 3M33A 3F5QA 2IY8A 3GJ4A 3ZCVA 5EZ5A 5LFAA 4P0QB 1CFJA 3N7TA 4C2TA 2DSTA 5KX5B 3S8YA 1KI6B 3DSRA 4ZCRA 2P30A 3HXLA 3KQLA 4XPZA 3UKOA 3AUKA 1A72A 1JTFA 2ZZNA 1M2GA 4B1FA 4UXIA 1LVGA 3U3DA 2WU4A 4MEAA 2VRNA 1JIQA 3K4PA 4H1WA 1SB8A 2ON6A 1K86A 1SCJA 5F2NA 4DV4B 3H5RA 1RRGA 2AH5A 4F92B 4DZRA 4IL5A 2WVAA 4F96A 3CXRA 6ADHA 1DL5A 1P0MA 3P4YA 1B8OA 1L4LA 1N6IA 1T4GA 1XQ6A 3BREA 1LKZA 2XTJA 1XEXA 3T94A 1XZQA 2FFHA 5AW7A 1I3CA 1ZQ9A 1ADFA 3Q85A 2ZRJA 3BK2A 3VOSA 4CMJA 3JS5A 4LOHA 3UMSA 5I7EA 1Y8QA 3EG5A 2EJWA 1TK9A 4I55F 5LD2C 4GGPA 2BELA 5EXEA 5FQNA 4YRPA 3SIPA 3V2GA 4TWRA 3ZXSA 4B3DA 2TSYB 1IUPA 4XYLA 3FROA 4HWPA 2VH5R 1P7VA 4AURA 5IDXA 2OAP1 4M76B 2RAFA 4L4YA 2YMQA 4URVR 1KE1A 1SD5A 1IIRA 3NIWA 1FOEB 2P2CA 1CE8A 4IRXA 5HK8A 4EB0A 3D6UA 5EAIA 2VA8A 3KKMA 1G7TA 1KK2A 4X7MA 4DE5A 4PX5A 5CYFA 3C8HA 5HKAA 1FA9A 3MQ2A 3N8KA 1D2NA 4I1SA 2XRZA 2HL6A 2WM2A 1RD4A 3IUBA 5BSHA 3UC5A 3B89A 2WWXA 4GIBA 3RI3A 1GUYA 2DUUA 4IYJA 1RC8A 1SQFA 3EVAA 3DHWC 2QUKA 4HJXA 2D2XA 2HQOA 4KQWA 5AW1A 4EKEA 5E8RA 5SYAA 2BM9A 1ECPA 3BFKA 4H4CA 4J43A 3UGJA 3KQKA 4TUYF 1XZBA 1CLEA 2PK3A 3QVTA 5HW0A 1E32A 2HQBA 1W93A 3G68A 2H7CA 3EAFA 3MCTA 1EEXB 1G8GA 1U99A 4MLPA 5K3CA 2NU8B 3SZRA 1E1QD 2GPAA 3A1VA 1P1CA 3NAQA 2FSHA 3NHPA 3RIYA 5LQAA 2R65A 1EUZA 3DE2X 3ENQA 1KR2A 1XK7A 4OJMX 1WEHA 3EWAA 3JRWA 2QYSA 3IDSA 2AG1A 4LTMA 2PR2A 4WL0A 5IASA 2W0SA 5EJMA 1CLUA 1WU7A 4X71A 5CA0A 4YRNA 4AWBA 5ALKA 1EZ4A 1JLRA 2GCOB 4FDVA 3L0ZA 2RAPA 1D8AA 2G63A 5GQSA 1TYDE 3T3EA 4YBZA 5LLTA 4G0MA 1MOSA 1F4VA 2QUIA 4AJ4A 5C46F 1KZ9A 1C0EA 1LV7A 1AC5A 5AI9A 5HCUA 3VR6D 3SR3A 4YECA 3E9QA 3A9SA 5HE9A 1DINA 5DISB 2P3LA 3ABOB 3NOOA 2EX1A 2OZEA 3VOBA 2FR1A 3UOWA 4MKZA 3F6RA 1ZIOA 1NF2A 1XJQA 2PV7A 1VPDA 1PFWA 2OCGA 3EA0A 4OUKX 1FU7A 1JQJC 2VJLA 3UK2A 5A9RA 1WX1A 2W4QA 1WMSA 2ZCUA 1F9AA 2QX4A 3NRBA 3VPAA 1M2EA 2WJ3A 3YASA 1KI1A 2P9YA 4R5MA 3M6FA 4XARA 4ZEMA 2QMUA 2WF5A 1XLUA 3BXXA 4QHTA 3S40A 3GA5A 3QE0A 3K4HA 3BE6A 3OCVA 4WXPA 2JJYA 2ZUBA 1UJBA 4TROA 3FUTA 5ECWA 1ZITA 5A7FA 5BSFA 2DKOA 5EN4A 5BV7A 3UJNA 1IVSA 5JH7A 3KPUA 4LNUA 1KFCB 4OBWA 3ZD8A 3ZE9A 3B60A 1BEUB 1JU3A 4Q3DA 4R1SA 4F0JA 1GAJA 1JKFA 1Z7YA 1A9QA 2VAVA 4Q6BA 5D3ZA 4AJJA 1XJWA 5L95A 5LA6F 4KCGA 1Z62A 3I6YA 1IXYA 4XWYA 2CCJA 1YE3A 3NONA 4EPTA 4V3BA 2XMPA 4MV9A 3BXGA 4AMBA 4O2AF 1XQ9A 4NMWA 4E4RA 4DV0B 1FX0A 3SI7A 1R16A 1YC5A 3E48A 3WY9A 4AZ0B 2CT8A 1VHLA 3MWFA 4GX1A 4J3JA 2ETVA 4P54A 5IKXA 5IK2A 1RLOA 4FYMA 1T9AA 1ZMXA 3VTZA 2FP4B 2IT1A 3UUGA 5KBYA 2VP6A 4Y8VA 1GWNA 4IQFA 2X0EA 5IULC 4AU1A 3Q1KA 1C30A 4WINA 5THKA 1QS0B 4HLCA 2O8EA 5CVDA 4JK3A 1A3CA 5F23A 3LQKA 3L6DA 5IZCA 2A9FA 4EHKA 1J33A 2BR4A 1FMLA 3R20A 1HZZC 4K86A 2IEZA 1TZBA 4M1WA 3PITA 1FXWA 5LWQA 3GLSA 1TC2A 3PR3A 1KY4A 2PKRA 1J8FA 1VJDA 1FX1A 3R0ZA 2UYCA 4K9LA 4KGZA 4MQBA 1BRTA 4HY3A 1P81A 2CMDA 3D4BA 1HF3A 1NVFA 3K0AA 1NV9A 3CVWA 2HV8A 2YXPX 1XELA 1Z3IX 4MH0R 2JATA 1YSCA 3A11A 1J1IA 1QVRA 3EQ7A 4OYHA 4G0XA 4Q4JA 3R8CA 3RVSA 3RVMA 3WJAA 2FEXA 1WTCA 3HR8A 3JQ7A 3AOEA 3Q3HA 621PA 5JHHB 2BH2A 4MRPA 1H2BA 3KCQA 1VPLA 2CV0A 3PXAA 2DYKA 1VE5A 2HWYA 4F45A 3PUZA 3WVNA 3MMPA 3MZ0A 3NWOA 2Y77A 1NVUQ 3EX7C 4MV1A 3L7AA 1ZK2A 2PD4A 1XTIA 2Y76A 3GUVA 3KB2A 3M6MD 4A0RA 3VKHA 4GVPA 3TNFA 1PFQA 4OFZA 1OLXB 3HSSA 3JRXA 3CNEA 1P5JA 2ZYDA 1N3BA 1JA1A 1E89A 3GZ4A 1OKKD 3ZW7A 2D1SA 3GLQA 1M7GA 3AILA 2C2XA 1K92A 1Z3CA 1G18A 1NBAA 3T4UA 3VPXA 4B17A 1RJWA 2AT1A 4C14A 1GZ7A 3MWGA 1P8AA 3P71T 1R0BA 1WZNA 1ZR4A 3KQWA 1FLVA 1P4AA 1TT7A 1YVUA 2V4MA 3D8RA 3ND6A 3PXDA 4JJ6A 1U94A 3LOUA 3L3BA 1B8NA 4LXYA 1GEEA 5ECYA 4LMRA 1MD9A 1KJIA 1Z7EA 2O57A 2QAIA 3VXKA 1KOFA 2IS4A 3L0CA 3FPSA 3Q7QA 2P9BA 1JXMA 1MH1A 4D4MA 3C5CA 4F5ZA 2Q4OA 3Q8WA 2HF9A 3O90A 5KYXB 1EINA 1RFLA 2RHCA 3HBJA 3IQZA 3DZCA 1Q17A 4NOMA 2ZPUA 2OHJA 2PJZA 3WDSA 2H5EA 2GDJA 1R1DA 1BVUA 1XD8A 2H48A 3MBIA 4Y0VA 1R18A 3W5IA 1RYYA 1WHSB 4NBWA 5BYJA 2HHAA 3U17A 1B7GO 1OBCA 3PDWA 1TCAA 1P7PA 3GR6A 1U0HC 2VAMA 3HCEA 4EA6A 4QLOA 1U1CA 1J9GA 3L8EA 1A4XA 4YAEA 5HF8A 2UYOA 4DWJA 2GQ0A 4HEJA 4RKEA 4AX4A 3WLSA 1U04A 4D3DA 3BXHA 3E7PA 3RSOA 5J1SB 1IOWA 2I2BA 2FZWA 2K5UA 4GI7A 4TTJA 3A0UA 4LYJA 2WJYA 3IMEA 2D74A 4LBZA 1M2NA 4BNXA 1LV8A 1KAQA 3LUHA 2GAJA 1SGWA 3EZXA 1HV8A 4UMDA 1HORA 5IH3A 3Q0TA 5IANA 1GD1O 4A82A 2FSPA 4ITVA 3SKXA 2GT1A 2O50A 4R1OA 5AI5A 3NBYC 2BL4A 3OQMA 3A6HA 2UYGA 1FTWA 4OATA 4Z0TA 2FG5A 5ARCA 4UVDA 3OBBA 4B83A 1LSOA 1ODSA 4HZGA 2BKAA 1RIFA 5G0VA 3L6CA 4JR1A 1XMSA 3GGSA 1QWOA 1DC7A 2BFDB 3TTVA 4PYJA 4F4IA 5JZSA 4NWIA 4PV7A 2O2EA 1U3CA 2R6FA 3KS9A 1TUBB 5SY9A 3TTUA 3FYUC 3K70C 3D3WB 3QXSA 4RACA 3BMCB 1ZK0A 4Z9AA 1OZFA 1YZFA 4JJEA 1H8EA 2RARA 4TV9B 5EE9A 4D4IA 1HYHA 3ZNQA 1E3MA 3EC1A 2BI4A 3OWOA 3H97A 3GPLA 2BTEA 2WJAA 1KK3A 4HAIA 1S8NA 4JLAA 3FAZA 3PIRA 3PYLA 4Q9NA 1J8MF 4I1UA 5AOCA 4OOEA 4EUNA 3HWX1 2CXSA 1FP4A 5IBRA 3TNDA 5JCXA 2AJBA 2V3VA 4PZYA 4V1CI 2C58A 4DABA 2VDPB 4BRSA 2EDCA 2C1EA 1CVIA 4G67A 2CNOA 3GBSA 1SXJA 2IELA 3PPIA 3FPFA 1CT9A 3QA9A 2BSQA 4RC9A 2FW1A 4JKIA 4NZNA 4BNIA 2OXCA 2VJAA 2W48A 1X1DA 4DCJA 2XGOA 2O52A 3ESZA 1Q50A 5KC8A 1QG0A 2P62A 4IJQA 3L8GA 3PNBA 2WIDA 1Z2CA 2A8YA 3PD7A 1O94A 3UAZA 4DCOA 3PFBA 4EHDA 3ZEIA 3QVWA 4E31A 2XZTA 4NENB 3K1AB 1MA0A 4EHJA 1Q7BA 1DAPA 1NBME 5EJIA 2LCQA 2ZRLA 1KFEB 4OGKA 1V6SA 2CLKB 1GL7A 4FNOA 5FA8A 1TJ5A 3IURA 1A4UA 1VIAA 2IYVA 4MQFA 4OAOA 5CTJA 3IT1A 4G5FA 1QC5B 4RF4A 1CEQA 4WEOA 1LS6A 3DE4X 1QO7A 3R6LA 4O1IA 1Y6ZA 2PRKA 4C01A 4ND7A 4M37A 5AQ1A 1XTSA 1U7UA 4HDKA 5FR2A 5KDLA 5L4NA 4CV0A 1CDZA 1JSRA 3LOPA 1P61B 1ZD5A 1PUJA 1LBHA 3K0AB 3W3AD 1R4NA 2PUWA 3JZDA 1IZYA 1S2LA 4J0FA 5JD5A 2VHYA 3VU8A 2O1XA 1YUBA 3THOA 3P0EA 1A27A 3K0HA 3B82A 1NDUA 2GWRA 3A6KA 2QN1A 221PA 4MGKR 2ARKA 2UVQA 4RD2A 4CR8A 4EYKA 4JC8A 4ZCLA 5IJ0A 4FYKA 2MINB 2H6EA 5B1HA 1L5GB 2R8PA 4DNXA 4ZYVA 3BGIA 3RHTA 4TWJA 1N3LA 2OCYC 2O8DB 4ZT6A 4TRJA 1A9RA 1YQ9A 1GQRA 2FDXA 3C7TA 2R60A 2HK9A 3H0EA 3HDJA 3W2GA 1H2RS 1AXRA 1KYXA 1LUAA 4DCPA 3B3QA 1ZJ5A 4MKHA 1CCWA 4NBUA 2QGZA 3T7DA 2YV1A 1KKLA 2HKIA 4WBNF 3CEAA 4B9EA 3S28A 1GVNB 4G1UC 3NRCA 5KX5F 4YV7A 1X14A 2GMWA 2YZGA 2AMJA 2PIAA 2XMQA 5T6MA 3ZY2A 3GU3A 4O4JF 2W6ID 4NS1A 4WBXC 4AECA 4QOSA 1HSOA 5LD2B 3JXEA 3SKVA 1DQZA 4XIFA 3S1AA 4HVCA 1U8XX 5JECA 2X1LA 5IVDA 2CNKA 1QH8B 2G1UA 2IPAB 3PEWA 3OF5A 5ALFA 4M0MA 4DAOA 4C3VA 4BS9A 1ZGBA 3LK6A 3KQYA 1A5AB 3B38A 4LZWA 3T3OA 1PJZA 3BZBA 5BWMA 4QUJA 2J85A 3RK1A 1B6SA 2O0JA 4S1PA 4PO9A 1Z18A 3A4TA 3ROFA 1ZHOA 3I3SR 2OFFA 5A3QA 2QPTA 2VWHA 5LBUA 4E4YA 4RTMA 3UG6A 2QLLA 3WFZA 2BT4A 2PFSA 4KQEA 1R0ZA 4OLHA 1YDEA 4B6SA 1F0YA 1L8AA 4CTKA 2AG6A 3HXQA 3Q8KA 4DJAA 5HIJA 1MDFA 3C4JA 2WF8A 4QFMA 1XEFA 3MC1A 4RABA 4UHEA 4XQ9A 1JFFB 3QMPA 1DAFA 4YRFA 4CLDA 3C98A 2H2IA 2UVPA 2YBDA 5F9FA 4ALLA 4HT3B 1FNCA 2IW3A 1M1YA 4D3XA 2VA9A 2XA2A 4Y2YA 1T1GA 4I4CA 4J07A 5LOVB 1A4IA 4YJ3A 1CD5A 4N5NA 5I4CA 1BD3A 2P2DA 2X0RA 4HDSB 3E8SA 4MYRA 4TZTA 3WJ1A 1A2BA 1FDSA 1B6RA 1QCZA 3ELBA 2W2VA 4H7KA 2PNFA 3HSYA 4EG3A 1XJ5A 3HJFA 2XCSB 1ZNQO 2CLSA 4CETA 1KSFX 4S1WA 3WX0A 4FHFA 3F9IA 4ILKA 3R3XA 4TZ0A 1EG7A 2AN5A 3JD4A 3OPYI 3K3PA 4I55A 2AUTA 1PWXA 3SR0A 3LPAA 4XDHA 4GYJA 2GCIA 3WYAA 2HZ7A 3FWPA 3D7MA 3QWIA 3E9CA 1E63A 2E1RA 2BOVA 1C81A 1Z26A 3ZWMA 2WHXA 4RCYA 5GWXA 1N5LA 2GZRA 2V54A 5KTRA 3TFOA 4IVNA 5DNDA 5IC4A 2Q2WA 4H18A 2B69A 3GNQA 1B8PA 3CONA 3KQUA 3FTDA 3B9BA 4HQLA 5DTRA 5K3EA 4Y0AA 1SUFA 1BE1A 2RHMA 1C7FA 1JPUA 1CY8A 1NNUA 4LA4A 4RXTA 4Z4QA 3GMIA 3NDIA 2Q5HA 4RORA 5K8IA 2EC5A 1QH1A 2I2AA 2FX2A 3NHUA 4ZQFA 4N49A 2WD7A 2QR5A 3MT0A 4ASUA 1BSVA 1CUUA 1NG1A 1VHJA 4PCVA 4BP8A 3D3JA 5AJUA 3SBXA 3LKZA 3JY6A 1MPXA 1NIJA 4MCAA 1VM6A 3ZIAA 3AF3A 2BEUB 3Q12A 1AGXA 2BPOA 4X97A 1TM7E 2V5AA 4C4XA 3TBKA 1VP9A 3E6AA 1XMIA 2QU7A 1P5ZB 1Z2DA 3CZAA 1CKEA 2PVPA 3IAFA 3MRVA 1EP9A 4PZEA 3SBOA 3X1KA 3G89A 5C8VA 1RRKA 1JR3D 2FEWB 1C4KA 1AZTA 2YFKA 4IGEA 3GJ6A 3NC4A 4HXFB 1C50A 4ND1A 1QM5A 2Q9AA 4KK4A 2R2AA 3RK4A 2XQFA 5IBPA 3IQXA 3ROEA 3NNSA 4LJ9A 5IABA 1LLCA 3WL5A 1M8GA 1DDOA 1P1KA 1NXTA 3DAYA 2IDJA 2JIZD 3AEQA 3GYGA 3V33A 2O4UX 3CFYA 1ISMA 3IJPA 3S1LA 4GQAA 3T3GA 1D04A 2ID8A 3JQAB 5AW5A 1SXPA 2XB4A 5BVGA 3AUTA 3KL4A 5CTAA 1JEAA 1EFRA 2OV6A 2DGDA 1V5GA 1Y4DE 4NBVA 2X5OA 2PD6A 5ADWA 2FXVA 4G5RA 1R50A 2YJTD 1X1QA 1CJBA 1FDIA 3OJEA 5ALDA 5JWHA 5JADA 2JKZA 1T5BA 1UK9A 5FI5A 4YMLA 2I9KA 2O8FB 1FNDA 3MJFA 2HSDA 4ZOLA 2OCAA 3HBNA 3H0CA 1G55A 3AVWA 1UJNA 1W9HA 2ZR7A 3WLNA 5ISMA 4RNDB 1O97C 1VG9B 3HP7A 3KWFA 2FSSA 4DGQA 2Y6UA 5BXYA 3CG0A 4OFWA 3GFRA 2ZM6B 3ZHZA 1BCRB 2BGUA 4WEQA 3L46A 4QOFA 4TKUB 5TS2A 2O2JA 1H2EA 2QZ9A 3GDGA 5KTPA 4KSCA 2VJCA 3AVOA 2QJRA 3AG6A 1I7LA 1P33A 1P0CA 1Y5MA 2B6NA 2C3OA 4RZXA 4C29A 4DA7A 5BVHA 1FTGA 2Q8QA 3HCWA 3GT0A 3GN2A 3H9BA 1O0SA 4PFQA 1PSDA 2ZTHA 5J5CA 1U2TA 4DQKA 2AEFA 2Q9CA 1YIDA 2V4UA 4M53A 3TD2A 3A26A 3WWEA 1CZUA 3FYUA 3EXIA 1UT8A 3VRHA 4BKQA 3W1WA 3U7QB 3HLTA 1E3DA 4DQLA 1KORA 4OHMA 3AHEA 5GTDA 4A2WA 4UUNA 3IAAA 2C99A 1YQUA 3UAVA 3DLBA 4JI0B 4CGZA 2IU6A 5KJ1A 1O6BA 5BSMA 2ZPAA 4XR4A 1H2FA 3QG5A 1YFKA 1KKUA 3OZDA 2ID4A 5B53A 2Q49A 3O5AA 2AX3A 1SELA 4GXTA 4FT4A 1PJCA 3LHIA 3NBKA 5FADA 4DDHA 1VMAA 2WWVD 1V8DA 2J30A 4UKDA 3E2MA 2B7LA 2P69A 2O5EA 3JVIA 3X43A 1JR6A 2QYOA 3HBLA 5JNTA 4C7BA 1JLMA 2ZP1A 1QDUA 4XIJA 3COYA 4WA7A 4E2YA 5EP4A 2GZSA 4LVCA 2GF2A 2WF7A 2HT1A 3V97A 1LK5A 4IIJA 3ZIAD 3G2OA 4OMDA 4DV2B 1O6FA 2ZSKA 1J7KA 1ZESA 2WHPB 1DTWB 4O4HF 4KXVA 1UBCA 4WI1A 3NKFA 2OV4A 4ZOLB 3REGA 4FKBA 4PAOA 2E5LB 3EVDA 3WC4A 3PENA 2CJXA 5I4BA 4X91A 1UANA 5BV2P 2FZLA 5ES4B 2NT3A 1NUPA 2BDEA 1XCMA 1UBFA 3O8OB 1NTRA 2OOKA 4LF9B 3CUUA 1YA6A 1SUBA 3EVBA 3ONWA 4BO4A 1U1FA 3LUAA 4X1YB 1VL0A 1WXFA 1AHIA 1GGJA 1ECLA 1FUYB 3DKPA 1T1EA 1ZN7A 1J22A 3M9XA 3O9MA 3RBZA 5CLLA 1K7EB 2H4JA 2H85A 4NBSA 5HF9A 3LHKA 2O7RA 4RHCA 2ZXUA 4CFYA 4R16A 4HGNA 4QNRA 1UOPA 1MEOA 1T2CA 1S8OA 4COOA 1YBAA 3QVKA 2XRMA 4DBLC 2RGRA 3FY4A 3HEAA 2CXQA 3PUVA 3DM5A 3W8EA 2AOUB 2WAOA 2TRSB 4Q3NA 4PHHA 1MABB 5LP6A 4F71A 2G0AA 3ANYB 1UKYA 5FTJA 4B3BA 2JJMA 3V5NA 1SVLA 5DU2A 3D5EA 1EDBA 2JGJA 4EI2A 3E3OA 3TMKA 1Q15A 1SZDA 1QB8A 4C4YA 4REOA 3NASA 4HNVA 5K8JB 1IN6A 3HHEA 1XTTA 2Z9DA 4P58A 2H17A 5DGIA 2WVGA 1FJ2A 1NRWA 3QGMA 1C7JA 2VZ8A 4HB3A 4AG5A 3EPHA 1WQ4A 1H1LA 2FMHA 4P3XA 5L3ZA 5B6JA 3A28A 2XDQB 2QRVA 3H87A 3TWOA 4ZYUA 4HRAA 1THTA 2ESRA 4YY3B 2QTCA 1YZ3A 2V7UA 3DAOA 4UEOA 5LIPA 4MS3B 3IEVA 2V7VA 3MFQA 1DXOA 2PKEA 3ZD7A 1VLVA 3ZD9A 2GZMA 2P9JA 2W8ZA 4BZXA 4D02A 1J9EA 2I4RA 3PWZA 1USIA 3MINB 4PBRA 2ECQA 2A4KA 2QUZA 4UNPA 1PEYA 1QQ7A 4KXQA 3JARB 1HDYA 1PRYA 3Q11A