2NZJA

The crystal structure of rem1 in complex with gdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
171
structure length
155
Chain Sequence
MALYRVVLLGDPGVGKTSLASLFAGKHEQLGEDVYERTLTVDGEDTTLVVVDTWSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein REM 1
publication title The crystal structure of REM1 in complex with GDP
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 155
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nzjA00
4RCZA 1S9DA 4X8LA 1G1MA 1HE8B 2CE2X 2P2LA 2AWNA 4DIEA 3R20A 2RGNA 1RKBA 2MMCA 1OJLA 2KBEA 5KUTA 3NXSA 3TVTA 5F3WB 4Q4HB 3GQBA 3VR3A 5JECA 3CZQA 3OE7D 3EAQA 4G5SA 5AJXA 4MYCA 2ZAOA 3Q5DA 3ZDQA 1FW6A 2V6JA 3CW2A 1R4AA 3B9PA 2J9RA 3QBVA 3GCGA 4TTRA 4BLQA 3PEUA 1H8HA 1MABA 1G5PA 4A15A 2HT6A 3QXXA 1T3LA 4CYMA 1QHSA 1S4QA 2ONKA 2PEZA 4Q4JB 5FFMA 2QPAA 1G21E 2VTKA 3BFKA 2JDID 2ZR7A 1G4UR 3I72A 3IIKA 5AK0A 3L8ZA 3KKNA 5AJVB 2O8DA 2UZIR 2FSIA 2Q3MA 4ZPXA 4IDOA 4JLKA 4DLWA 1ZD8A 2RGGA 5EXTA 2ZEJA 3GLGB 1YZGA 1S3GA 2OFWA 4OQLA 2GEUA 1W0JA 1YU9A 4NKRA 1YR7A 4PC3A 3WXMA 1VYVA 3SI7A 5BN5A 3MWJA 1ZM4A 5DISB 3KKQA 2RGXA 1QBKC 2QQEA 3B9QA 4IVPA 1ZNZA 4D0LB 2A78A 2ZUDA 3VU9A 4AYWA 1QRAA 2ZM5A 1FX0B 3R7WB 4IOKA 2IXFA 1M74A 1Z6YA 3ZJYA 1N5IA 3BC1A 4PHGA 1JECA 3T1VA 4JVLA 4CEJB 3EW9A 4BGDA 1G6OA 1HUQA 2D4HA 1LFDB 4FW9A 5L3QB 3ZD6A 4HAYA 3NVAA 2IUUA 2D7DA 1G7RA 5FOXA 2YV5A 4DLTA 3UKDA 1MO4A 1RJ9B 1KK2A 1P4SA 2C77A 4IRUB 4A0FA 3RRZA 2HDNB 2PLFA 5D3MA 4ZKEA 1T9HA 5FI1B 4NONA 1XTRA 4NHOA 2ORIA 1GILA 3QKTA 1OXXK 3TSWA 4R2IA 1ESMA 4HI0E 3KZ1E 4RSGA 1R0XA 3A1VA 3EPLA 1ZYUA 4GL2A 2EU8A 1HH4A 4D4JA 4TLDA 3DO6A 3GEIA 3RS2A 1G8FA 3T61A 4ZIRA 3RRYA 2P6UA 3K09A 2IXEA 1UPTA 4YQFA 5IHPA 1W4BA 4A2QA 1KI8A 3B13B 5FBRB 4A0RA 3C8UA 2KB0A 3THYA 4H1VA 1JXMA 3FMIA 1G5RA 1Q22A 2RKOA 2C99A 5EJEA 2NG1A 1Z0AA 2WJVA 1FUUA 2GXAA 1A5TA 1YHNA 4EJSB 4JVMA 1AGPA 2WJJA 3P26A 1GKIA 3X1XA 1FNMA 1DBSA 1N25A 4BFSA 2JLVA 3BB1A 3M0EA 2CCGA 3W5IA 3QUSA 1QF9A 2X19A 3L2OB 4II7A 1G8GA 3GJ8A 3W90A 1Y3AA 3F5FA 2P3SA 5C1BA 2ZI6A 4D4LA 5BXQC 3OF5A 2RMKA 3PUZA 4KSCA 5BWMA 2OM2A 1LY1A 4IXNA 2LKDA 4L8GA 1TEVA 1CJVC 3MJRA 1YZUA 1US8A 3OEHA 4D81A 4TN1A 5GVRA 1OE0A 2QNRA 5ANRB 1EFTA 2ZJ8A 4JBYA 2Q3HA 4LYHA 3EIHA 3TRFA 2GWHA 3LW8A 3PVSA 5JWOA 4KSBA 2PT5A 2GJAA 2VP4A 4ESHA 2VP6A 3HWSA 4RFVA 3ECCA 4CT4B 1R8SA 2J3EA 4LYJA 4EPVA 1NL3A 1R5BA 1DAIA 2ORWA 1G3RA 2AWOA 4RZ2A 3TKLA 4O0MA 2A5DA 1J99A 1Q57A 2J7PD 5E95A 2AD5A 4ACBA 2DWPA 2GA8A 4JIMA 5C18A 4A8JA 5HKKD 2XOKD 2X2EA 3ASZA 2GVZC 2PMDA 2XB4A 3BIFA 4LHYA 4NCJA 4PQYA 1N5JA 3LW7A 3AP2A 4HZUA 3U7EB 1D8TA 2J87A 3O47A 5GJCA 1Z3IX 1Z29A 2WKQA 3K9GA 4QBHA 3TR5A 2I4IA 3B85A 2C95A 2DFTA 4D82A 3FFAA 1FMLA 1VDZA 1RYFA 4LJ4A 2OBNA 3PUXA 4MRVA 1MR3F 3DM5A 3BD9A 2ZR0A 1NMYA 2Z4SA 3CX7A 1Q21A 2QMEA 3X1DA 2O8FA 3W5JA 1R2QA 2YWFA 3UATA 2XXAA 4KFSA 1PZNA 1E9AA 3X1WA 5DIFA 2REOA 2WICA 1DVRA 2BVNA 1YZKA 1ZC3A 2WJIA 4TTQA 4A4DA 2I1VB 2UKDA 3BH6A 2EYQA 3FMPB 3QI2A 3BRWD 4KJZA 4MA4A 4OQXA 3U3OA 1TQ6A 2CBZA 4V0KA 1RVDA 4HLDA 1GITA 1EFUA 2ERYA 2C78A 1WF3A 1Z5ZA 2JJ2A 3EWSA 5JMTA 2Q0HA 2ZAMA 3A1UA 3UANA 3TIFA 2BMEA 4GI7A 4U02A 1BS1A 4H1UA 1S0UA 3TGPA 4DRZA 1IQPA 3HP1A 3UPUA 5CJPA 4XVRA 2O8CA 4OK5A 1F2UA 3PV0A 4B76A 1OIWA 1OV4A 3IEVA 1UBCA 3GLIB 3KFXA 4B73A 4OQNA 1W48A 1MO5A 4JVSB 1XCPA 4BEBA 4LJ6A 2PMKA 2VP5A 2C96A 1GOTA 2E87A 4M9ZA 1E9DA 1Q3TA 2FMXA 4DKXA 5EP4A 1VMAA 1Z83A 4XOIA 2XNDA 3IPYA 1E2HA 3EZ6A 3TAUA 2XTZA 3SJZA 1MOZA 1QDEA 2A9KA 1ZP6A 2J7KA 1F5NA 3I3SR 3WBJA 2GXSA 2QAGA 3LLUA 2IXGA 3QJYA 4M8NE 2QTVB 1ZUHA 3AQ4A 4ITRC 4DCVA 1SVMA 1GNPA 3I92A 3QG5A 2BBSA 4C0AC 2G88A 1IOZA 4C0HA 3NH6A 4GMXA 1JAIA 1UKZA 1XMJA 3IILA 4DLRA 1UKYA 5B57C 5B30A 1IM2A 2R8RA 2IHYA 3Q8XB 4FCVA 3JVVA 4URUR 5EE0A 5GJWC 2QMUA 5E4FA 1R6BX 4NE2A 3FPAA 3LNCA 1ZCBA 1TNDA 3CUEF 4RD4A 4P4TA 5KTYA 1P9WA 2ZANA 3PG5A 1AM4D 3SR0A 1NVUQ 1CJTC 1AIPA 1NKSA 1IN8A 4GFDA 2BWJA 4LBVA 3JZMA 4OBEA 1EFRA 4DUGD 1W7AA 2CXXA 4JT4A 4DT1A 4X8HA 1Z0KA 1SVKA 4Q18A 2A3RA 2GXUA 3TK1A 5JS8A 1KSJA 1OXTA 1CXZA 1W2GA 2J5XA 5FBQB 1IN7A 4F93B 3AVTA 4HLQB 1P60A 3H1TA 1UKEA 1IY2A 2BMDA 3KJIA 2ZQ5A 4ZV4A 3C15C 1QVRA 1S96A 2CNWA 1FNNA 1IJFA 4ZDWA 3B2EA 1G4AE 1NSTA 3DVLA 1MO3A 1E0KA 2L0XA 3RNLA 1G17A 3AH8A 1SXJA 2GJ9A 2Z43A 5FBVB 2QE7D 2XEXA 3LQQA 2QENA 3DMDA 3HYTA 3I8SA 5KPJA 2E1RA 2RGEA 4XVQA 1FFHA 4MH0R 2WKPA 4YDSA 3SBDA 4BFTA 5CB6A 1TF2A 3ICEA 1BKDR 4FD2A 3MG9A 3U3MA 1VHLA 3SHWA 4EIWA 5F9HA 1IHUA 1UFQA 2ZI5A 3VHLB 3LQRA 1LVGA 4KFRA 2QT1A 3M1IA 2PH1A 1T91A 3CPJB 3SE0A 3DHWC 5EZ6B 3FTQA 3CZPA 2PJRA 1VHTA 2OUKA 4MGYR 1IY1A 4NP6A 3REFA 2QZ4A 3SFVA 3TSZA 2IHBA 1RFLA 2R62A 2VHQA 3E2IA 4G1UC 2QPTA 3NIBA 4AYTA 1ESNA 1KY2A 4MGKR 1NBME 2HV8A 1W4CA 3U7FB 1H8EA 4HDOB 4LY6A 4KBGA 2VH5R 2C98A 5DYGA 2ODWA 5EE5B 1XRJA 1G41A 2F55A 5EP3A 3NG1A 2NIPA 4B32A 1GL7A 3E1SA 3QVUA 3RABA 1D2MA 3B5JA 4MYHA 4LHWA 2C9CA 3DOFA 4X8OA 3WNDA 4TMWA 1JR3E 2WSSA 1OW3B 1NN1A 1KI7A 3GEHA 5F9FA 2HXYA 2O8BB 1KK1A 5TARA 5K8IA 4NPHA 1S1MA 4MRPA 1KZ7B 3MD0A 4V03A 2ZJYA 1R0ZA 4PHTA 4EJSC 5EP1A 4EQ6A 4GOJA 2VEDA 2QL6A 4JVNA 2VSXA 3K0AA 4LCBA 4NCKA 3DMNA 4Q03A 5CLLA 1N6IA 1OXSC 3FYHA 3V9PA 1WE2A 4XSHA 1DAHA 4GP7A 4M1KA 1KK0A 4ZI3A 4M9XA 3QF4B 2KE5A 4DB2A 3IUYA 1ETUA 1Z6XA 3B78A 4XIGS 2XTMA 1JQLB 5B58C 1D9ZA 4Z51A 1CJKC 2QG6A 2OE2A 5KSYA 3W3AA 1VG0B 2JLRA 3OIUA 4B44A 3QSYA 3WYAA 5HE9A 5FTLA 1KJZA 2BDTA 2V55B 2J46A 1E2LA 3VNVA 2QT0A 4C30A 2WJGA 3QKSB 4LC1A 4M9QA 1JBKA 2CK3D 4FMCB 1VKJA 2RGBA 2R6CA 3ZQ6A 3PR1A 2H92A 3HPRA 2RGCA 3MJHA 4DCTA 1HE1C 3VMFA 4B48A 1NMXA 1CEEA 2XJ9A 1X1RA 2OCYC 3V4FA 4LPKA 1T3SA 1AJEA 3PCRB 1ZIOA 4YC7A 5HTKA 8OHMA 3RRMA 1VCMA 3GLHE 3AVVA 2D74A 4QXAA 2DR3A 1XBTA 2FU5C 2PX3A 3N70A 4EFMA 2C03A 2R2AA 3T35A 1D2NA 3K53A 1NRJB 2YC2C 4ON9A 1J8YF 1FZQA 3FE2A 4L5BA 3PXGA 2HUPA 4DCSA 1XXHE 1GAJA 2EFGA 4MGIR 1BYUA 1N6LA 2DWOA 3GPLA 5SZIA 4WZ6A 2ZI9A 4O2LA 3IIJA 2DBYA 2EQBA 1FUKA 4D80A 3C4JA 4TL6A 4Z8XA 3BFVA 3WRXC 4IKEA 2FE4A 3CRQA 3VTKA 1V43A 3WRYC 5J47A 4RZXA 2RGAA 5KNCA 4GSYA 3MUFA 1NN0A 5FTJA 1ODFA 2D2FA 2ZS7A 4G3XA 1AGRA 1E2JA 1I4TD 1M34E 5M04A 1K6MA 1RRGA 3CONA 1PLLA 4PR0A 4HSEA 1UADA 4XTRA 1HYQA 1P9NA 3Q5EA 4AIIA 4TQAA 4TQUS 1XPOA 1E9FA 2W2VA 3EZ2A 4Z1MD 3AP3A 5JLJA 4D0GA 5DI3A 1UKVY 2VP9A 4TMXA 5FUWA 1U0HC 2NPFA 1Z63A 3QENA 5P21A 2ERXA 4L4UA 3J81k 1XF9A 2Z83A 4KITB 2JJ1A 1OHHA 4B3XA 1GDDA 2X1VA 5C46F 1OFIA 2HLDA 3AKYA 1HV8A 4NZYA 1X1SA 5HKKA 3AVUA 2ODBA 4A2PA 4ACAA 1R0YA 1XB2A 4MRNA 4URYR 4HZIA 1PVOA 3I8XA 1G3MA 1KO7A 4TT3D 1XD2A 4NYIQ 2JEOA 4BFUA 4MKIA 4Q47A 2IYQA 2JLYA 2X77A 2DFKB 3CRRA 3T5DA 3A37A 2WAXA 4TYNA 4A1FA 4V0OA 3GP8A 5A4JA 4TMZA 3AF0A 2Q3FA 5DN6D 4KHZA 2CHQA 3FB4A 3ETLA 4Q1BA 3IEUA 4FMBB 4XH9B 1Q12A 1XJ0A 2IYYA 1NN5A 2F3TA 1RRPA 2WAYA 4IEIA 2BHRA 1M2OB 3TBKA 2QM7A 2QPOA 2CHGA 1B0UA 3ZVNA 4L9WA 3THXB 5CB8A 3PITA 1A7JA 3CF0A 121PA 4GRAA 1II0A 4PSKA 4QFMA 1CTQA 4Q1CA 4TZ6A 1SKQA 1W49A 4B2IA 3NBZC 4IOLA 1BMFD 1CR0A 3B6EA 3ND8A 4N0DA 2F6RA 5FBWB 4EPYA 3EZ9A 1AQYA 4A36A 5K8UA 3RS0A 3GJ0A 4MUAA 1UEIA 3HU2A 4IFBA 4AURA 3DPUA 4HB2A 4UXJA 4Q21A 3GJ6A 1PLKA 4PO1A 2ZROA 2SHKA 5EUMA 4WVFA 3OIVA 2IBMA 1WP9A 1A1VA 1EWQA 2XITA 2P5SA 3RS3A 1G8HA 1T8UA 5CJ2A 4XJXA 4C0JA 4LHVA 3CNLA 2P0EA 2B7CA 4KVAA 3NHAA 3P27A 1Z8FA 1UAAA 4R9UC 4ILEA 1NNEA 3A8TA 4LYAA 2EFDB 2QU8A 5AUOB 1V5WA 4OQFA 3CNOA 3ZH9B 4DLZA 5AJYA 3GLGE 4NYJQ 1G9XA 1NVWQ 2AK2A 2MSEB 4TYQA 1KI2A 4IVRA 4CEHB 4GOXA 4QBGB 5IT5A 1KI6A 1P61B 1P73A 4TL8A 3OEED 4ZDIA 1E79A 3BH0A 4KYIB 4Q7KA 4N0EA 1N0WA 4QOSA 2NO9A 3EX7C 1GM5A 2PCLA 2WM9B 3B1VA 1TMKA 2H8KA 3FGNA 1YJ5A 3OHMA 4BECA 2X2FA 4JBXA 3LRPA 2PEYA 1M7HA 1MV5A 1G20E 1Q1QA 1SZPA 3SN6A 1JEEA 2IYWA 5FPKA 5CDFE 4DIDA 5KPDA 4CVNA 2A5FA 3K70B 1OFTA 2AR7A 1TL7C 2ZRBA 1SULA 1YR9A 1N3BA 3AGPA 2ZJOA 3K0CA 3U60B 2O8EB 5G53C 2PJZA 2GK6A 4IOMA 4AD8A 2PT7A 1DE0A 1WB9A 4C7OB 1S8FA 3OESA 3QVVA 1XZQA 3K70D 2H17A 4TL7A 1AS2A 4F7WA 2G0NA 4Q9JA 3SYNA 1S2MA 5FOWA 4HUQB 5JWRA 4AY2A 4A6XA 2Y8EA 5B64A 1G7SA 2ATVA 4TLCA 5BN3A 4Y0AA 3KKOA 1N6HA 2OT3B 2G3YA 4GDFA 1W44A 1KTVA 2GESA 5FL7A 5AR1A 4PAMA 4OHVA 5IK2A 4A9AA 4DEXA 4YONB 4JZKA 2MSDB 3K0FA 4O25A 1W36B 1N0VC 3ZIAD 4ZDKA 3EZ7A 4OI2A 2JIZA 4UQOA 5EE3A 4I81A 2V54A 5HZHA 2CL0X 1AA9A 2Z5FA 3W6OA 1MO6A 3KUCA 2R44A 4DDUA 1W36D 2BKEA 3QKRA 3DOEA 3UIEA 4AC9A 3IGFA 2G1JA 2WOOA 3LY5A 2W6JA 5KNBA 1HT2E 4WA7A 3D3QA 3WMGA 5LDDC 1XX6A 2VBCA 4LSGA 2VHCA 3GFTA 3RS5A 1F2TB 3W6PA 2NO7A 4US1R 4ZKDA 4BFYA 1U0JA 3CRVA 2AHOA 2RH5A 2EW1A 4D4MA 3REGA 3RLFA 2WVJA 2GCNA 1U2RA 3BERA 3ICQB 5DHAA 3D6TB 4QJ5A 2ASEA 4HEJA 3ASYA 1YR6A 2MSCB 2KWIA 4KFTA 3W9YA 4RKFA 3C5CA 4Z8YA 4EDHA 1JPJA 1ONBA 1Q20A 3P1JA 1II9A 3Q7QA 1QHXA 4YDHB 2F43B 1OH6A 4DSTA 2WWGA 4YXWD 1MRNA 3AKEA 3CF2A 4I99A 1W2HA 3QXSA 4I4LA 1XJCA 2OG2A 3THWB 1VIYA 4AKHA 2YINC 3DKVA 3WYGA 1HTWA 1NG9A 2QBYA 4CIDA 1CRPA 4D2IA 3NEYA 4LJ7A 2J59A 3AGQA 3L0IB 1P9RA 2IUSA 3RWOA 2R6AA 4Q9IA 3VR4A 4OHZA 4NYMQ 3LAWA 2QSYA 1CS4C 2XTNA 1KAOA 1NLYA 3VR5A 3IHLA 4PFSA 4DB4A 3AKDA 1KDPA 1JQJC 4DJTA 3QEJA 2WV9A 4UXIA 3UK6A 3W3ZB 1G19A 3KJGA 1I4LD 4Q1DA 4AKIA 3KTAB 2B92A 3B82A 4WOPA 2XZLA 1GNQA 2RAPA 3T12A 1IN4A 4DZZA 1ZC4A 1SHZA 3V00A 4I1VA 3T1QA 2FFQA 4C2TA 3H4MA 2CHVA 2DFNA 3BFXA 4P3YA 4RFSB 2ONJA 1VYUA 1RRCA 5EE1A 4N3NA 5FR2A 1W5SA 3WNCA 4LUCA 1RE0A 3WHLA 4W9MC 3AF4A 4NDZA 3ADBA 4HB4A 5FUYA 1E4VA 3O8DA 3BS4A 4N1AA 1T0JB 3P4XA 4BLRA 3ZVRA 3Q3JB 2QSZA 1KMHB 2H1LA 1G8PA 3QPWA 5FPTA 3S1AB 3T06B 2QMHA 1QZXA 1UDXA 2BEJA 1Q0UA 2V4ZA 3BGWA 5FPYA 4F91B 1GKUB 4DLUA 2ZYTX 2VP0A 2JLXA 1XJQA 3UMFA 2GJKA 1HA3A 2YWEA 2EFHB 1YR8A 4PSAA 1EFCA 3B60A 4PC7A 2QGZA 4PC6A 2V8OA 3U3RA 5HCNA 1COWD 1WRBA 3H84A 4QL3A 4QGGA 2YWHA 3QXJA 4ZDJA 2XX3A 3EA5A 1E2IA 1TQ2A 1UM8A 1KNXA 2FFBA 1NBMA 3AF3A 3U44A 3GD7A 3I61A 3RC3A 4UKDA 5A0FA 4CF7A 1P2SA 2WPDD 2GJ8A 3UXMA 1PUJA 2ZIAA 1DADA 5JSZA 2RGDA 4C3ZA 1N6PA 4X8MA 1GVNB 4MDFA 3MWLA 4PAQA 1R0WA 4Q7LA 4I1SA 3L43A 1E2NA 2BEKA 1F60A 2FX3A 3UG7A 2QRNA 4BQSA 1JR3A 3O8CA 3MAAC 1HQYE 2C2HA 4M9SA 2NZJA 1A4RA 4B3DA 1OF1A 4XD7A 1Z0JA 3RSOA 1G3IA 4TWZA 3TVDA 5KSZA 3ONWA 5CYPA 4IDHA 4JL6A 1KKMA 1VCNA 5L3SB 3AUXA 4B47A 2FN4A 4FINA 3LVQE 2OXRA 1QHHB 1JALA 4CZ2A 4D0NA 1OFHA 3U7HB 1OXUA 4LWZA 3FMOB 4HAUA 5J40A 2YNMA 1KO1A 4JLJA 4JSTA 3N2IA 2VP2A 1G3UA 4U5XA 2ZVPX 2WIAA 1CBUA 2AFHE 2OCPA 1JR6A 1T5IA 4JLNA 4BRUA 2WMNB 1II8A 2REBA 4TL9A 1OIVA 1ELOA 1AS3A 1JNYA 2G0TA 3E70C 1TEXA 2X8AA 2ZJZA 1KGDA 1L8QA 2REXB 4ZCMA 2J0QA 3IO5A 3KL4A 3QY0A 2ZUBA 2GCOA 1DAMA 1E2GA 2AD1A 1ZNYA 5LB4A 4A82A 5G41A 4IHQA 1ZU4A 4QJ4A 4KCGA 2IEZA 3BORA 4AI6A 3A4NA 4YMWA 3T15A 3VKHA 2ECKA 3ZZTA 3GLHA 4B6FA 2DHRA 3FKSA 4XWOA 2OLKA 3AB3A 2GVDC 2XGJA 3CRW1 1XD8A 1OLOA 5EP2A 1QHNA 2W6ID 4Q02A 3LDAA 1SVWA 1G6HA 3K70C 1DAFA 4UNPA 1XEXA 2AXNA 4GZLA 4TSFA 2DCUA 3B7GA 3SJAA 3OAAD 1XXHA 4CEIB 1W5TA 2IF0A 4DC9A 4OHWA 5KDDA 2FEMA 1E1RD 2E9SA 4ASUD 1ZIPA 4ARZA 1W4RA 3Q85A 2FGKA 2PZFA 2CL6X 3IPXA 3HR7A 1ZCAA 2FZ4A 4DVGA 5CM9C 4YMSA 3PFIA 1R5OA 3U7GA 3B1ZA 2J0UB 1C4OA 2WWWA 4HB0A 4HDCA 2QUZA 1KO8A 1NVXQ 1VYTA 3KB1A 4Q4AA 3VAAA 3FKQA 3WMEA 4A0HA 5DNYB 3QF7A 1E9CA 2IYZA 4PSVA 4IDNA 4JYCA 5EZ5A 4NCNA 4BASA 2WKRA 4PHFA 1OKKD 2H16A 4B33A 1XZPA 4PTLA 1W36C 1YZQA 1U9IC 4EKDA 4JLAA 1NVVR 4P4SA 1PV4A 2C04A 2GETA 2FF7A 2C8VA 2WOJA 3TMKA 4E03A 2WWYA 4BWYA 4R98A 2ZJBA 1JXOA 4GOKA 1RC8A 3R9XA 1E9BA 1TX4B 1ZINA 3T34A 4MRSA 3G82C 1P7CA 1ZM3A 2YOFA 4LDJA 4Q1FA 3VX4A 2QTFA 3QIAA 3UWOA 1IBRA 1TQ4A 3ZS8A 3LFUA 5HZKA 2IS1A 3RYTC 1YRAA 1E9RA 4XTCS 4BLPA 1KSFX 2FSGA 3BE4A 4TMKA 3IQXA 2LCFA 1P5ZB 2OHFA 4JLMA 3D8BA 1RZ3A 4L9SA 1MABB 1E1QA 2ZS9A 2OESA 4KI0A 2IWHA 3BJIC 3LVRE 2ZYWX 3KQHA 3W34A 221PA 3BOSA 2PCJA 3A1TA 1Z47A 2ZRHA 2CJWA 4B3BA 1G64A 2F3RA 4M1MA 1TU3A 1ZVQA 1XMIA 2F1JA 2Z6VA 1E96A 1H8HD 2H18A 3HPQA 3QG1A 3EXAA 2YHSA 3ZZUA 5GJBA 3U4QA 4OJKA 1CKEA 1NY6A 2HF8A 4LJ8A 3OE7A 4DDTA 1J7KA 3KDSE 3Q9LA 3VU9B 4E09A 4URXR 4FCTA 4P4UA 4RY2A 5L3VA 1W0JD 1YVDA 4DSNA 1EK0A 2FSHA 2P6RA 3BAFA 3QOFA 4Q4HA 2JDIA 3PEVA 1T5LA 4RD1A 4FWTA 2V1UA 5IRCD 1U8YA 5HE8A 1RPZA 1AN0A 1WDTA 2F7SA 4B75A 4KXFB 3B1YA 1G5TA 4URZR 4NH0A 1K8RA 4M22A 4OHXA 2VHJA 5TXGA 4Q4JA 3B8HA 4TLEA 5LB2A 4K8OA 3GLFB 2FPMA 1LTQA 5D3MB 2ZU0C 4V0ME 3ZVMA 2XZOA 1O87A 2JCSA 3WMFA 4TYWA 5JJKA 3CX6A 1UF9A 3AVXA 3FHOA 3M6AA 4S2EA 3CX8A 4DLSA 3GLGA 2EYUA 1KJWA 2ZRIA 1VG8A 1FOEB 3D31A 5FH9A 3PIRA 3DEFA 1XCGB 3LO5A 2ZSBA 3VNUA 2WIBA 4BEJA 1N6RA 5TY0A 1D5CA 4U7DA 4RKEA 1OFUX 2QM8A 4C0QC 1OSNA 2R6FA 4M1TA 2FEOA 4ZIRB 1FX0A 3FVQA 3R7WA 3WP0A 3DL0A 5TVKA 2AKYA 2P5TB 1IJEA 3VX3A 4D26A 1XEWY 2QI9C 1GG2A 4Q5IA 5DH9A 4XWKA 3THYB 3A58B 4CEJA 3C7KA 3H0KA 3IQWA 1KDTA 3SU8A 3PUWA 5ELXA 4O3MA 5L3QA 1WCV1 1DO2A 4BE7B 4BLTA 3MMPA 4Q1EA 4HAXA 5JI3E 2ZJ2A 2FA9A 5CDFA 2G77B 5DO9A 3T5GA 4CGZA 1RJ9A 3BB3A 3G5UA 2IS2A 4PQFA 2IS6A 4HLCA 3NDPA 4F38A 3SZRA 4B2LA 3PEWA 1Z0DA 1NIJA 2IEYA 1CULC 2A5JA 2ZYUX 2XB2A 1US8B 3O8RA 3QBTA 3LX5A 3AF1A 3HU1A 1SVOA 2HF9A 1X86B 4URVR 4ZCLA 2DB3A 5DI9A 3OFND 4W5JA 1F6BA 2AK3A 3JZAA 1IXRC 2B21A 4J0QA 4LBWA 4AKGA 3X1ZA 4KLZA 2JASA 4KU4A 3R8FA 3OEHD 4IXMA 1E0SA 4DCNA 2OAP1 3EG5A 1S3SA 2YC4C 3SOPA 1KDOA 2JA1A 5KHOC 5FUVA 721PA 1VPLA 1DEKA 1QG4A 2F9MA 2G1KA 3RVBA 1VG1A 2J45A 1DAGA 2R6GA 2GBLC 2EWWA 4A8JB 1YRBA 2QORA 1TQDA 3CNNA 2YJTD 4EJSA 3TR0A 5K8LA 1AKYA 1YZNA 1E0JA 1Q1BA 4HZUB 2IWRA 1ZUIA 3GJ5A 4H9GA 3G0HA 1XMVA 1NF3A 4CW7A 1PUIA 1E3MA 4EPWA 1Q3HA 4IDPA 3IIMA 2Q21A 4PQRA 2JLSA 4LV6A 3SQXA 4KVGA 1KJYA 4POAA 5KSPA 3V4RA 1UEJA 2N46A 3IBYA 3B1WA 2NGRA 1TTTA 2JLWA 3L0PA 2O8FB 1RRFA 4FCWA 1ZAKA 3CBQA 2O0HA 4DWJA 2GZHA 2C5LA 4PXAA 1Q44A 2XXAB 3NH9A 5HPYB 1AK2A 1CR1A 1GNRA 1GWNA 2CLCX 2BCGY 2BM0A 2J7PA 3EIEA 3U6BA 2BJVA 4OQMA 3EA0A 3AVOA 1U98A 3AUYA 2F1RA 3MLEA 4G5RA 4W7SA 3UMSA 2XOKA 4YMTA 5J4KA 1C9KA 3OIYA 2WPDA 3A1SA 2OZEA 3Q72A 3I5YA 4DHEA 1XPUA 2ZRNA 1W46A 2OV2A 3Q7PA 2AN9A 4IDQA 4B74A 1E9SA 2VHUA 1P3JA 2PBRA 4JSYA 1SVSA 3A36A 2DYKA 5H1YA 4F4IA 4B71A 3MRSA 1FMJA 4A92A 4EPTA 1KI3A 1FL9A 2NTYC 3W8RA 4QM7A 1LS6A 2Z0MA 1CU1A 2FJUA 2IX3A 2O8CB 1F2UB 1R7RA 5JJIA 1TADA 4O2RA 1DAKA 1WBBA 2H7VA 4PAOA 3PQCA 5JCPA 2EFEB 1T6NA 2VF7A 3ADCA 2B7BA 1E4YA 4HLUC 4PC2A 1DO0A 5JHGB 2IUTA 2IYLD 2W2XA 1LV7A 3RANA 3IDQA 3RHFA 1X8LA 4IOJA 3FDIA 5A5GA 2CL7X 3CR8A 4TQ9A 2MMGA 4L16A 1EXMA 3HJNA 3U3JA 1J90A 3BXZA 5C4MA 4KAXA 5FTMA 2QAGB 1CRQA 3KKMA 5GADl 4ABYA 3K9NA 3D7MA 2HXSA 5K8TA 2LKCA 1AKEA 2XNDD 2ZE7A 4XVUA 2Q9CA 1VIAA 1GKYA 4GT1A 1A82A 1W4AA 1WQ1R 4E5UA 3NDBB 4MYUA 5CITA 3TJZA 2WWIA 1MT0A 4BFZA 2XAUA 1NG1A 4G5QA 1L4YA 1ZM2A 4D6PA 4U00A 1NSFA 2RGNC 5DHFA 2W0SA 3U61B 1GTVA 4V02A 1LF0A 1R10A 1FQKA 3KXKA 3GLIA 4QHSA 4NYMR 1WXQA 2JAQA 1XMSA 2WJHA 1N5KA 1T8TA 1UJ2A 3SS8A 5AWFC 5SZKB 1YZTA 2BBWA 2YZ2A 1OH7A 3I1FA 1XPRA 2GJSA 3ZS9A 1XNJA 2A5YB 3CWQA 1ZD1A 3ZZ0A 3OAAA 3C16C 4LV8B 4DT1B 2NMVA 3P4YA 1QHIA 4WXRA 1NMZA 1NI3A 2R9VA 3WP1B 4P0TA 5AJZA 4ZI2A 5LD2B 4EAQA 1N0UA 1OB5A 2VF8A 4EUNA 2WWXA 4P31A 4M1YA 4NTZA 5D3QA 1EFRD 2ANBA 2QROA 5AUQA 5JZVA 3X2SA 1OYYA 3A6PC 1KIMA 4QHYA 5TV2A 4YMUA 4EFLA 1KZGB 1NN3A 2A30A 1SXJB 4ESVA 1XD9A 5JS7A 1TUEA 3QPVA 3KQKA 4LI0A 4LX0A 5KSOA 3EIQA 2CNWD 5J4VA 4BZPA 2C9OA 1XEWX 3HDTA 5FL3A 2QY9A 4LK2A 4CDGA 4DUGA 1KYIA 4DBLC 4UNRA 5FI0B 2B8TA 1JJVA 1L2TA 1SXJD 1TAGA 2WJYA 5H8WA 1IN5A 4OHYA 5CLQA 1I4DD 2DPXA 3K0EA 3VKWA 2ZRCA 3L0SA 3P20A 4GZMA 1ZUNB 4G0NA 1DOAA 1OYWA 4MRRA 1JI0A 2ZRDA 2FOLA 3SHFA 2VLIA 4RD3A 4Q7MB 621PA 1A2BA 2V7QD 2ZITA 3AVPA 3LX8A 3QXHA 821PA 2CCKA 3EPKA 1M1YE 4M4SA 2WSMA 4A0GA 1H65A 4BFWA 1E94E 1AS0A 2QE7A 2BOVA 2XZPA 5JEEA 1BO6A 1OIXA 2JLQA 1SGWA 1UBGA 3KUDA 4AKEA 2JLZA 1GL6A 2C9YA 2ZRJA 1RYHA 2V3CC 4US2R 2VRWA 1E6CA 4QBIA 3QXCA 5JWHA 3UG6A 2ZI7A 1H8ED 5E7JA 1YE8A 2AL7A 2FG5A 3K09C 3NBXX 1X3SA 2XNSA 2K5UA 2QA5A 3TUZC 2ZVQX 3H2YA 3RC8A 1MRSA 2HCBA 5C4GB 4TYYA 4XSGA 1NIPA 1P2VA 2WBLC 2ORVA 5HCIA 2ZRGA 2UVQA 2PLRA 5FTNA 1Z07A 4FWIB 4BUJA 1ZD9A 2ZS8A 3NEJA 4JYBA 4B35A 4EQ6B 2BBOA 4HB3A 4LHZA 1KOFA 2WSSD 2YKGA 3K0AB 2J0VA 4UNSA 4KO8A 1I2DA 1VCIA 2IT1A 4LJYA 4MQBA 2RB4A 4OYHA 3FFBA 4WXPA 1SKYB 5EXXA 3GJ3A 3LD9A 2ZE6A 4NU0A 5CIQA 3AVWA 2GRJA 4B6EA 4QGHA 4RD2A 5J4YA 3AV0B 4C0BA 2ZRMA 3U6KA 3FOZA 3TUJC 1ZU5A 5J5CA 2YVUA 2IYTA 5JCZA 1NKTA 2F9LA 1U0LA 4UNNA 4LJAA 4Y0VA 2GXQA 1GFIA 1GRNA 4UJ5A 3EASA 1NJFA 1CLUA 3RS7A 1TF5A 3EARA 2DY1A 1AZSC 2BJWA 3RRNA 2QN6A 1U81A 4JL8A 2BV3A 2F1HA 2FFAA 2V1XA 4DCUA 2O8BA 4M1SA 4FMDF 1Q1EA 3GLFA 4DLXA 4C9BA 3NBYC 4A8JC 3VFDA 5F2EA 2XSZD 1EGAA 3W8NA 4FI3C 1TU4A 1W0KD 4LZZA 3SJBA 2NPIA 3U2QA 5LPNA 2GDJA 2FPKA 2W0MA 4FXPA 5FOTA 1FP6A 4P33A 4UNQA 2IS4A 2IC5A 2QQ0A 3QF4A 1NJGA 4LHXA 1B23P 2VIIA 1IXZA 2OLJA 2PZGA 2OILA 4QM6A 2CK3A 1KSGA 4PZLA 5B2ZA 3A1WA 1QHGA 1GUAA 1M6NA 1ZJ6A 3MWYW 5H70A 3WNBA 4F92B 3EZFA 5JJLA 3PEYA 5CYOA 5L3RA 4KYUA 3SEAA 3MWKA 5SZJA 4R2HA 5JRJA 2JLUA 3I5XA 3FMFA 3I73A 4GPTA 3QKSA 1BYIA 3SC3A 5E7MA 4LGMA 3NC1C 2IF2A 1U94A 2GHIA 1Z0IA 3GLIE 2CVFA 1E2MA 1Z22A 3KQNA 4KBFA 1E2QA 2YWGA 5IDVA 5TMPA 1KSHA 1XU4A 1UBFA 1J8MF 3VR1A 3OFNA 2FPLA 3KXLA 4QBFA 3RWMB 2BMFA 4A6PA 5DYIA 2D3WA 1GRQA 1XTKA 3LWNA 4I1UA 2BBTA 3ZQJA 1E2PA 4Q19A 2P65A 1DPFA 4IJMA 5DI3B 5TDHA 1P6XA 5DGXA 4JLVA 2GAOA 2LWIA 4AG6A 1QG2A 3GMTA 2GZDA 1C1YA 5KOYA 2ANCA 4KFUA 2H57A 4RZ3A 3KXIA 2G83A 4ZO4A 1KI4A 4HAVA 5JI2E 2HT1A 4PANA 3SJCA 2RCNA 3N2EA 1LF5A 4YLGA 4MDEA 1QVAA 5C2JB 1ZNXA 1XD2B 2JJ1D 1OHHD 5CM8B 2ZI3A 3KFVA 4Q01A 2HLDD 3CPHA 4LYFA 3DZDA 2HYIC 4GP6A 4V0MA 2GKSA 4B3GA 4JJKA 4OJQA 4Z1MA 1LW7A 4JLBA 4D4KA 4LOAA 2QAGC 1Q1ZA 1EESA 1P72A 2ZRKA 4BLSA 1N6KA 2GK7A 2GILA 3AF2A 1NY5A 4NCHA 2AXPA 4P32A 3W6NA 2V9PA 3CO5A 4DSUA 5FUXA 1MH1A 5TB5A 2PL3A 3GEEA 1G16A 4LBYA 2I1QA 4HAWA 5G40A 1CJMA 2VHTA 1LS1A 4Q9KA 1WA5A 3RDPA 5JRZA 1DS6A 2GAAA 4TT3A 2Q6TA 2JATA 3E5HA 4Z54A 4LJ5A 3QNUA 4GMDA 4WIAA 2BC9A 2FNAA 1E2FA 2VSFA 1LB1B 1Z6TA 2EWVA 2ZPTX 2BMJA 3EC1A 3GJ7A 4KODA 4RVCA 5CIWA 1GRRA 3X1YA 3KX2A 4CRWB 2ZSEA 3EC2A 5DN6A 3TAHA 4D25A 2ZRLA 3DDCA 2FZLA 1BOFA 2RHMA 1ZNWA 3RS4A 1TF7A 2WWHA 4EPXA 2OSBA 1XDBA 2NO6A 2VQSA 2IK8A 3P32A 1FTNA 5LD2C 1VECA 2R65A 2YOHA 3SYLA 1N6OA 1TUIA 1KHTA 4JJZA 2QP3A 1G291 4PPGA 2UZ3A 4NL4H 2WMOB 1DARA 1BMFA 1IONA 1Z08A 1SXJC 3TNFA 3THXA 1SHKA 4IW3B 4E22A 5KYKA 2BKUA 1XP8A 4PZZA 5EUQB 3L82B 4G5GA 3SFZA 1DAEA 1G18A 1KI6B 1NLFA 1Z2CA 5FBLB 4MYTA 3TH5A 1U8AA 2ZE8A 3QKUA 1VG9B 2FV8A 4QKQA 2JJ8A 3IBGA 5AUNB 2PZEA 4QC2A 2W58A 1KI9A 3PJRA 1UBEA 1FP7A 1TPZA 4JLDA 4Q9LA 3R9WA 1E79D 2W00A 4HYYA 4Q9HA 2IA5A 5BYJA 2BIFA 4DDWA 1XTIA 3O8BA 3GLFE 4RCYA 5BYKA 4TMVA 5H68A 2HCJB 1E2DA 1SQ5A 5IF9A 2J0SA 5BQ5A 3I32A 1KKLA 1E32A 2ODNA 3CLVA 3CIOA 3RAPR 4BZXA 2ZTSA 4AG5A 3OEEA 2FDCA 1G7TA 3KQLA 3HYRA 3I62A 3F8TA 5SZHB 4E07A 3EWAA 4OK3A 3VKGA 1KO5A 3LA6A 3KJHA 1ZW6A 4CEHA 1M7BA 3F0TA 1EX7A 2D62A 3GJXC 2BM1A 3VHXA 1OH8A 4B3CA 1EX6A 1M8PA 2CE7A 2OBMA 2Q9AA 1MKYA 4M2LA 3K0FB 3ND9A 4DLYA 4QNRA 4EFNA 1U90A 1Z6GA 4QG7A 3THOA 2ZSAA 1P2UA 5FOVA 5JHHB 4AYXA 1IXSB 2GZAA 2OBLA 2O8DB 5FL7D 3AM1A 5IK2D 2QGNA 3BH7A 1GZSA 4JBWA 5L8VA 5DE3A 1HT1E 3QKRB 2ODEA 4F4JA 4TYPA 2JIZD 4BLOA 3TQCA 3B1XA 4Q00A 2O8EA 1P62B 3TW4A 3SQWA 1CP2A 3SBEA 2FH5B 3MGCA 4JLOA 4WAUA 1P2TA 4OI1A 4XWAA 2O0JA 5G3ZA 2WHXA 4C7OA 5EQTA 1DTSA 2V7QA 4MITA 5FPSA 1W47A 2KI5A 1U8ZA 2ZI4A 1IN6A 4HAZA 1IY0A 3A4MA 2VA8A 2A5GA 4HUQA 2HYDA 2NO1A 3AVYA 1N2CE 2W6JD 3KQUA 3ZIAA 1NP6A 2YOGA 3C14C 4QJ3A 4MKGA 4GBMA 2KSQA 3NHBA 2VYFA 1YQTA 1XFAA 1AQUA 1F3OA 2CCJA 2P6NA 1XTSA 2CEAA 2EFCB 4DSOA 1K5DA 5KO2A 4NYIR 5DSZA 3FHTA 3A4LA 3I4LA 1U9IA 3L8YA 1U99A 1VCOA 4PZYA 1DG1G 3NTUA 3TW8B 5JFGA 4HDQB 4V0LA 5FR1A 1FQJA 2GEVA 1ZRHA 4PO8A 5UKDA 3WYFA 5EXPA 2VL7A 4WBSA 2OO7A 4LJ9A 4AWXA 1HQCA 2QMOA 2WTUA 2AFIE 2WWFA 2QBYB 1ZBDA 2KJQA 4JLPA 5CK5A 4A2WA 5AUPB 1PLJA 5KNDA 3UMRA 3LBIA 2O0KA 4UXHA 3CH5A 2QRZA 3TUIC 2D2EA 3UWKA 5KDOA 2CLDX 3R9IA 2DFLA 4PX9A 4Q48A 1PJRA 4QGAA 3SDZA 1GIAA 4C0SA 2ZU6A 3JVUA 4US0R 1F2TA 3BBPA 1HURA 3IKJA 2GEDA 2ZSDA 3CKLA 1OB2A 2KBFA 2OAQ1 4C0LA 2HJVA 3F3YA 2OEPA 521PA 5DLQC 5LBIA 4NBSA 4JKYA 2FWRA 4YXWA 4G01B 2IL1A 2NZ8A 5FTKA 2QAJA 3QE0A 4JL5A 4RZUA 2QTHA 1T3HA 3CPEA 1CR2A 4LV5B 5HR5A 1N6NA 5CK4A 1XTQA 4JT2A 3CH4B 4AK9A 2F43A 2FFHA 2OCAA 1R5NA 2Q9BA 3LV8A 2CLSA 5FOSA 1VTKA 1S1CA 1G7CA 1OPXA 4IEEA 1CF4A 3N5CA 1E0AA 3THWA 1KDRA 5J4HA 1DG3A 1SVLA 2VSOA 1HEIA 1HY3A 3IHWA 3L0OA 1Z28A 2XSZA 2GNOA 3SNHA 3GJ4A 4NYJR 3AVQA 3ZYCA 1W0KA 2J41A 1K5GA 2OCBA 4OK6A 3VR2A 1JJ7A 3MCAA 4B3FX 1J70A 4PPNA 5FPHA 4WW0A 1UDWA 4PO9A 4PPQA 3PUVA 3KTAA 1RW4A 1Z6AA 1NVVQ 1E98A 2CDNA 4NCIA 4GNKA 2GF0A 1ZM9A 4PHHA 4M1OA 3RSLA 2N42A 4PC1A 3TLXA 4RD0A 1YZLA 3U44B 3LH5A 4LPSA 2ATXA 4RFSA 4JS0A 4WZAE 2IYRA 3QQ5A 5JSZB 2A7QA 4OI4A 1T0HB 2P67A 5E3HA 2RHDA 4LBZA 1KAGA 3ADDA 4I1OA 4BFXA 1NBMD 2BCJQ 3DZ8A 3SYKA 1KMHA 3PENA 1KNQA 1ANKA 1KO4A 4JKIA 3S1AA 4DDVA 4Q1AA 2VO1A 4LRWA 3BWDD 3FWYA 3OZXA 3TE6A 3K9LA 3C5HA 4W5HA 2PX0A 1COWA 2FSFA 1E2KA 1OXVA 3M4YA 4JMPA 1M7GA 2V6IA 5GVSA 1D6JA 4MGZR 2QP9X 2J1LA 1JR3D 3CRMA 1D2EA 4URWR 1X8JA 1D9XA 3LBNA 3LXRA 1XCMA 1KI1A 1LNZA 1Z0FA 2OFOA 3HU3A 4IFEA 2CVHA 4QGFA 4XD7D 1GP2A 3FHCB 3QPUA 4S35A 2O5VA 2O52A 1ZM7A 5EE9A 2QEQA 1E69A 4M1WA 5AJWA 4OI0A 2GTPA 3C41J 1X6VA 1DELA 1XEFA 1Z06A 1II8B 1KMQA 3T1OA 4M21A 5G3YA 4QHTA 3OIWA 4BRWA 6Q21A 2FGJA 2ZRPA 4EPRA 3KJEA 3CM0A 1BH2A 2QP4A 3BK7A 4F4CA 1R8QA 2JJ2D 2NOAA 3AKCA 3KB2A 4TTPA 5JEDA 1JB1A 3ZLJA 1SXJE 2GCOB 1X8KA 4DEYA 4WZBE 3ZGXA 1XTJA 3QEOA 2YYZA 2G6BA 2ZR9A 3CWZA 4CT5A 421PA 3LBHA 2HEIA 4C4PA 4R71A 3NKVA 4KLNA 3EPJA 1KK3A 3VR6A 2AX4A 3GLHB 4FMCF 5L3SA 4TLAA 2GBLA 1YKSA 4DXAA 1QHHA 3ZD7A 4NMMA 3ZVLA 3NC0C 1EG7A 4TLBA 2ZYVX 2A2ZA 1F48A 1EFHA 1GSIA 1CIPA 4QRHA 3WBKA 5F98A 4V0NA 4MKHA 1S9HA 4RJLA 1XEXB 1Z2AA 4B2PA 3FKSD 2CMKA 2OFXA 2B8WA 1XXHB 3K0CC 5E7IA 4K46A 2B6HA 4Q7JB 4ZCIA 5GJVC 4ARZB 3ADKA 3U5ZB 4G5OA 3CB4A 3U3KA 2XJ4A 2ZETA 1JEDA 5KDLA 4TSFD 3H86A 4Q66C 4FIDA 4DLVA 2H5EA 4B43A 2JGNA 2D7CA 2IYSA 2ZRAA 3DM9B 1CJUC 1XWIA 4Q4AB 2AKAB 4L15A 3TSOA 1I2MA 4C0KA 2Z4RA 3K0SA 1FTSA 2W6IA 1L4UA 3MSXA 1A2KC 2G9NA 5J4LA 1RIFA 1EWRA 2TMKA 4MUBA 4ERNA 3AEZA 1OH5A 4W5WA 3GFPA 5KU1A 1AZTA 3AP1A 2NQ2C 2ZSFA 1NLZA 4UJ3A 4P4SB 1GL9B 1E99A 1E9EA 2I3BA 3MFYA 4C2UA 1E1RA 4TZ0A 4ASUA 5JBQA 3GFOA 2N1BA 2ZXUA 2HJGA 2W83A 2OXCA 2ZE5A 3T1TA 4HATA 2ZJ5A 4HUTA 3R8CA 3KKPA 2ZRFA 2W2TA 4OL0A 5EXSA 1KY3A 4CEIA 1SKYE 4R7ZA 3CR7A 1W1WA 4K81B 5BW8A 2F1IA 1JPNA 2ZJAA 4KV9A 4M53A 1WBDA 4YMVA 3LXXA 1IAQA 2ZUCA 4HLUA 2GF9A 3WY9A 4LC0A 1OKKA 2DWQA 3CF6R 1Y63A 3TQFA 2J0UA 1G8YA 2R6DA 2VPPA 2EVWX 4FMDB 2IYUA 3BB4A 1BIFA 4FN5A 4RD6A 3LLMA 2IW3A 1N5LA 1J2JA 1WMSA 2CJWB 2GCPA 2WZQA 1JAHA 3NWJA 1ZMXA 4PPFA 1T4GA 2NO0A 4IVQA 3EPHA 1E1QD 1CR4A 3HR8A 1OT3A 3K9HA 1G3QA 4TMTA 5BN4A 4BPBA 4OKSA 3WHKA 1P75A 3U4QB 1E2EA 1O3YA 1QHYA 3PUYA 3IO3A 3K1JA 3DKPA 3K8YA 3NBFA 4Q4LA 2ZREA 4QNMA 5FOUA 1L7VC 2D06A 4MKFA 2IYVA 4BZQA 4BFVA 4M0LA 3VQTA 2IYXA 4B34A 1SVIA 1FPMA
chains in the Genus database with same CATH superfamily
4F04A 3CGWA 2DPHA 4X8LA 4OXRA 1GVHA 3ZK8A 3RAFC 2O8VA 2P68A 2P3QA 2P3LA 1RKBA 2C31A 1QCYA 2VJCA 2IOQA 1KR5A 2MMCA 1OJLA 4PF1A 4V3CA 2HZBA 4QQNA 3RBVA 2WHYA 3GUVA 1OLXB 5F3WB 4Q4HB 4XASA 3NIWA 3VR3A 4MI9A 3OE7D 4X3PA 4H2DA 2E37A 5D85A 2B78A 2ZYHA 3N2YA 1N4DA 3W2EA 4Z7NB 1AA6A 1MABA 1SU4A 1K5HA 3E7DA 5BWCA 2DMRA 1QHSA 1S4QA 1T5DX 2C4TA 2PEZA 4Q4JB 5FFMA 4CMIA 4BQPA 1G4UR 2HA6A 3IIKA 3R2JA 5HGXA 4OU5A 2FFJA 1Z8DA 3R23A 4N54A 4YQZA 5TGDA 5AJVB 4LCEA 3JZFA 1P5HA 5DDIP 4ZPXA 2Q3MA 2QV0A 1ZD8A 1KEVA 2A92A 2D1FA 4FLMA 2G4VA 5JT1A 1KVQA 2UYHA 2ADFA 3PHBE 4WESA 5DKFA 4MI6A 3WISA 3DLPX 1W0JA 4A5SA 5JCJD 5JSYA 3SI7A 3MWJA 5FHRA 1FJHA 2A9OA 4MUXA 4NMHA 2PK3A 2RGXA 1QBKC 4R1TA 1JEOA 3PJEA 3LDHA 5HWSA 3WYCA 2QIOA 1GPKA 4Z7QB 2ZB7A 4AYWA 7ABPA 1FX0B 1H05A 1QFZA 3GAZA 1RMTA 4QDKA 4PG7A 4IOKA 4E5KA 3ZJYA 1JEYA 2CXRA 3RYIB 5JAUA 1N5IA 3Q10A 5KYTA 1T8RA 1TB4A 1Z2OX 1I6MA 4CUZA 1FFSA 4BLWA 1NXTA 4F2HA 3WA7A 1G6OA 1F0NA 4WKNA 1LFDB 4TV8B 3CMMA 3VKVA 2I8LA 3WL5A 4OTZA 2QX4A 2RCYA 4JWTA 3SX0A 1SB9A 3KPVA 3H5RA 3NVAA 1L5LA 3H75A 4WK2B 4NFLA 3ZY6A 3TLYA 2YV5A 2ZQYA 5TE9A 1PGOA 3UKDA 3JQAB 4RSMA 1PSWA 4K9OA 3UJ8A 3DEYX 1SXHA 2C77A 4KAJA 1ZWKA 2YV2A 4MV7A 4GUAA 2OO3A 4UVIA 3KAJA 1XTRA 5KTPA 2ORIA 1GILA 3ESQA 4XIYA 1SMKA 3TSWA 1MJ5A 5BRJA 1U7TA 3I6IA 3Q12A 5AKEA 3KZ1E 1U7HA 3EVZA 3PZBA 4H0CA 4RSGA 3SVTA 2FPIB 1SQ0A 3EPLA 1E61A 2EU8A 3KJNA 4IIBA 1T8SA 1BXGA 1TC2A 4HVLA 2OKGA 1HNZB 3IAHA 2XOXA 3BDIA 3DO6A 1KZ9A 4ER6A 1EG2A 2Z98A 4ZIRA 1V8FA 5C8YA 3CLUD 2EL9A 3GRZA 3KT6A 4ZZIA 1YOVA 3BXHA 1W4BA 3QW2A 4WNAB 3RC7A 2BTQA 1AQJA 3DAGA 2KB0A 4H1VA 1G5RA 1I1HA 1RHQA 1V9SA 4EF5A 4XDZA 3IT3A 2NYUA 3BZUA 5HIJA 4U4AA 1QXSA 4FJ2A 2VHYA 1Z0AA 4W8GA 4R8VA 1P1RA 2GXAA 3CUVA 2HA7A 1NYTA 1AGPA 3D4OA 2YNMC 4KH1A 4YROA 3U4GA 3O0TA 4B8WA 4LOJA 5EJFA 1L3CA 1C9DB 1N25A 5A6SB 3TCKA 3TVYA 1G0NA 2JLVA 4O4LB 1REQB 2B94A 1BAPA 2DQYA 2VH1A 3L2OB 3LLVA 2AMJA 4II7A 2CLFB 1S8OA 4NIMA 1BFDA 1XKTA 5HYVA 2RMKA 3ABRB 4KSCA 1RE1A 1LY1A 4IXNA 4FHZA 4WL0A 2XNCA 4L8GA 1TJ4A 1Z56C 3QXGA 3JWEA 1JUDA 5I7VA 3M1AA 2AJCA 4EO7A 4CGYA 5F76A 5HKBA 1MFZA 3G2OA 4RHCA 3LC2O 1N2CA 4G97A 1CUIA 3PQ3A 5CA0A 5LZ9A 3AEQB 4LYHA 1GCIA 3DGFC 3GRCA 3EIHA 4FE7A 4C6RA 5JWOA 1X1CA 3PVSA 1FMCA 2QN9A 2GJAA 1C0KA 1HE5A 2DFDA 2VP4A 5BSHA 4OB6A 2CLHB 3N76A 4RFVA 1T9KA 5FI5A 2J3EA 4LYJA 4P80A 1P3DA 3BA1A 2EWMA 3V7FA 2I4MA 2PPVA 2Q0XA 4ZJUA 3V8QA 5JH7B 3BJMA 2A5DA 1B1CA 4BNMA 1Q57A 2J7PD 2OVFA 3ZGZA 1NXPA 4JC5A 4WTOA 2GA8A 4QT4A 2VZ0A 5HKKD 2XOKD 2X2EA 2C4HA 3ISVA 4NCJA 2J6IA 2XB4A 3C3WA 4PQYA 3PNPA 5AKGA 2AN1A 3LW7A 3AHIA 1CUSA 4HZUA 3V2GA 2AFIA 3ZTYA 1WNFA 1TFUA 1Z29A 2WKQA 5EZYA 2I4IA 3F73A 3W8EA 5TQ0A 4BKMA 2H1HA 1RBQA 1Z4JA 2XRFA 2P6PA 4AO6A 5JYCA 5LIRA 5B1SA 4LJ4A 4NF2A 2H2WA 4MRVA 4WUVA 1MR3F 1Y82A 3DM5A 3L1JA 5LZ5A 2Y93A 3HM2A 1F0YA 3X1DA 3MB8A 1Z5WA 1XCOA 4RPKA 5ALHA 5KSWB 3BQNB 1NVKA 2GPNA 4Y3UA 3HN7A 1R2QA 2YWFA 1OAOC 4UD2A 1P81A 4HDRB 4B8YA 1GCOA 5CT8A 4F85A 1QG0A 2OGSA 2OQIA 4E3ZA 2XD9A 5DLYA 1M67A 2ZSHA 4ZEMA 2WICA 4QD3A 1VXRA 4CF5A 1KY4A 1DVRA 5B2FA 4R8SA 5FLKA 2PXHA 2NTVA 4TTQA 2I1VB 2VCHA 3BH6A 2EYQA 3ED1A 3COWA 2OK7A 1AT1A 3IEXA 4HRXA 4IIYA 4KJZA 4MA4A 3T54A 4QFDA 1Z68A 1RVDA 1H5NA 4HLDA 4EGFA 1PJ4A 4J7XA 2ERYA 3B89A 4ZALA 3GGPA 4MUIA 4WLFA 1C3VA 1D4AA 3EWSA 3VNAA 4AS2A 2HA4A 3BKWA 2BFPA 5IC6A 2VJOA 3DE3X 3I0MA 1CWUA 3H5OA 4RPCA 3SZOA 1HLDA 4EM6A 1B6GA 4RTLA 5CG1A 3HEAA 3GJQA 3IHKA 1KYXA 5KTNA 3UBTA 2HI0A 4PQEA 3JQ9A 4P38A 3JZIA 1NUUA 2EP7A 3HP1A 4R2LA 1T8WA 3JD4A 1LRLA 1TZJA 1X1TA 2BLLA 2IHUA 2TMDA 4KACA 3ELBA 3GGOA 3NYWA 2XUZA 4K9DA 4EYGA 2O8CA 1MDFA 3FFXA 5C1PA 3PV0A 4MWEA 1K7FB 3L7AA 3FI0A 4MDHA 5LBTA 5TJHA 1KZ1A 1S6YA 2JCVA 3GLIB 4EECA 4OQEA 1W48A 3FWKA 3HLYA 3T4XA 4BB9A 2MYPA 3I2KA 3OCYA 3OM1A 3TDMA 1F4PA 4BEBA 5IXYA 4PONA 3USES 1E9DA 3W7VA 5JSFA 2B5WA 4BFCA 4Y0NA 2X3FA 3EFBA 2XNDA 3GGGA 3QOXA 2XWSA 3LPLA 1J0CA 3TNYA 1ABBA 5AW2A 2ZBUA 1QDEA 4TRJA 2R8YA 1XZNA 1JP7A 4WZAA 1MF7A 2BHSA 4EG3A 2J7KA 4PG4A 4DARA 3DR3A 3MW8A 2X42A 1XQ6A 1X9IA 2HA0A 2IXGA 3KT3A 3QJYA 4M8NE 3PX7A 4WVLA 3AQ4A 2A58A 3ESBA 4Q93A 1GNPA 4QO7A 5ALZA 1CY8A 3U09A 4ZV9A 1IM8A 4HNVA 3JQ7A 5AJUA 1LLQA 2K7ZA 2I55A 5C7IO 3TLJA 1T9AA 1XCJA 1ZNQO 4RBNA 1OTHA 2TECE 4EYQA 1P6QA 5ALIA 2QRKA 1QF6A 4DV0B 1KH1A 2ZSJA 2B0CA 3L5OA 2A0XA 4KK4A 2FPXA 2HHJA 3G9QA 4FCVA 3WQRA 5E4FA 3NEPX 4J94A 3FPAA 5IMSA 1L8XA 3BEOA 1TNDA 2MJLA 1I3NA 4P4TA 4ZRNA 4B5LA 2R7NA 3PG5A 1V47A 1AM4D 3SR0A 1M0WA 3RFXA 1AIPA 1N7IA 2FWJA 1ISMA 1DKUA 2Q1SA 1V5EA 5G1PA 2BSAA 2PSFA 5EZQA 1EFRA 2AFHB 3QSGA 4HN9A 2HXGA 4KGZA 1Z0KA 1EEXB 2OMEA 4Q18A 4PGHA 1O94D 1QIJA 3UC5A 4ZEVA 5JS8A 1G63A 1CXZA 2BKAA 4XUCA 1GT6A 3AHFA 4AZWA 1G8JA 3AVTA 3LC7O 2WJ4A 3D6UA 5IJ9A 2BMDA 2NO4A 4ZD6A 3JD1A 4W9NA 5K45A 1RQ2A 2ORYA 2MWMA 1U3CA 3CZAA 4F72A 2CNWA 1FNNA 1XDSA 4BMOB 4ZDWA 2YH2A 3B2EA 4S0XA 4U5QA 2V6BA 3ONDA 1JVSA 1G4AE 4PBSA 4F2GA 1C50A 2O05A 4IF4A 1UT8A 4D8XA 1NTRA 1I36A 2JBWA 3MS2A 2IFTA 4H7DA 5AMXA 5J59A 1BHO1 3OC6A 1AZLA 1W87A 2XEXA 3BAZA 4YCBA 5FBVB 3LQQA 4QEKA 5H02A 4K03A 3HYTA 3ULKA 2OQVA 5KPJA 1ZCZA 2E1RA 3L92A 1JN0A 1UWLA 1VJTA 2FW8A 2WKPA 3NDIA 4JX8A 5K0LA 5CB6A 5E4JA 5BR7A 4LGVA 3UGJA 2Z2IA 3HY3A 2TYSB 1LJLA 4KREA 3NUQA 4O8ZA 5DP2A 5ICCA 4RAQA 1MNAA 3OD1A 2QS9A 1I6WA 1W59A 2L19A 1JJBA 3LQRA 1DP4A 1ECPA 2WE7A 4P9NA 3LPCA 3FN4A 4KFRA 3U1VA 2XDQB 4TWAA 1IBSA 1K7XB 3GARA 2R86A 3QH4A 3LT1A 5ICSA 3PXEA 4YIKA 5EZ6B 4GIBA 3FTQA 1RJGA 1X77A 3CVJA 3R41A 4LAFA 2OUKA 3GG9A 4PYOA 2B4QA 2Y0PA 1EJBA 3WNZA 3SFVA 1NAHA 1CQPA 2LE0A 4G1UC 3OQIB 5TQ2B 4DV7B 1ESNA 5C4IA 1E62A 4MGKR 4ZU1X 1HETA 1VE1A 1NBME 2I29A 4OVKA 4UD6A 1H8EA 3GEDA 1SBTA 4BN4A 4MKZA 5KNCH 4BZZA 2GEBA 2R79A 3DTNA 2C98A 4KBGA 3GOHA 5DYGA 3RIGA 5EE5B 4NNOA 2J48A 5CVUA 2C7VA 4Q4CA 1HDGO 2X14A 4P0QB 3U9LA 3ZCXA 4UDXX 4ZN6A 4ETIA 4X8OA 3VVBA 4TXNA 5LVAA 4HGPA 5K6RA 3WC4A 1NN1A 4QQFA 1PR4A 3MJEA 3OQ6A 5HF6A 1EX1A 1H4TA 1P8JA 4HH0A 3TW0A 5C34B 2J08A 2QN7A 4KN8A 2VRCD 4LA4A 1S1MA 4OHPA 1EFVB 4PX3A 5BSVA 2O2HA 2YDXA 3FTCA 4GECA 1JHMA 2X0IA 4EX6A 4EJSC 1Z2DA 1RYDA 2VEDA 4GOJA 4LWPA 2O5CA 4QLBA 1XMOB 4FOPA 4C03A 5F35A 4NCKA 5CM2Z 3D8HA 4PSDA 4Q03A 5FNZA 2ODQA 1EGMB 3T52A 3N6RA 1N6IA 1LD3A 5CFPA 4J7CA 1M8GA 4GRIA 3TDKA 3CXUA 4GXRA 4H77A 4GP7A 4XFJA 1KBQA 3WGYA 1A5SB 4HHEA 4BGEA 1ETUA 3WWDA 3SMQA 4ZZ1A 2VPZA 4LK3A 5GWXA 1WUJS 1MENA 1XEAA 5B58C 4PFQA 3RFVA 2XBLA 3B6KA 3QE3A 1ZGGA 4AG3A 5JNUA 2OE2A 3PHHA 5KSYA 1VG0B 3OIUA 3C85A 1N9KA 4ZZ2A 2Q1TA 4N0PA 2SBTA 3LLSA 1QTNA 2BDTA 2W6MA 4DNPA 2V55B 1B16A 2QT0A 3CMCO 4RACA 1M6HA 3QKSB 3TD6A 1KH2A 2BFNA 4NXMB 3OMLA 5JROA 2R6CA 1SOAA 4GOLD 3PR1A 1O08A 3ZQ6A 4EL5A 2VQEB 3HPRA 2RGCA 3ELUA 3OUZA 1H3EA 1MZPA 1HE1C 5KYXB 4B8ZA 4P58A 4KFCA 3BHJA 3D6MA 4RMIA 1FBNA 2PYIA 2XJ9A 3HJBA 2P6OA 1XO1A 2WHPA 1T3SA 4LPKA 4NEGA 4ZO8A 3TOCA 3PCRB 1ZIOA 5T4EA 5CUQA 3WQQA 2YY6A 2CD7A 1VCMA 3GLHE 3ZIUA 5LP6B 5LYJA 4LQCA 2WW8A 5BVHB 5AW0A 1XBTA 3UUEA 1CZLA 3QI7A 3TZBA 1ODLA 5KYVA 1M1ZA 3DE5X 3LSTA 3Q7EA 4D02A 3I0NA 4IUDS 4EFMA 5JZSA 4Y8VA 3MMXA 5IVDA 2C03A 2VNKA 3EQ6A 5F2NA 2JCBA 2VJAA 3H13A 1MQSA 1G1AA 4M0UA 2P9BA 1LUAA 1NRJB 1KE2A 2YC2C 4ON9A 4F71A 3FE2A 2H65A 3V2IA 2HUPA 5DN9A 5CBPA 4ZICA 1CERA 1SUFA 2D8AA 2HO5A 4MGIR 4E1VA 1BYUA 3MXOA 4K40A 3GPLA 1R4MB 3OU6A 4PLWA 2IHNA 1MJGA 4OKIA 4YP5A 2V6MA 3IIJA 1Q7CA 2NT3A 1ADGA 5JG7A 2WI8A 1NBOA 4NX2A 3C4JA 4MEBA 4KUGA 2Y77A 4DLPA 3O7WA 3CRQA 3VTKA 4IUYA 3HCAA 5DTRA 4DMMA 1YZFA 2X2PA 4PYRA 5CD9A 3SCZA 2ILVA 1NN0A 1MC5A 4ND6A 1X7WA 1JFFA 1DEHA 1UBSB 1E2JA 1D0IA 3HLTA 3HI6A 3R5TA 1K6MA 1RRGA 3H5NA 5L7TA 3EH2A 3QX3A 3VV2A 4PR0A 4FFNA 1QM5A 2Y6VA 3GUUA 4TVOA 5LQRA 4CR7A 3CVXA 1J4AA 3ZX5A 4WINA 5LXTB 1XPOA 1TT5B 5FJJA 1OC2A 4N3CA 3NBKA 4Z1MD 3F67A 4EJ2A 2YJZA 4D0GA 5DI3A 3DG9A 1UKVY 1Z63A 3CB2A 2ET6A 3PE6A 3PR3A 3QENA 4CEHA 3EXHB 3COZA 4NH4A 5AVOA 2ERXA 1DEOA 2Y1EA 3FRJA 5AI4A 5H3CA 5BPHA 5KJFA 3J81k 2JJ1A 3KS9A 4B3XA 2X1VA 1XLTC 1OLSB 4GVLA 4S1VA 4XGNA 1M0EA 1HV8A 2G28A 1X19A 5LZ4A 3U62A 2ERCA 1XALA 4A2PA 4OSOA 4F3TA 1R0YA 4MRNA 4URYR 2OCGA 3BUSA 4RESA 4FYWA 4F5WA 3HJUA 1G3MA 4I14A 1KO7A 4TT3D 3U0VA 4DJAA 4QJIA 2NXJA 2JEOA 4BFUA 1INLA 4K7JA 4MKIA 4WCFA 5KX5B 2C7PA 3S2UA 4J76A 3O82A 2JLYA 1JHDA 3CRRA 3R6LA 5CNMA 2FEKA 5BV2P 3ROEA 5ITVA 3PGLA 1M6VB 1Z5OA 1TEHA 5GINE 4RQAA 2HDOA 4RVNA 5LMZA 3M5DA 3LQKA 1P0PA 2VYNA 1RKVA 3EIXA 3INYA 5FEMA 1U5BA 4R1NA 3FB4A 3ETLA 3FIJA 4Q1BA 5A3SA 2HWWA 3JQQA 3ICWA 1E1KA 4FMBB 4XH9B 1XJ0A 1S7CA 3RKRA 4EHLA 2A9RA 3EXG1 1EXVA 4ZEOA 1NN5A 3H11A 4HK4A 2QPOA 1U1CA 1E63A 1RMQA 3CCCA 3DMTA 3ZVNA 5CB8A 4B3TB 5A6VA 1DKNA 3EVCA 1XPJA 1PYGA 1GCGA 1SK9A 3ER8A 2FZWA 1ZJJA 4LCJA 4FYVA 4PNEA 3AX6A 4TZ6A 5DTIA 4J0IA 1V16A 4WACA 1IZ8A 1X3LA 3P5BA 2E82A 4CQNA 1JA0A 1P2BA 1ENZA 2DTDA 2EZTA 4MQUA 5JTTA 1FU7A 5FBWB 1YCGA 5TEVA 4EPYA 4PYIA 3CUSA 3D8TA 3WRYA 1YRHA 3H3JA 4RZHA 1Z17A 3QLJA 5K8UA 3RS0A 3W5BA 1ZJ4A 1P18A 2AEFA 3HU2A 4PE5B 1CDDA 3WGZA 1MHPA 4CM5A 4MLPA 4HFRA 4AURA 4HB2A 1IY8A 4UXJA 4R83A 1UINA 5FBKA 1RRVA 4E2FA 1YS4A 2SHKA 1BU8A 4UHKA 4CKCB 3TPCA 2D0IA 3OIVA 4MVCA 1VLZA 3SEFA 4PO3X 2GZSA 2KS6A 5COQA 1XNHA 3LCUA 5IJ0A 1A1VA 5HDBB 1VSTA 1G8HA 2D00A 3RS3A 3W9SA 1RZRA 1RLOA 5D00A 1CS0B 1LBSA 4LHVA 3K73O 1QANA 4Q3EA 4LMAA 3NIFB 1R9NA 3VZCA 4A8PA 3NHAA 3NU1A 3IIEA 3P27A 1KQ3A 5EIOA 1SKUA 4LJSA 1Y4AE 2QTZA 4R9UC 4J4HA 1SZDA 5H0IA 1NNEA 3A8TA 1MU0A 3SZLA 1KPIA 3ROGA 4OYLA 3S3TA 4OYYA 1XKQA 3QWHA 4DLZA 5AJYA 3STTA 5D5QA 2K7FA 3Q6IA 5LXTF 1OI3A 2Q5QA 3R24A 1AB5A 1PJ8A 2AK2A 3DAFA 4TYQA 5EKTA 1YO6A 4IZHA 3KOZA 5H81A 3S8MA 5IT5A 4NESA 1IM5A 4YN3A 4TL8A 4RKYA 1NJ5A 3HA2A 1CF9A 4KYIB 1C80A 3EGOA 5CEFA 4L4ZA 2NO9A 4EYSA 1DC6A 1JE1A 5D87A 2WU4A 1RI2A 1RWBA 4F1WA 4G8BA 3TRHA 3WGUA 1YJ5A 2YW9A 5FFNA 4G2NA 4FKMA 1KEPA 3OHMA 3VR4H 4H3VA 4JBXA 3VZSA 5ABPA 2EBUA 1U2DC 1FFXA 1M7HA 4MW1A 1MFPA 2FEWB 3B51X 4JN6B 1HYGA 4X71A 1Q1QA 2W43A 3KUXA 3SN6A 4LKOA 4NE7A 4NJEB 5FPKA 4GZ5A 1J20A 1GQOA 2I67A 3CF4G 2ABWA 1SULA 2CLKB 5CLIA 4D57A 1ILWA 2V9ZA 3IJPA 3MPOA 1QTQA 3R7BA 2O8EB 5A4DA 2ZJOA 1TZBA 3CVUA 1PG0A 1LCIA 4RA6B 3U60B 4IOMA 4EHDA 3WGMA 1QGED 4LC9A 1GN8A 3V3TA 4DJDC 3S8YA 3RPEA 3T6KA 2WTEA 3FZNA 3ROXA 1S8FA 2Y1XA 3DBRA 1XZQA 4HWSA 3K70D 3BMQA 4HNAA 4ZGBA 4F7WA 4YT2A 1BQEA 2JVIA 1ACMA 2RJNA 4BKRA 1K7YA 3Q8WA 1ZK3A 2Y8EA 3O4IA 1ODJA 3I05A 5IHXA 4TLCA 3I2FA 4YWJA 4L9AA 2NSHA 2WM2A 5K8VA 1C1DA 1JTEA 1YTUA 3EDYA 1M1XB 3OJOA 2VQ6A 3ABIA 4FT2A 5KKNB 3FROA 1KKUA 4REMA 2IXAA 4O25A 2JIPA 3ET5A 3R0IA 4UAUA 1KYTA 3VNQA 1PWXA 3I9NA 3MAJA 2RC6A 1B3RA 2Y1DA 2YUIA 4Q16A 1P4HA 2HADA 4CMCA 1LBEA 1Q7BA 2H4WA 4YPVA 2A33A 4CMAA 4MP8A 3H5AA 3OOJA 2FQQA 4I9HA 3SWWA 1UJ4A 1V5GA 2QTLA 2P4UA 2FRDA 5LWHA 3MERA 3L02A 1C7FA 1MO6A 4BMCA 4EW3A 3OT1A 5CGZA 2BKEA 2NU6B 3S1LA 2P2NA 2QDXA 1PHRA 1RQRA 2V6FA 3DOEA 4GX2A 4XEUA 3UIEA 5LJLA 2WOOA 1K5PA 3ZE8A 3ITKA 1A77A 3FAZA 1Q0ZA 4JT9A 4U7GA 1JAXA 1FDUA 2IPOA 2QJFA 3PDIB 4TTTS 4XGQA 3UWSA 1CUDA 2GNAA 3F2IA 4B17A 5B6IA 1JBQA 3BGDA 1DEXA 3V32A 1XX6A 2VBCA 4RJIA 2VHCA 1SIBE 1F2TB 4FUTA 2CF6A 5I7FA 1SXQA 1LJUA 1M2WA 1C3XA 3NPAA 5AKXA 1FS4A 2G5TA 4BFYA 4ZKDA 5KNDD 3A9UA 5B53A 4D4MA 3REGA 3RLFA 2OO5A 4S05A 3CE9A 4Q9NA 3MELA 4NJMA 5AK3A 3ICQB 3TMYA 1E4OA 3OTHA 4OJNA 4E6PA 4ESEA 2JLBA 1QLJA 4QJ5A 4HEJA 1AUXA 3ASYA 5JC8A 5JXGA 4RGBA 1YR6A 5L4LA 3A2KA 1G8MA 4IKOA 3RYHA 2E55A 4KFTA 2QYOA 1TCVA 3H8WA 3E9CA 3DUFA 2C84A 2B30A 1H2EA 2I7XA 4DN6A 1ONBA 3K2EA 5TGTA 4G56A 1OH6A 2I6SA 5KS2A 1UFKA 1Y9ZA 2WTMA 4ZEXA 3SKVA 4YXWD 2PSHA 1Z36A 3H42B 4PZPA 1PQWA 2Q29A 2NYRA 3W9BA 3M4ZA 3QXSA 1XJCA 4KQ9A 1DOZA 2AI2A 4P3XA 3RC9A 2CZCA 2YINC 2QBYA 3FMVA 4IHJB 1CRPA 4IDEA 2SCUB 3CUTA 4D2IA 5I45A 3NEYA 4G0PA 4LJ7A 2J59A 1SOWA 3SIRA 4MW4A 4QULA 2QIPA 3HADA 4CL2A 1GAQA 4IEFB 3H9GA 4NV0A 4NYMQ 3S4YA 4JP8A 5BNZA 2XTNA 4N8DA 1KAOA 4XARA 4X91A 2XD4A 2XIJA 3ETEA 1I3CA 2VOJA 1M10A 4LZLA 1OVMA 2A9QA 3MCVA 2JGAA 1G19A 3L6UA 1OJ7A 3IQEA 4G4SO 2DTXA 3KTAB 4Q1DA 4XLTA 3TI7A 5AVUA 2RAPA 1ONSA 2Q46A 2E5WA 4OGFA 3RSCA 1D1PA 4BXOB 1NKVA 3MJVA 4M0FA 4RNDB 1JDZA 5JVDA 2CNBA 5D2CA 1PIWA 2VUIB 2ZWAA 3MMSA 4N3NA 3W8DA 3WNCA 1RE0A 3SGLA 2R8OA 1PQ4A 4BIMA 4XVHA 4HB4A 4J1TA 4WQMA 3DEKA 3Q3JB 3IS3A 3ZCPA 3KR9A 2H1LA 3AFHA 5FPTA 1TO6A 4XXHA 3T06B 4CKWA 4M54A 4UVDA 3JAWB 2BEJA 1VIDA 3CZRA 1G21B 3PRHA 3RE1A 4YRIA 5C80A 1DCFA 1BX3A 3CH7A 2JLXA 2QE6A 2DWUA 3QWFA 4OHOA 1K86A 1ISFA 3PKZA 2LW7A 1LSSA 1N8KA 4JI3B 3WRWA 4IUBS 4MIEA 4AN4A 2EFHB 2OZVA 2PLAA 3U3RA 4C1BA 2HMYB 5IZ4A 3CN9A 3MWDB 4FDUA 4QGGA 4ENVA 3VNRA 2PNJA 2L42A 4HL6A 2JB9A 4MUGA 4FONA 1H1LA 3C7TA 5JCOC 3EW7A 4N0QA 1NBMA 1R0BA 1WDLA 4R01A 4CQJA 5ALMA 1XZFA 1R88A 2WPDD 2YIDA 1IQ0A 1B8PA 4C76A 1PUJA 2C9DA 3H5LA 3O84A 3QU5A 3QVXA 3R5KA 3BIOA 4M36A 4Q37A 3ENNA 4RCVA 5C5IA 1N6PA 4X8MA 3TL2A 3DOHA 7MDHA 1NUAA 5G0VA 2BEKA 4ZT6A 4QG3A 1K8YB 2FX3A 5BMVA 1DTEA 2DKNA 5ARDA 3O8CA 1HQYE 4UMEA 5JALA 2WK1A 3U0BA 1A4RA 4G89A 3H04A 4G5FA 1CG6A 3IA7A 3ORSA 4CODB 3TLKA 2WLSA 3TVDA 1IWPB 3ONWA 4BL5A 4XGRA 2OAGA 3MRVA 1NW7A 3AILA 3FCXA 4IDHA 3VU0A 2CLMB 3F6CA 3K96A 1H0SA 4JL6A 3WGNA 4F4UA 3CEJA 3SQNA 3AUXA 3VYRB 1JEQB 3AFIA 1GO2A 4O1HA 2OXRA 3JYLA 3VPAA 1OXUA 4I6GA 3FVRA 2OBBA 3FMOB 4HAUA 2H0RA 4LWZA 4CL0A 4YRSA 1EM8A 4L57A 2BMVA 2QN8A 5JQGA 3GLGE 3G5AA 3IDFA 1P17A 1Y5RA 2WWRA 1XHLA 4FNAA 4XM1A 2VYVA 4XR9A 3T5BA 2AOUA 3VVLA 3QEKA 2QX8A 1OMOA 4B2YA 1JR6A 2QRLA 3R3JA 5BSUA 5C9ZA 4ZO6A 3DR5A 4F6RA 2REBA 2JZOA 4TL9A 1SELA 5EJ7A 4ZANA 1H9CA 5EMMA 4HZGA 1QP4A 1AS3A 1XQYA 5FIUA 1IBMB 1PJSA 4RANA 4BDTA 3E5RA 1LZLA 3K9WA 1TEXA 1GPLA 4DIOA 2HFJA 5EJ2A 1XQVA 2EBHX 2X8AA 1R00A 3EY4A 2ZTHA 4GM1A 5D5HA 5I4BA 2REXB 2BFBA 2PSEA 3CT4A 1NWHA 5ALDA 3B3GA 3IO5A 5FYDA 1A71A 3AY6A 3GY0A 5TQVA 4ID3A 2CFIA 2GCOA 1E2GA 1F38A 2AD1A 1NVDA 5CEEA 4X84A 4NSNA 2C0PA 4EEKA 1LI5A 1PEKE 4AI6A 1SCAA 4YMWA 3CIFA 2RKWA 3VKHA 4IV8A 3GLHA 1FQWA 3R6GA 4B6FA 3L7KA 4JUIA 1Y48E 2P78A 1GTJ1 4B3IA 2Q4OA 1WMAA 4D4IA 5HOQA 3AB3A 3G1UA 2GVDC 2NXWA 2ZUEA 1RHJA 4IG4A 4Q3DA 2XGJA 4DE5A 3INRA 1GXSB 1JU9A 2BLNA 3JD2A 4XLZA 5FUQA 4U6SA 4EB8A 3HJRA 4C7BA 5DBOA 1IVNA 5AKKA 3NNSA 1GPDG 1O97C 2UZ1B 4UNPA 1XEXA 4YJ2A 1E89A 1HMPA 3LU1A 4TSFA 2G40A 3B7GA 1PSDA 3OAAD 4KO3S 3C8ZA 2J9GA 5B4TA 3R74A 4CEIB 3M6MD 2PZKA 4XSVA 4V1CA 4DC9A 3GNQA 1YQXA 1E1RD 2VSQA 4NPAA 1PDWA 3OBIA 3OLVA 4QA9A 4TSRA 4ASUD 1RD4A 1A98A 3RSFA 5AW5A 3IPXA 3HR7A 1YFZA 5FPQA 2XQKA 3TZKA 2EGGA 1NU6A 3OKAA 1VZ3A 2AOTB 3DE1X 3PFBA 3U7GA 2V3VA 3B1ZA 2J0UB 4HB0A 4M0KA 4BBJA 4CDMA 1NVXQ 1VYTA 1A04A 2D59A 2XWQA 4A0HA 4BV2A 4IO0A 3TG8A 3QF7A 1E9CA 1L1FA 2ZCJA 5IBRA 3PQ5A 2VUTA 4BO0A 3L7DA 3BXOA 4N49A 4JYCA 3UYKA 1U80A 4BASA 1TUBB 3KE8A 4PHFA 4V24A 2H16A 2PS3A 4NBVA 5EIFA 2ZYRA 4ARUA 4Q3KA 1H2YA 1NQAO 3AUAA 4GGOA 4QOGA 1U9IC 2WD7B 5ERYA 2X0NA 2FJ0A 4EKDA 2WF7A 3OKFA 1PV4A 1XQXA 1P80A 3AIOA 5FWYB 5KAMA 5FBZA 4IX9A 2C8VA 2CVOA 5DM60 4E03A 3BE8A 4JYZA 1ISRA 5J9FA 1OOEA 2WWYA 2HWKA 4N3AA 4ARCA 5HVNA 3KVYA 4NBRA 2VHVA 4DANA 3ETNA 3MCZA 3IHTA 4B3SB 1ZINA 2D54A 1S01A 1EZ4A 1XQ1A 5KREA 2YOFA 2Q49A 2I87A 4LDJA 1BXRB 3ZPXA 4OAOA 2QTFA 3DF7A 3QIAA 1N8SA 3AHEA 4UCWA 5DCWA 2ISCA 3LFUA 4QTZA 1NYLA 2Q2OA 3ZWVA 2YYAA 5EWLA 4BLPA 4XTCS 3M2PA 4MVJH 4D0RA 1KSFX 4A2CA 1GZ4A 3NUZA 3TWOA 2FZVA 1JG6A 4ZCSA 3FOCA 3D8BA 4RIFA 4LFAB 2PO7A 4ZTBA 3H4VA 4L9SA 2AZDA 3DL4A 3IP8A 3UW3A 2IWHA 5JY1A 1UP4A 4G9GA 1GPMA 2G82A 3BOSA 4ZEWA 4HNQA 1Z5GA 1ZK4A 2F3RA 2YY7A 4V1CI 1N2JA 2E6UX 1TU3A 4M1MA 3R9KA 3KV3O 2Z6VA 3GG2A 1E96A 3OHSX 5LZ2A 1PFYA 3DUWA 4HAOA 2UUAB 4HQOA 1L5OA 3L04A 3GIWA 1FNBA 1ZI6A 3AHCA 2Y9PB 4UHCA 1LW6E 1ZI9A 1KY5A 4LGYA 4TPKA 3H2ZA 5IJXA 2CHFA 2J3DA 5K09A 3OE7A 1FTGA 3KDSE 1UM9B 3L7JA 4MUMA 3LUGA 1SCKA 3D1JA 3WKDA 1MD9A 2B83A 2RJ3A 3NCTA 4CMKA 3PP8A 4RY2A 1ORRA 1CEQA 3H2IA 3TQTA 1GU1A 4HDKA 2VDOB 3OF2A 1U7DA 4IH9A 3ZE1B 1EQUA 2MSLA 4HXEB 2ZLBA 1C30A 1U8YA 1V2GA 4B75A 1WDTA 1A0OA 4YFVA 5HIMA 1A9SA 1M6YA 1JYFA 3AU8A 3GGCA 1Y37A 2C29D 5I01A 3GBSA 5TXGA 3LYAA 6ADHA 1GGMA 3BSYA 3J81A 4TLEA 1TECE 2IDZA 5JCJA 2FPMA 3TINA 3E1KA 4O2BF 3H97A 4G09A 1YE3A 2Q8PA 4RQTA 2XZOA 1TD1A 3O8LA 5CT5A 1VLLA 3ZU2A 1UF9A 2K4MA 3ABQB 1L3IA 1U7PA 5IVPA 5EHZA 1TVKA 1CUZA 3W2HA 3D7NA 1PL6A 4I5DA 2WIBA 4DL9A 4MB2A 5ED0A 1QV6A 5K4HA 4K0RA 1H0HA 2TMGA 1OFUX 2AXEA 2O4UX 1RAIA 2HRRA 2R6FA 4B4VA 1WR8A 4KGDA 4QO8A 5K3AA 2I2CA 3IUJA 4O4JA 3LHSA 3R7WA 4YT8A 3S8EA 2P5TB 4BV8A 1NXXA 3R3UA 5F73A 1PEAA 4D26A 1R6UA 4J90A 4XWKA 2CSXA 4HXYA 3RJ5A 1QGUB 2CC2A 2IEGA 3CV3A 4OH1A 3RJ9A 2C2ZA 3M9LA 4HAXA 1Q7EA 1F1JA 1RPJA 1X2BA 2FA9A 5JI3E 2G77B 4BKQA 3WL7A 4BMNA 1B43A 3ZWNA 4XX1A 1UPAA 2BH2A 1MEJA 1ZVVA 3BB3A 1SN7A 3NANA 1YJBA 2DPLA 5JXWA 2MINB 2RI0A 4PQFA 2IS6A 3JVDA 1SB8A 1F7UA 3KPUA 5FAKA 4F38A 3EUAA 3SZRA 4F0JA 4B2LA 3PEWA 4RS4A 2EJCA 2PS1A 1NIJA 2Q3DA 4YH1A 2P4HX 3OCWA 2HJRA 3VAYA 1CULC 3DULA 3ZD9A 2B2NA 1CY2A 4YMLA 1H1TA 1US8B 1ZISA 4XQ0A 3AF1A 1SVOA 1Z4PX 2E4AA 4O4IB 4ZCLA 4B6RA 1D07A 4BC1A 4OXQA 2BRUA 1K6IA 2ZAYA 3DV0B 1DPGA 3HB9A 3PXCX 3RFTA 3THSA 1LK0A 2CMGA 4AFNA 2EATA 1KERA 4KLZA 4ND2A 2JASA 3V1LA 4G1FA 4OM7A 1V37A 1Y81A 2G5GX 4L0QA 2K6GA 4CM4A 3R8FA 1S3SA 2B5OA 3ZDCA 5DM0A 5U4QA 1AXEA 3W5CA 1VJ5A 5KHOC 1DEKA 2IDMA 3AOEC 5A3JA 2R6GA 2REQA 2EWWA 1YRBA 3W4JA 5EPUA 2HTFA 3TR0A 5A7GA 1AKYA 1YZNA 2ORED 1FYWA 1GYPA 2P2GA 3HCNA 4L22A 2QK4A 2RG1A 3ILSA 3I01M 4IP0A 4CW7A 3Q7IA 2IVFA 5HMLA 2D5IA 3AO0B 1E3MA 1WY7A 2CJYA 2D13A 3IIMA 4FOOA 1JQBA 3C8MA 2Q21A 4TWJA 4HDSA 4BAUA 1V7QA 3WGLA 1ZOSA 3KZXA 3SQXA 1DHTA 3VOSA 3V4RA 3IBYA 4GBGA 5FJIA 2O8FB 1ZAKA 2O0HA 4DMFA 2ZIWB 2C5LA 4PXAA 3AQIA 1Q44A 1H6CA 5CYGA 2CFTA 1CR1A 3AT1A 2VNSA 2BCGY 4MKXA 2J7PA 5IKMA 4X93A 3NT2A 4TWRA 3EA0A 3AVOA 1U98A 3JARB 5IT9A 2IU4A 2XOKA 4Y6PA 4P82A 1GU7A 1I24A 3CX3A 2BSQA 4DM7A 4LDRA 4GXNA 2JANA 3IODA 3IUPA 1JQEA 1ZN8A 2EKLA 2QLBA 1A5ZA 3C3BA 4DHEA 4XVCA 2ZRNA 2XMDA 2JGDA 5K3CA 5DSXA 2OV2A 2CYCA 2M9MA 3EIFA 1J7JA 2VHUA