2NZJA

The crystal structure of rem1 in complex with gdp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
171
structure length
155
Chain Sequence
MALYRVVLLGDPGVGKTSLASLFAGKHEQLGEDVYERTLTVDGEDTTLVVVDTWSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein REM 1
publication title The crystal structure of REM1 in complex with GDP
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 155
sequence length 171
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nzjA00
1Z3IX 4M1WA 2IBMA 2JLWA 1SVMA 3QF7A 4FXPA 2XB2A 1ZC3A 3TR5A 1E9DA 3GPLA 2WMOB 3U3OA 2NO1A 3B1ZA 3K0AB 3U3JA 1TUEA 2HT1A 2OAQ1 4JLOA 4EAQA 1OHHD 2J41A 4DLSA 3DO6A 1TQ6A 1OXUA 1R4AA 4D6PA 2C04A 2EFCB 3AH8A 3MAAC 3FHTA 4PZLA 4HLCA 1VCMA 1NLYA 3WP0A 4F4JA 5AJVB 2EFDB 1WXQA 2QRZA 1KNQA 3Q85A 1TF2A 2XTMA 1E9FA 1R10A 5SZHB 3U5ZB 4Q7MB 5AUPB 3L8ZA 4IVQA 2P6UA 3AV0B 4JLBA 3VU9A 5H68A 4KLZA 4EQ6B 2FSIA 1KMHB 1Z0KA 2BEJA 1G8HA 5DI3B 3GJXC 1KMQA 3DZ8A 2FPMA 4TMVA 4QNRA 3B78A 4G5QA 5B64A 2OHFA 1N5KA 3AEZA 1V43A 2GHIA 2ZJAA 3BE4A 3GJ8A 3FKQA 5TVKA 2JA1A 2FPKA 3WBJA 2FDCA 3EG5A 2P0EA 2IEZA 1DAEA 5J5CA 5HR5A 2CCGA 3N2IA 2AFHE 2ZYWX 1U9IA 4G1UC 1OFTA 1GP2A 1G16A 2IEYA 2WAYA 4C0BA 1COWD 4DLTA 3QF4A 4N1AA 5DN6D 1DAHA 3C14C 4TSFA 4LV5B 4RD3A 2YOGA 4RCZA 5KDOA 4M9QA 4OI0A 2Z4RA 1M7HA 3AP3A 4PZZA 2GXUA 4E5UA 3LLMA 1SXJC 2J46A 1KDTA 2GF0A 4LHZA 3MWLA 3WMGA 1ONBA 1N0VC 2W2XA 1M7BA 1XDBA 1XTSA 2ZI4A 4WZBE 2BMFA 1S0UA 5BWMA 2AKYA 1Z6XA 4URZR 3LX8A 2CMKA 1WE2A 4M9SA 5JI2E 3AKCA 2QTFA 4A4DA 3AVTA 1XMSA 3KZ1E 1FOEB 4QJ4A 1OKKA 3HU1A 1DOAA 1J90A 2CL0X 2IUUA 1U2RA 2RMKA 2OZEA 2WPDD 2ZE8A 3W34A 2O8BB 1GRQA 3EA0A 1BH2A 3O8BA 4PZYA 1J8MF 5JLJA 2C78A 3RS0A 3GLGE 1HH4A 2EYUA 4ILEA 4KXFB 1Z22A 1E79A 2B8WA 4BEJA 5JZVA 1Z0FA 3WHLA 1IOZA 2IA5A 4B73A 1JEEA 5CB8A 1YR9A 1N6HA 5IK2D 2REXB 2X19A 2GCPA 5KPDA 2O8DA 5EP3A 1QHIA 2RGEA 3EZ2A 2ZRHA 4QL3A 3CF2A 1N5IA 4KFUA 4DIEA 2H92A 1E0AA 3NKVA 5KSOA 1FW6A 2PZEA 3OF5A 3ICEA 1YRAA 1E9EA 1K6MA 3AF4A 4DB4A 2ASEA 4FMCB 4L8GA 4KJZA 1Z0IA 2ZU6A 1DS6A 3A58B 4HAUA 2NOAA 4CIDA 4DDTA 1DELA 4QM6A 3C41J 4I99A 1XPRA 2CK3D 3W90A 1E9BA 1CJKC 4BWYA 3BB1A 1JBKA 1F48A 4N0EA 1YVDA 2OV2A 1G21E 1KY3A 4OHVA 3TMKA 4HSEA 3NEJA 3T1OA 1CXZA 4C0LA 1RRGA 1U8YA 2IYQA 1RRFA 2X2EA 3SHWA 2ORIA 3B1XA 1FNNA 5HE9A 1SQ5A 4XOIA 5HTKA 2JATA 2Q9AA 4GZLA 2ZJZA 4KCGA 4HB2A 5K8UA 5DO9A 1PLJA 3NC1C 3C5HA 3OIYA 4JL8A 3CRMA 1M1YE 1IN7A 2BVNA 2DHRA 4MITA 1JNYA 1JQJC 4LWZA 2HYDA 5FL7D 2ZYVX 5FOXA 1OE0A 1ZCAA 4O2LA 2VP9A 3B7GA 2AFIE 3U6KA 1ZD9A 3R20A 1YR8A 1ZNWA 2KWIA 1VIYA 3AF1A 4ASUA 1VDZA 4JT2A 1ZU5A 2WM9B 4I1OA 3OESA 2GXQA 5AK0A 3G0HA 2R44A 2J7KA 5BN4A 1XCMA 4EPYA 3I61A 3VKHA 821PA 4Q1AA 4AURA 2EVWX 2QORA 2QZ4A 5FPKA 5K8TA 1OT3A 1J99A 4PC1A 5FTLA 2ZE7A 1KIMA 1KZGB 1ZIOA 4Q9IA 1NG9A 2FN4A 4RZUA 3RVBA 1NN0A 1CKEA 2NZ8A 1A7JA 2F9LA 3LD9A 1H65A 4KSCA 1P2SA 1Z6YA 2OCAA 4TWZA 3TRFA 2QN6A 3HWSA 2W2TA 2AD1A 2W00A 3GJ0A 1Q44A 1YZLA 4QM7A 1RZ3A 2YHSA 3OAAD 4GNKA 2GJSA 4JSTA 2BDTA 2FSGA 5J47A 2BJVA 3EARA 2FFAA 3RHFA 3VR1A 1SVKA 2GVZC 1E2NA 4YC7A 4DEXA 5BN5A 2ODEA 3SFZA 3P4YA 5KO2A 2ZI5A 3T35A 3ZQJA 3ZDQA 2R2AA 4NBSA 4DDVA 1JXMA 2GKSA 3TUZC 2ORWA 4ZCMA 3GLGA 1P6XA 2V8OA 1MKYA 4JVSB 4TL7A 1T5IA 3K0CA 4TZ0A 4ZKDA 1IQPA 4BFXA 4DHEA 1S9HA 1KAGA 1W0JD 4LPSA 4A9AA 4D0NA 5JI3E 4C0AC 2VSXA 2J0UA 1NIJA 2WKQA 1SVLA 2QQ0A 2PMDA 5LBIA 1AS2A 4PC2A 4PHFA 1W5TA 3CX7A 4OKSA 4GOXA 2P6RA 4U7DA 1G19A 4Q9KA 4A2WA 2XSZA 5JSZA 1L4YA 1ZM2A 2Z83A 3AF2A 3HDTA 4FMDF 4TL6A 4OQMA 4Q21A 2NG1A 1U0HC 3K09C 4MKHA 3NBZC 3U3RA 2A30A 2GJ9A 5G40A 5FI0B 4NTZA 3OIWA 2WICA 2OFWA 4FWTA 2GCOA 3BB3A 3JZAA 2ONJA 4BFUA 2JJ2D 2IYXA 4OHWA 1S1MA 5G3ZA 3W3AA 5A0FA 2QE7A 2A78A 2F43A 4JLVA 5EXTA 2V6JA 4EJSB 3FMIA 1SVOA 5DISB 2QPTA 3TW8B 1EWRA 4KV9A 4MKIA 1HE1C 4N3NA 1J7KA 5AJWA 3EC2A 1ANKA 2DWPA 2AD5A 2R8RA 3RS5A 2ORVA 4UJ5A 4GP6A 2IYZA 4R71A 2RGAA 3NBXX 3VMFA 1XXHE 4HUTA 3QUSA 1RIFA 3K0AA 4A8JB 1M8PA 1WBBA 5JWOA 1KGDA 4R2HA 3MSXA 4B2IA 2WMNB 4Y0VA 3KJIA 4FWIB 1A5TA 3BK7A 2CHQA 2ZRKA 3KDSE 4Q7LA 4FCTA 1HYQA 4JJZA 4QC2A 3SC3A 5JMTA 2Q21A 3CRVA 3TH5A 5LDDC 4TLAA 5FBLB 1E1RD 4DLWA 2HLDA 4NYIQ 4GFDA 1L8QA 2QL6A 1CRPA 4WXPA 2FWRA 3F0TA 3LFUA 3JZMA 1KO8A 4C9BA 1P9WA 1VYUA 4XD7D 4B3GA 1XEFA 1NN5A 4FCVA 1MO4A 2EFGA 4PTLA 2YWEA 1KMHA 1WDTA 4DUGD 4EQ6A 2W58A 2ZANA 2I4IA 1JI0A 5DI3A 5D3QA 4R98A 5KDLA 4ABYA 1N6LA 1I2MA 4OQNA 4V03A 4DLXA 4KFRA 1X1SA 5CIQA 2KBEA 1F2UB 4Q19A 4C3ZA 1OHHA 5G41A 4JLJA 5GJVC 3CZQA 4B74A 1NN1A 1UAAA 1IY2A 1DBSA 3AVUA 4GI7A 2W2VA 1MOZA 2G1KA 1KK0A 3DEFA 4MUAA 3T06B 1FP6A 4JZKA 2AK3A 3AVOA 4GPTA 2AHOA 4Q4HB 4TZ6A 3LBHA 1ESNA 1UEJA 3E1SA 5LD2B 1VPLA 2CVHA 2UKDA 2NO0A 2P65A 1HQCA 2VF7A 3BXZA 3EPJA 2JAQA 2P6NA 4KVAA 3NDBB 3PENA 2GJAA 4MGZR 2ZREA 2WJVA 3IGFA 5FPTA 1E2KA 4LBYA 5H1YA 5JHHB 1FL9A 2HF9A 4ZCIA 1S3SA 4FMBB 1XB2A 1X6VA 4FINA 1G5RA 3UK6A 3OEHD 3BIFA 5HCNA 3BGWA 1XF9A 3SNHA 2AWOA 2J1LA 1G8GA 3O8CA 2IXEA 2GZAA 5J4HA 2AR7A 5FPSA 2ZRDA 5AR1A 1KNXA 1E2DA 1TEVA 2PT5A 2ZRFA 4WZAE 3REGA 4RKEA 2RGGA 4W9MC 3EWAA 4WW0A 1AKEA 1N25A 3IHLA 1N0UA 2WIBA 3QPUA 2O0KA 3R9IA 3I62A 4JIMA 2WSSD 1XJ0A 4FIDA 4QHSA 3H84A 1EGAA 1P4SA 4UXIA 3THXB 2O8BA 3CX6A 1COWA 3ZVRA 2VP6A 3MGCA 3K70D 4NKRA 2QSZA 5DN6A 4BLQA 4KBGA 4JVNA 1VMAA 4LC1A 3ICQB 1K5GA 3SJAA 1IM2A 4F92B 3QY0A 1NJGA 4P4SB 4ZDIA 1HUQA 1GSIA 4L9WA 3MCAA 3AVWA 4XIGS 4P31A 1G1MA 1MO3A 1XXHA 4H9GA 1ZNYA 1U99A 3KKOA 4Q9LA 5IT5A 1P73A 2YWGA 3BERA 1E94E 2GWHA 3NC0C 2GBLC 3DOFA 1UKVY 2WIAA 2ZM5A 1CRQA 1G4AE 3KJEA 4DRZA 2IYYA 4EDHA 4EKDA 1G3UA 4G3XA 1RVDA 3PVSA 4QNMA 3TAHA 2R6DA 2MSEB 4QFMA 1PLKA 1NJFA 2ZJBA 4CEIA 5AJYA 3JVUA 4CGZA 2ZQ5A 2WPDA 4PHTA 2A5GA 4MGYR 3NVAA 1CR0A 2D2EA 2VTKA 4V0NA 2WJIA 5J4VA 5KSYA 3RAPR 1DARA 3HPQA 1CIPA 1W49A 2GESA 1UEIA 3K70B 2IHYA 4R9UC 4URXR 1JR3D 1N6NA 1Q1BA 2O0JA 2ZRJA 3CRRA 1NBMD 3RWMB 3UMFA 4KYIB 2D06A 2B8TA 3HPRA 1D9ZA 1TF5A 4JLMA 2W0SA 5KNCA 1W48A 5TARA 5CITA 2BMJA 4AD8A 5IK2A 2VP0A 3M4YA 1NVWQ 1C4OA 1UM8A 3NDPA 4JL5A 3PEWA 2CE2X 3KKQA 4LV6A 3MD0A 5CJPA 5JECA 5DSZA 3QKSB 4LBWA 3C16C 2ZR9A 4LY6A 3BH7A 4OQXA 4MA4A 1Z07A 4D81A 1NLZA 1QHXA 2C77A 1ZJ6A 3AUYA 4JMPA 3FB4A 4ASUD 4EFNA 3LVQE 2CLSA 2DFTA 4QGGA 3UWOA 4DCSA 2CK3A 2GTPA 1IN8A 1ZIPA 3G82C 5A5GA 1KI7A 1TL7C 1FX0B 1YZGA 4A8JC 3BFKA 1QHHB 3X1WA 1ZMXA 3D31A 3EA5A 6Q21A 4AKIA 4DLVA 3NG1A 5FUYA 3U44B 3WY9A 1KI9A 3KQKA 4GP7A 1RYFA 1BOFA 1E0KA 1DADA 3RNLA 3R7WA 2XOKD 4Y0AA 5HPYB 1E6CA 3KFVA 4LHYA 3I32A 4Q5IA 3SZRA 3U7HB 4Q66C 2D74A 4IEEA 4BLTA 1IJFA 3IUYA 2A5DA 1LS1A 1HY3A 2ZYTX 1TF7A 4RKFA 3U6BA 5FL7A 2UZ3A 2YNMA 5FFMA 3RS4A 1EFUA 2QM7A 3PCRB 1E2MA 5BQ5A 2EYQA 1JR6A 5KU1A 4B48A 2ZS8A 5EQTA 2ZJ2A 3KKNA 3ZZTA 4RCYA 3LW7A 3RC3A 4IDNA 4D0LB 1AZTA 5IRCD 1BKDR 1R0WA 1G8YA 2BBOA 3LAWA 4FCWA 1E4VA 5FTMA 4F91B 1RRPA 4RD1A 1PJRA 4DLRA 1CR4A 1GKUB 2W6JD 3KJGA 4PFSA 4LJ6A 2ONKA 4LJ7A 4B2PA 1XPOA 4RVCA 4M4SA 1G4UR 2GAOA 2EW1A 3L43A 2OAP1 3TNFA 3B1VA 3KB1A 621PA 1G6OA 1T3LA 4LBVA 1PUIA 2IXFA 5FL3A 4N0DA 1ETUA 5CYOA 4YMUA 3OAAA 1AA9A 1DE0A 1Z06A 4B44A 3H86A 4CEHB 2XSZD 4OHYA 2R6GA 4UNRA 3ZH9B 3OE7D 5DYGA 5EZ5A 4PC3A 1HT2E 3BC1A 2GVDC 3K0FA 3RRZA 4LJYA 3TIFA 3GFOA 2BBWA 5L3SA 2AN9A 1OYYA 521PA 3CR8A 2NMVA 3QXSA 1TUIA 3TSOA 1W44A 1W4BA 1F6BA 2HV8A 3R8CA 2QP9X 4Q02A 3EC1A 3SYKA 1G8PA 1KZ7B 2V7QD 4C2UA 4ZDKA 3AM1A 2JGNA 4ACAA 2AWNA 2H18A 3CUEF 4B3CA 4LC0A 4F7WA 3T5DA 4DZZA 3WMEA 3LNCA 4FI3C 4U5XA 3K9LA 4MGIR 4QG7A 1E9AA 4EJSA 5GJCA 4URVR 1U9IC 3PUVA 3UXMA 3L0SA 1EK0A 3A36A 4PO1A 2Q3FA 1F2TB 4ZV4A 1G8FA 1YZKA 3I72A 2ATXA 5GVRA 3TUIC 2F9MA 4PHHA 4OK3A 4B71A 3FYHA 2QMOA 4LYHA 4GL2A 2VLIA 1EFHA 4DCVA 4C7OA 1IONA 1S96A 1E2FA 1X1RA 2ZJOA 4HDQB 1YZUA 2BKEA 1ZM4A 2L0XA 4S35A 1AGPA 4JVMA 3LQQA 2ZSAA 2GCOB 4LX0A 2AKAB 3DL0A 2D4HA 4B47A 2Q0HA 2PEYA 4IXNA 1DO2A 2ZJ8A 3VX4A 2RGCA 2ZTSA 2JJ2A 1T0HB 4H1UA 3I8SA 3CNLA 1GTVA 1WB9A 1Q1ZA 1EX7A 4L16A 2PJRA 3IBGA 3HR8A 4DB2A 3PV0A 2JCSA 4G5OA 2H17A 3EZ6A 4KHZA 4DJTA 2GRJA 3IIJA 2IWHA 3FGNA 3ZS8A 3DMDA 3ASYA 1UFQA 4RD4A 1G20E 2J0VA 2FEOA 4ZPXA 4DC9A 1JALA 4DBLC 1G5TA 1TEXA 3W6PA 3WRXC 2ZI9A 3U61B 3P27A 4KYUA 1E69A 1F2UA 2KE5A 5HE8A 4D4LA 1PLLA 3RSLA 4DSOA 4LI0A 1ESMA 2C99A 2OBNA 4LRWA 1LS6A 1RJ9B 2HCBA 4JLPA 2JLQA 2YVUA 4M1KA 2D62A 1W4CA 2Z6VA 1ZRHA 1P5ZB 1J8YF 3CWZA 4HUQB 1E1RA 5GJBA 2SHKA 4E09A 2JLUA 1D6JA 2VHUA 3ECCA 3IO3A 4KFSA 4Q4HA 4ZI2A 3U7FB 2XXAB 1DEKA 2VYFA 1JR3E 4XD7A 3WNCA 4G5RA 4D4MA 5BN3A 1NBME 1R2QA 2QTHA 1XTQA 1NN3A 3BAFA 1P2UA 1G6HA 1N5JA 1P62B 2CVFA 2DPXA 3HJNA 3OIVA 4DUGA 1W47A 4OI2A 4W5JA 2PBRA 5EE9A 4ERNA 2DR3A 4M1TA 4P4TA 3L0IB 5JS8A 1R5NA 4Q9HA 2K5UA 2D7CA 2G1JA 2ZUCA 3QE0A 1MV5A 3B1YA 3FVQA 4KITB 4LBZA 3UWKA 3B2EA 4FD2A 4P33A 2O8CB 2PCLA 5FBRB 3U60B 2QM8A 1GITA 1IXZA 1MR3F 5CJ2A 2XX3A 2H1LA 1IN5A 4M9ZA 5B57C 1TQ4A 3BB4A 3KTAB 2ZRIA 3CIOA 5TXGA 3EPHA 3IPYA 1KI2A 2ANBA 2ZUBA 4Z54A 2HF8A 4AK9A 3AP2A 3THXA 4JBYA 1XTIA 1G41A 3LV8A 4IRUB 1JEDA 3I1FA 4DLYA 1NI3A 3WYAA 1T5LA 5G3YA 2YYZA 3DDCA 2Q3HA 1W46A 2QAGA 3MFYA 3RWOA 5J4KA 2B6HA 4C0KA 3OEHA 3MG9A 2ZRNA 4P4SA 1N6PA 1UF9A 1Q22A 2OCYC 2ZVQX 3M6AA 5EJEA 1ZVQA 2IUTA 3DKVA 2B7CA 2A2ZA 4XJXA 3QEJA 4MDEA 4MYUA 3Q9LA 2BKUA 1QDEA 2A3RA 1KTVA 2QMHA 4LJ9A 4Z1MD 1VCIA 2VPPA 3Q7PA 1N6KA 2GAAA 1EWQA 1A1VA 4EIWA 4LHVA 4RD6A 4QGFA 1MO5A 3IQWA 2AK2A 2KSQA 2WAXA 2ZRMA 4GOKA 1Q1QA 2I1QA 4AYXA 1A4RA 2WSSA 1NP6A 2G0TA 1KO1A 4LGMA 3CPJB 4Q1CA 1YZNA 1J2JA 4QJ3A 4I1SA 4URUR 1NIPA 1RFLA 3T5GA 1BYUA 2ECKA 1E2IA 4U00A 5UKDA 3SQXA 1CF4A 4II7A 3SBDA 5B58C 1W0KD 2FF7A 1M7GA 1G18A 4IDQA 2FEMA 1W36C 1R5BA 2IYVA 5FBQB 3K1JA 2D3WA 2IX3A 3AKYA 3TE6A 3ZVMA 1Z2AA 2GETA 4ZI3A 1KJZA 4OYHA 3W5IA 1KAOA 3KQNA 4OHXA 3DM9B 2P3SA 3EIQA 3K0CC 2ZS9A 1XXHB 2IYRA 3ZJYA 5C2JB 1TPZA 3F8TA 3IIKA 4PC7A 1TAGA 2F3RA 4BGDA 4AWXA 5GVSA 2ZR7A 3QKSA 1AGRA 3X1ZA 2GJ8A 4C0QC 1QZXA 2F1JA 4R7ZA 1OXSC 1DAIA 1Z5ZA 2QBYB 1XTRA 5EE1A 3H1TA 4CEIB 4NL4H 4C0JA 4MRVA 1OH6A 2CNWD 4OBEA 4WA7A 4Q1DA 2VP2A 1R0ZA 1MH1A 4ZDWA 1E2GA 4J0QA 2ZETA 2GK7A 1FX0A 1JR3A 1TQ2A 2R6AA 3D3QA 3KL4A 3T1QA 1NBMA 4RFSB 1QHHA 2OSBA 1RRCA 3BBPA 5C1BA 4NCIA 5K8IA 3U44A 2FV8A 2O5VA 3ADBA 2ODBA 3CBQA 2QEQA 1GRNA 1XCPA 3PEVA 2GEDA 2WWHA 1GUAA 1ZINA 4XH9B 4D80A 3ZYCA 1Z47A 1BYIA 4UXHA 2OBLA 3SOPA 1XEWX 4B2LA 2PCJA 2FH5B 5CLLA 2XZOA 2JLSA 3A1VA 2V55B 4MH0R 5FR1A 4A6PA 1VKJA 3CM0A 2AXNA 3SQWA 1CLUA 4UQOA 1ZD1A 4XWAA 2BC9A 4OQFA 1G7CA 2LWIA 3B82A 5CK4A 4C0HA 3MMPA 5E4FA 4Q1FA 4PQYA 3V4RA 4QRHA 3LXRA 4QXAA 1DAMA 3IO5A 3UATA 3F5FA 4EPWA 3QG5A 1R0XA 3VHXA 2WWYA 5AUNB 2P5TB 2WOJA 5BXQC 1E9SA 1FQJA 4WZ6A 1E0JA 2QMEA 3CF6R 4GSYA 1YQTA 4BQSA 3GEHA 2ZRAA 3WMFA 3FKSD 3R7WB 2XOKA 4W7SA 4K8OA 2XNDD 2IYLD 5HKKD 1CTQA 4UXJA 3SEAA 5FOSA 1R0YA 2IT1A 1LTQA 1Q57A 1GL9B 1KO5A 3WP1B 4CEHA 1P9NA 1XZPA 4D25A 2OFXA 2G88A 4ARZB 2PL3A 3VR2A 1KO7A 4ACBA 2YZ2A 3B13B 5KSPA 2ZSEA 5DLQC 1Y3AA 5JCPA 1AZSC 2PJZA 4BLRA 5C18A 1E3MA 5TDHA 1VTKA 2IW3A 2GJKA 2ZEJA 2FFQA 1L7VC 3CRW1 4FN5A 2VRWA 4V02A 1W4AA 4DKXA 3B6EA 3ONWA 4RZXA 1EFRD 1T9HA 1ZC4A 2BJWA 3SFVA 1MABB 2IHBA 2OXRA 3H0KA 5JFGA 1T3HA 4QBHA 1AKYA 3Q8XB 2W6JA 4A0HA 1W2HA 3ETLA 4C2TA 2OFOA 2JJ1D 2CE7A 3U7EB 2FSFA 2PX0A 2W83A 2LKDA 3ADKA 3SBEA 1AK2A 1F2TA 4JLAA 2GDJA 3Q5EA 4DCNA 4F38A 4PHGA 4NYMR 3SN6A 2MSCB 2QENA 2QRNA 5A4JA 2F3TA 1QHNA 2WJGA 2OLKA 3N2EA 1VECA 4M1OA 3GJ3A 4A15A 3OE7A 1CP2A 4RZ2A 3V00A 4GMDA 3L0PA 1OH5A 3H4MA 1KKMA 3K0FB 5L3SB 2GCNA 2NZJA 4DVGA 3K9HA 2BBTA 5D3MA 2C8VA 1FUUA 2I3BA 3A1SA 3HYRA 3I5XA 2DYKA 4PPNA 2OEPA 3LX5A 1E2LA 3WHKA 5KDDA 2C9YA 4US2R 4AKGA 2V7QA 5EUQB 3TUJC 3A6PC 4G5SA 2QMUA 4NONA 4Z51A 5CYPA 1KSFX 1N3BA 2G3YA 1E9CA 1LF5A 3LY5A 3IKJA 1FUKA 4LDJA 1JQLB 3AGQA 4O25A 1NKTA 3CF0A 5JCZA 4M22A 2QT1A 1S3GA 4F93B 1ZUHA 4AYTA 1LV7A 4WOPA 2E9SA 2PMKA 1NY6A 1CR2A 5FOVA 5J40A 3VX3A 3QPVA 4OHZA 4MDFA 1K5DA 4LPKA 1P72A 3AVXA 2F1HA 2NO9A 4IEIA 5DE3A 4OI4A 5LB2A 4C7OB 2CHGA 5G53C 2Q6TA 2G6BA 3GJ6A 5FTJA 3C15C 2D2FA 1UBEA 2AXPA 2IUSA 3NH9A 4CRWB 4CW7A 1R8QA 1RJ9A 1FMLA 3RDPA 1VCNA 1CJMA 3IQXA 2VEDA 2NQ2C 2X1VA 4LV8B 4HUQA 4JLKA 1IHUA 5EE0A 4YDHB 1TMKA 1NRJB 2FGJA 3EZ9A 4X8OA 3QJYA 2VP4A 1W1WA 3WXMA 2XXAA 3GJ4A 4QHTA 5GJWC 4DEYA 5JEDA 3KUDA 4IOJA 1EFTA 1M34E 2NPIA 1W2GA 3THYB 3EX7C 5H8WA 1RE0A 3OFND 4PQFA 3DOEA 2B21A 1JAHA 1HURA 1KDOA 2WWIA 1B0UA 2PZGA 2J87A 2G0NA 3CPEA 1DG3A 1DTSA 4GDFA 3MWKA 1R8SA 1G64A 4JL6A 4TLDA 1I4TD 1WRBA 2GZHA 3EWSA 4L5BA 2O8CA 1Q3TA 2QU8A 4MRPA 5TMPA 4OQLA 3KQHA 5IHPA 4RD0A 2QA5A 1MO6A 2GF9A 4LZZA 3QKUA 2DFNA 2X8AA 3NBYC 4KFTA 4QGHA 3KTAA 4A2QA 3MWYW 4XVRA 2ZAOA 1N6RA 2CHVA 2EQBA 2R62A 3BFXA 2FE4A 3Q7QA 4M8NE 5AUQA 2BWJA 4KBFA 5E7IA 3HR7A 4JS0A 3B1WA 1JB1A 5F3WB 3IDQA 1K8RA 1Z29A 5AJZA 4B32A 2C5LA 4BRWA 4WAUA 5KTYA 5FUXA 4EPTA 1KK2A 2QGZA 2H5EA 3CLVA 3FWYA 2DFKB 4IOKA 1P7CA 4A36A 2XNSA 3GLHE 4PSVA 4HEJA 1D8TA 1HT1E 2WJJA 4WIAA 2XTZA 1XMVA 3CH4B 2OT3B 2WHXA 3QPWA 1VYVA 1UPTA 3ASZA 4B3FX 3W9YA 4B43A 4H1VA 4X8HA 2VSOA 1U94A 1LY1A 3NHBA 421PA 3X2SA 2G77B 3FE2A 4E22A 2VHTA 3NBFA 1E2QA 5TY0A 2WJYA 2BV3A 4M1YA 3EXAA 4D0GA 5AWFC 5CIWA 1XJCA 3IBYA 1OXVA 5F9HA 2F1IA 1OH7A 2UVQA 4B3XA 2BCGY 3BORA 2G83A 3A1TA 3MJRA 1EFCA 2Z43A 1OH8A 2REBA 3R8FA 3TR0A 4DIDA 3KKMA 4LYAA 2QAGB 1S2MA 1SZPA 4PPFA 2OM2A 2V3CC 4GT1A 3VHLB 3FOZA 4A0FA 1XEXA 1OSNA 1OXTA 2HCJB 1NL3A 1CS4C 4X8LA 4MRSA 4YONB 4IKEA 4JVLA 4Q47A 1UBCA 2YWFA 3QNUA 4LOAA 4JJKA 5L3QB 1V5WA 3ND9A 3CB4A 3IILA 1II8B 3QXJA 5EP4A 1YR6A 5FPYA 3VKGA 4Z1MA 1P2TA 5ELXA 1E96A 1BIFA 4U02A 3IPXA 2QBYA 2OXCA 3K9GA 2ZU0C 4DXAA 2ZS7A 2ZR0A 2WWWA 1EX6A 3ND8A 1CEEA 2IYUA 3K53A 3KXLA 2JDID 1QG2A 2EFHB 4QBIA 3GLIB 3QVUA 4DLZA 4QKQA 1TU3A 1W0KA 3KXIA 4YDSA 1BS1A 4RFSA 1UDWA 4QHYA 4G5GA 3EPKA 2HDNB 1GG2A 3GFPA 4S2EA 2PX3A 5KPJA 2PEZA 3J81k 1US8B 1FP7A 1XD9A 5KNDA 2MMGA 1T8UA 3TVTA 1N0WA 4LSGA 1IN4A 1SVWA 4BECA 4P4UA 1SHKA 4EJSC 4Q1BA 4TL9A 2JLXA 4A1FA 2ZI3A 2F1RA 1NMYA 1DO0A 3BRWD 2IS4A 1E2PA 1A82A 2RHMA 1HA3A 3I73A 3O47A 2NO6A 2CNWA 1XMJA 1ZUIA 2E87A 4ZIRB 3KQLA 2FU5C 1TX4B 3FMOB 1KSGA 3LH5A 3LXXA 1LF0A 1WMSA 3CKLA 2Q9CA 5EE5B 3V4FA 4AKEA 3NEYA 3LA6A 2XGJA 3GD7A 3W6OA 4DWJA 1PUJA 1XWIA 1SKQA 1KDRA 2PLRA 4LJAA 4GBMA 3GLHA 1II0A 5CDFE 2O8FB 4MQBA 3NH6A 4NYJR 2FZLA 2WWXA 1HV8A 3S1AB 1SVSA 5BYJA 4BPBA 3P20A 2IF0A 4BZPA 4TMWA 1CJUC 1GVNB 1P2VA 4ARZA 4BRUA 3RRMA 2H7VA 1SXJD 2VHQA 3ZS9A 2GXSA 121PA 4XTRA 1IBRA 4IVRA 1P75A 5FPHA 3L0OA 4M1SA 4B75A 4XVQA 2DB3A 2D7DA 1T0JB 2ZSBA 2G9NA 4OJQA 3SU8A 2YC2C 1KI3A 5M04A 2C03A 3A4LA 1MABA 2NTYC 1NG1A 5FR2A 4Q4AB 4XSGA 3FKSA 3RLFA 4B76A 2C96A 5FOWA 2XNDA 1P61B 2ZSDA 5HKKA 5SZIA 2R65A 1HQYE 4HATA 5LD2C 1JAIA 4KLNA 2QG6A 4LJ5A 1YR7A 2W0MA 4C0SA 5L8VA 1Z8FA 1X8JA 1SXJB 5FOUA 1AS0A 1WP9A 2GNOA 2C9OA 4NP6A 1J70A 3PFIA 1TQDA 1N6OA 2OILA 4HI0E 1XPUA 2CLCX 1VG0B 5FI1B 1EXMA 1EFRA 5DIFA 3VR3A 4D2IA 3FFBA 1G3IA 5JHGB 1GIAA 4NCHA 2PLFA 4BEBA 1LFDB 1CR1A 3EZ7A 2VSFA 3GMTA 4OJKA 4BUJA 4DSNA 5JS7A 2WTUA 1O87A 2ZUDA 3PXGA 2QGNA 1XD2A 1UKZA 2Q9BA 3D8BA 2ATVA 2JJ1A 1X3SA 4CDGA 3C8UA 5F9FA 4TLEA 3FHCB 4IHQA 1QBKC 4BZXA 1OB5A 5DI9A 2HT6A 1JECA 8OHMA 4YMWA 1II9A 3CNOA 1T91A 3CPHA 1XD8A 2QAGC 4M1MA 2FMXA 4HLUA 2PH1A 2KBFA 1VCOA 1NLFA 3ZIAD 5D3MB 5DHAA 3AF3A 4IDHA 4TMTA 2RGBA 2FFHA 2WBLC 5HCIA 2A5FA 1AM4D 4LK2A 3FFAA 1WCV1 1TTTA 4JLDA 3EIEA 2HXYA 5EP2A 2WJHA 3I5YA 4XTCS 1G291 4L4UA 3ADCA 5AJXA 1A2BA 1WA5A 4E03A 3GLIE 2NIPA 5DNYB 4TTPA 1ZBDA 2HJVA 5CDFA 4DCTA 4NYMQ 5BYKA 1GRRA 3THYA 5JRZA 3CX8A 4XVUA 2CCKA 2AL7A 3VR4A 4JYCA 2O52A 3SYNA 4CVNA 3K70C 3KUCA 3EZFA 4JKYA 2BMEA 2ZRLA 1OW3B 3I92A 3M1IA 3DHWC 3G5UA 3E2IA 3QXHA 2OO7A 3N5CA 3EASA 4LCBA 3T61A 2WV9A 1QVRA 1Z2CA 4EPRA 4HDCA 4UNQA 4XWOA 1E4YA 5KNBA 2J0SA 4BFYA 4DDWA 1IXSB 1QHYA 1DG1G 2A5JA 4MRRA 1GNPA 1YZTA 3P4XA 1MT0A 1ODFA 2ANCA 2QSYA 4UKDA 4AG6A 4BLSA 1E9RA 4M9XA 4HLQB 2XJ4A 1E32A 3DKPA 1ZM7A 4MUBA 4HAXA 2CBZA 3ADDA 1HTWA 4MYCA 4HZIA 2ZROA 3OFNA 1P60A 3DZDA 4HB0A 4NMMA 3A4NA 4BASA 5EZ6B 1W5SA 3CRQA 2VO1A 3CONA 4L9SA 3TJZA 2V54A 2JLYA 1F3OA 3QENA 4F4CA 1NKSA 2DCUA 3I3SR 1D2MA 3THWA 4BFTA 1XU4A 4Q00A 2KJQA 2CCJA 2J3EA 3X1XA 3W8RA 3EAQA 3T1TA 4UJ3A 1NMZA 2YKGA 1IAQA 5HZHA 1UADA 1EG7A 4ZCLA 3SYLA 2ZAMA 1ZAKA 2FZ4A 1KHTA 5EXSA 2Z0MA 4G01B 4HAYA 2VF8A 3UKDA 1T3SA 3W6NA 4QJ5A 1KK1A 3THOA 4AKHA 1JJ7A 3QKTA 2ZXUA 4PQRA 1YE8A 1AS3A 1Q12A 3RS2A 1UKYA 1CBUA 1NF3A 3TW4A 4QOSA 3VR6A 1DAGA 3WYFA 4O3MA 3L82B 1YJ5A 3L8YA 4KAXA 4YLGA 1H8ED 2RGNA 2HUPA 3BD9A 1MRSA 3U4QB 2YOHA 2IL1A 1AQUA 3CR7A 4GOJA 3C4JA 4V0LA 5CB6A 2WKPA 2YOFA 1G7RA 3QBVA 4TN1A 2J0QA 1OXXK 4Q03A 5L3QA 4HAZA 3U3KA 4NHOA 1ZUNB 1II8A 3ZGXA 5KOYA 3PUZA 5K8LA 1NMXA 4FW9A 4IW3B 4YMVA 2H57A 1G3MA 5H70A 1SXJE 2QP3A 2CXXA 2E1RA 3BOSA 4P32A 2XEXA 1KSJA 2Z5FA 3LWNA 1Z0DA 3W3ZB 2QPAA 1KOFA 3PR1A 3A8TA 3ZZUA 3UG6A 3QEOA 4BFVA 4ZDJA 4BFWA 2BIFA 2VP5A 3GLIA 2OE2A 3GJ7A 2B7BA 2J45A 2ZYUX 1X8LA 3BWDD 4HAVA 4A6XA 4CEJB 1RW4A 4IVPA 1XMIA 2B92A 1XFAA 3K9NA 1BMFD 4V0OA 2O8EB 2HEIA 3U2QA 2WOOA 1JJVA 1Q0UA 2IF2A 2ERYA 4AG5A 1US8A 1XEXB 1OIVA 3RABA 1U0JA 3MWJA 4BFZA 4V0KA 3QSYA 1HE8B 1G17A 4TYPA 3TSWA 1G9XA 2ZJYA 3PUXA 1FPMA 2QPOA 4LYFA 3LO5A 3T34A 3PUYA 4B6FA 4LYJA 3B9QA 4K81B 4KI0A 1R5OA 2HYIC 3F3YA 2V1UA 1SULA 1ZM9A 4CT4B 4F4IA 1AN0A 4BLPA 3T12A 3UANA 4TYNA 3KKPA 2WVJA 2YC4C 2ERXA 4X8MA 4ZIRA 4NDZA 3P1JA 4NCNA 2JDIA 4NPHA 5GADl 3L2OB 2LKCA 3B9PA 4RD2A 1O3YA 3FHOA 4QBGB 1VHTA 1Z6GA 2N1BA 2V4ZA 3OEED 1T8TA 1Z6TA 2REOA 2ZE6A 1SVIA 1VIAA 2CLDX 2VQSA 2EWWA 4KU4A 4RJLA 4OK5A 2J59A 2R6CA 1N6IA 1Y63A 2ZPTX 2FOLA 2QNRA 2O8FA 5BW8A 4Q4JB 2BM0A 1ZD8A 3TKLA 5JJLA 4TLBA 5FTKA 3SR0A 3OHMA 4D82A 5FBWB 1KI4A 2GILA 2VBCA 2VHJA 3S1AA 3GP8A 3GCGA 2GXAA 2Q3MA 1E98A 4PAMA 4ESHA 2BMDA 5DYIA 2WWGA 3LVRE 5E7MA 2IS2A 3KX2A 1WF3A 1JXOA 1XEWY 4OI1A 1M74A 2WKRA 4D26A 4TT3D 3LDAA 4US0R 2J7PD 3TSZA 4IDPA 3LRPA 1XCGB 3GLFB 2ZSFA 4TLCA 5EXXA 2RGDA 3QKRB 5EXPA 3PUWA 3Q72A 1Z0JA 4PO9A 4Q4AA 4DT1B 2F55A 2ZRBA 5JWHA 3GLHB 1HEIA 2RGXA 3FMPB 3QIAA 4M2LA 3BFVA 4FMDB 1IY0A 1KSHA 1N5LA 1OFIA 2V9PA 4KSBA 5CM8B 4FMCF 4EFMA 1FTNA 4HB4A 3FMFA 4CF7A 3D6TB 4QBFA 3FPAA 1Z08A 2IWRA 2W6ID 3EIHA 2V1XA 2RKOA 1SXJA 1IY1A 2Y8EA 5ANRB 4TQUS 5SZKB 3BH6A 2QP4A 5AUOB 4DDUA 3D7MA 4YXWD 4MKGA 4RZ3A 4B3BA 4TL8A 3VKWA 4WXRA 4I1VA 3SJCA 5FOTA 4UNPA 1GL6A 1GILA 2R6FA 2JASA 3M0EA 2XJ9A 1KJWA 2FA9A 4OK6A 4PO8A 4NYJQ 2FSHA 2RCNA 1SKYB 2BOVA 2XITA 4CYMA 4M21A 1SGWA 1Z83A 4NE2A 5JJIA 3T15A 1NSTA 1Q21A 3VQTA 1CJTC 3K8YA 3Q3JB 4K46A 1E2JA 4MGKR 4HZUB 3RS3A 1KJYA 4C4PA 4AYWA 3R9XA 3BJIC 2JLVA 4RSGA 1OYWA 1E99A 1DAFA 2BBSA 5IF9A 3A1WA 2GK6A 3QVVA 1CU1A 1VG8A 4GMXA 2OCBA 4IDOA 4G0NA 1NY5A 2IYTA 1G3QA 3LBNA 4PSAA 1ZW6A 5E3HA 2JIZD 4BZQA 5FTNA 2PT7A 1KKLA 1H8HD 1UBGA 1KO4A 4PANA 2OLJA 3GFTA 1KI6B 4PPQA 4Q7KA 5JRJA 1QG4A 1NVVQ 4EUNA 1RC8A 3GEEA 2CL6X 2ODWA 3HYTA 1U98A 3TAUA 2P5SA 2QT0A 1XD2B 1QF9A 2EFEB 3AGPA 1IN6A 1TNDA 1D9XA 1T4GA 2C98A 1P9RA 3DM5A 4URWR 1XBTA 2RH5A 2MSDB 1F5NA 2BCJQ 5EE3A 1ZNZA 1U81A 1KDPA 2A9KA 4B35A 2IYWA 5JWRA 1Z63A 2I1VB 2VIIA 2OESA 4W5WA 3Q5DA 3AUXA 2DY1A 3I8XA 4L15A 3H2YA 3WBKA 4JT4A 2IXGA 2QI9C 5F98A 1S4QA 3RSOA 3B8HA 1E1QD 1AJEA 4JBWA 3ZIAA 4LJ4A 1YKSA 4D4JA 3AVYA 3P26A 1GKIA 2GZDA 3K0EA 5B2ZA 4LJ8A 4I81A 4E07A 4B6EA 2JLRA 1F60A 4YMSA 1MRNA 2CDNA 3WYGA 4TYYA 1WQ1R 4A92A 1GNQA 4JSYA 1VHLA 1CULC 4NU0A 3PIRA 1U90A 1GM5A 1GL7A 1U8ZA 2FNAA 4AI6A 4PR0A 1NNEA 3CW2A 1QVAA 2XZPA 1B23P 4HAWA 4OL0A 3CZPA 2C2HA 2HXSA 1N2CE 4XSHA 1KI1A 3N70A 1C9KA 3LLUA 1PVOA 4AC9A 3AP1A 3PEUA 4I4LA 4PXAA 1OF1A 1Z0AA 2CJWB 2QROA 1UKEA 3QXXA 1IXRC 4M53A 3LBIA 3NIBA 2ZRGA 2ZI7A 1VG1A 4HYYA 1GAJA 1OIWA 1C1YA 2GEVA 4EPVA 1OPXA 1VYTA 4ON9A 4PX9A 1GZSA 5P21A 1RYHA 5KSZA 4AIIA 3SS8A 3EPLA 1ZM3A 2YINC 4DLUA 1W4RA 2MMCA 3AVQA 3WNBA 1OV4A 4PSKA 4V0ME 4A2PA 3DVLA 3GLFE 1D5CA 2GEUA 4HLDA 4Q1EA 2RB4A 4Q9JA 1YU9A 3NWJA 5LB4A 1S9DA 3U4QA 2XB4A 3VR5A 1YHNA 5CK5A 3VAAA 3QXCA 3BH0A 4ZKEA 3THWB 1IJEA 5C46F 2ZJ5A 4TMXA 3TGPA 2H16A 4TTQA 3VTKA 2YWHA 3KFXA 5J4YA 1XZQA 2O0HA 2OCPA 4Q7JB 4Q18A 3GQBA 4P3YA 1QRAA 2AX4A 2P67A 1U0LA 4TYWA 2VL7A 2ZE5A 2DWOA 2OUKA 1E0SA 2BHRA 3A1UA 4GZMA 4TMZA 3FDIA 4TSFD 3VU9B 4Z8XA 3AVVA 4US1R 3E5HA 2PZFA 2Z4SA 3K09A 2N46A 2IS1A 1EESA 3V9PA 4CEJA 2ZRCA 3I4LA 5DH9A 3GEIA 3UPUA 3CH5A 5FH9A 4ZO4A 1H8EA 2O8EA 4QGAA 2VH5R 2WWFA 1I4DD 4Z8YA 3TLXA 3X1DA 2DFLA 1SKYE 1XJQA 1OKKD 2UZIR 2RAPA 4XWKA 2FG5A 3BS4A 3REFA 1X86B 2XAUA 3DPUA 1RKBA 4WVFA 5E7JA 1S8FA 221PA 2ZIAA 2NO7A 2IYSA 3SJZA 4BLOA 2KI5A 5L3RA 3R9WA 3QF4B 3VFDA 3SE0A 5FUVA 1D2NA 1XNJA 3CNNA 1E79D 1ELOA 2JEOA 4KO8A 4TMKA 3RRNA 3UMSA 1TADA 1GDDA 2ZRPA 4NH0A 5KHOC 2FFBA 2EU8A 4Q4LA 3MLEA 3X1YA 1W7AA 2EWVA 1BO6A 3HP1A 4IXMA 4TYQA 1DPFA 3O8DA 1TU4A 4CZ2A 1BMFA 5FBVB 4POAA 721PA 2OG2A 3RS7A 3B85A 3E70C 3RYTC 2XTNA 4BE7B 3IEUA 1WBDA 2CEAA 3QG1A 2BEKA 3ZVLA 4DCUA 3TVDA 4B33A 1L4UA 2DBYA 5EP1A 4Q4JA 4CT5A 1VG9B 1G7TA 2NGRA 1GNRA 1ZNXA 1ZP6A 2V6IA 2RHDA 3DMNA 4IFBA 4JBXA 4C30A 3RRYA 1FQKA 5FUWA 3TQCA 1DAKA 1R6BX 5E95A 3VNUA 1YRBA 2N42A 4O2RA 4UNSA 1Q1EA 2FX3A 2CL7X 3A37A 3RANA 3MRSA 4A0RA 1KK3A 3WNDA 1LNZA 3KQUA 2YV5A 3EW9A 1OJLA 3AKDA 4NCJA 1XTJA 4HLUC 1UDXA 2WSMA 2LCFA 3OEEA 1S1CA 2O8DB 1FZQA 2F6RA 4V0MA 1DVRA 3SI7A 3GJ5A 3GLFA 1FNMA 4R2IA 3ZZ0A 1OFHA 3IEVA 3AVPA 3QKRA 2A5YB 1NSFA 1OIXA 4NCKA 4DT1A 1GFIA 1GOTA 1T6NA 1JPNA 4IFEA 1U8AA 1RPZA 3KXKA 4RFVA 5TV2A 2FPLA 2QTVB 3PG5A 3IHWA 5JJKA 1E2HA 5C4GB 2DWQA 3SJBA 1R7RA 5C4MA 3ZLJA 1E2EA 1KYIA 1I4LD 2FJUA 3CWQA 3JVVA 4MYHA 4PAOA 1GWNA 3TBKA 1XX6A 5KUTA 1AIPA 2ZVPX 2NPFA 2IS6A 4LHWA 3T1VA 4B3DA 4TT3A 4GRAA 3UG7A 4TQ9A 5L3VA 2J7PA 3C7KA 4P0TA 1Q3HA 1X8KA 4TQAA 1LVGA 1PZNA 1FFHA 1ZU4A 4YMTA 3TQFA 5B30A 3PJRA 4EFLA 3KB2A 4IOMA 1NVXQ 1NVVR 1NVUQ 4B34A 5JEEA 5LPNA 4Q01A 1UBFA 3LW8A 1PV4A 5HZKA 2KB0A 3B60A 3U3MA 3SDZA 2C95A 2J5XA 3ZQ6A 1L2TA 3QI2A 4DSTA 4HZUA 1M6NA 2R9VA 1W36D 3RC8A 1AQYA 3AKEA 3B5JA 2IC5A 4ESVA 2W6IA 2P2LA 2F7SA 3CO5A 5KYKA 5F2EA 3FTQA 3SHFA 4NZYA 4YXWA 4MYTA 5EUMA 2GBLA 3W5JA 4RY2A 2JLZA 1KI6A 4KODA 4LUCA 3PEYA 2HJGA 1JPJA 4BFSA 2QAJA 4YQFA 1I2DA 2ZITA 5CM9C 3AQ4A 3AB3A 1OFUX 3IIMA 3QBTA 4URYR 3U7GA 3C5CA 5DGXA 4M0LA 1D2EA 2BM1A 2XZLA 4A82A 1FMJA 2GA8A 2ZI6A 1G5PA 1A2KC 3HU2A 2FGKA 1QHSA 1ZYUA 4EPXA 1P3JA 3WRYC 1W36B 3LQRA 3OZXA 4MKFA 4AY2A 3GLGB 1XP8A 1LW7A 2RGNC 2IK8A 3OIUA 5IDVA 3ZD7A 2WZQA 3ZVNA 2JIZA 4PAQA 4TTRA 4DSUA 2QE7D 3P32A 2A7QA 3MJHA 4IOLA 1LB1B 1W0JA 2ODNA 3ZD6A 1H8HA 1OB2A 4MRNA 2X77A 4NYIR 1G7SA 2J0UB 3TK1A 3UIEA 3QOFA 4I1UA 4A0GA 1ZCBA 1XTKA 1Z28A 5DHFA 3PITA 3HU3A 1SHZA 1GKYA 2X2FA 5JSZB 1KI8A 2QY9A 2J9RA 4ITRC 4Q48A 5SZJA 3K0SA 4KVGA 4W5HA 4A8JA 1KY2A 3MUFA 3QQ5A 4IJMA 1M2OB 2VA8A 3O8RA 2QUZA 3NTUA 4JYBA 2C9CA 5JBQA 3AF0A 1FTSA 2QQEA 2TMKA 1Q20A 3UMRA 1UJ2A 3PQCA 4HB3A 2H8KA 1G3RA 5J4LA 4JKIA 4PPGA 1CJVC 4JLNA 3NXSA 4HDOB 2HLDD 5TB5A 1E1QA 3A4MA 1YZQA 2VHCA 3W8NA 3NHAA 1XRJA 2F43B 4D4KA 5CLQA 2YJTD 1Z6AA 4PC6A 2CJWA 3VNVA 2OBMA 2JJ8A 1QHGA 4O0MA 4LHXA 1OLOA 3KJHA 4WBSA 4UNNA
chains in the Genus database with same CATH superfamily
1BFDA 1HI9A 1Z3IX 2IBMA 3AW8A 4M1WA 4HGQA 4PLWA 1NNI1 4PIVA 3TLKA 2CNLA 4KDRA 1SCAA 3TR5A 5CEJA 5LU8A 1K4KA 1VI5A 5FT9A 3MELA 4XZ3A 4YACA 5CJJA 1C9EA 3DTVA 3K0KA 1WXFA 2RHOA 3B1ZA 4V0SA 4TTIA 5D51S 4J3NA 5E2IA 4JLOA 3TDKA 2A14A 3V1NA 2J41A 2QX6A 3IVGA 1LD3A 2X7HA 5T41A 3DO6A 5AP9A 1OXUA 3BMQB 1ZWLA 3AUSA 2P3LA 1PHPA 3MAAC 3FHTA 4URHA 1GGJA 2QLMA 1Y6JA 4HLCA 4QASA 1VCMA 3FCYA 4AY4A 3MCZA 4EITA 3R5JA 3C97A 3QU2A 4JT9A 4F4JA 2AYYA 1PJSA 1RXSA 2CDRA 5DDIP 2XUOA 3Q85A 2GM5A 1I3KA 4DADA 2O19A 1ZZGA 3E7WA 1R0RE 5SZHB 1R12A 3U4DA 3HA3A 1DX6A 3KPUA 1O9BA 4XIIA 4BKUA 3WLRA 2P6UA 2O0MA 2CFRA 1H6CA 5H68A 5KMGB 4W5NA 3LS2A 3UWMA 1FFXA 4L0QA 5EHGA 1G8HA 1PSZA 1O6CA 3IEIA 1KMQA 3DZ8A 2O3UA 3Q11A 1H6BA 3PHHA 2OHFA 4MVJA 1YBFA 3AEZA 3WL3A 1V43A 3K15A 3C4QA 3CJQA 2ZJAA 5F1OA 4C7VA 3A9UA 1OFVA 5TVKA 3RKSA 2AIRA 2HI0A 3VV2A 3PQ3A 4FXOA 4I3HA 1GNLA 3VKVA 3R5XA 1FA9A 4K6CA 1D03A 2AG6A 1P1IA 2Y93A 4KR6A 1G42A 1TZ2A 3PC7A 3OLYA 3M6MD 5HR5A 1OFUA 1DEAA 4BEWA 2AFHE 4RSRA 4E32A 1P1HA 1OFTA 5FI3A 4CLRA 1GP2A 2WAYA 2AQKA 2YYSA 3BMOB 1M2WA 4A23A 1Q7TA 1COWD 2RIRA 1R4ZA 2F4VB 1QPGA 5JD6A 4RVOA 3QF4A 1J8VA 2YXLA 4GW3A 3BMXA 3T99A 5FUMA 3ZDCA 1UDAA 3A25A 3NNSA 5FNVB 4M9QA 2RD2A 2Z4RA 1KDYA 1PQYA 3DE5X 5LMZA 4OI0A 2RGUA 3CBGA 1T5OA 3GYGA 3JPYA 4U6QA 4C4YA 4D8UA 2AZMA 2GM9A 3DFZA 3KHKA 3LLMA 1SXJC 2KMLA 4IJKA 3RT1A 1KDTA 1XT6A 4LMRA 4NPAA 4EL5A 4BE9A 2Q5QA 4X00A 4AL4A 2Z9BA 3KB8A 4ZT5A 2W2XA 3PQ2A 1XDBA 1N3IA 1XTSA 4WZBE 4BNIA 4AUKA 2GHQA 2NN3C 5BWMA 3DH0A 3V1LA 1OQAA 5ENVA 3AVTA 1XMSA 2XBLA 4Z9XA 1NU8A 2UYGA 4HGPA 4AUEA 3WWDA 4EA7A 4WBNF 5MGBA 4IGIA 4L6AA 3CSSA 2RMKA 3W5BA 3OY2A 1DXYA 2P6PA 4WINA 1LBTA 1CY1A 1FRVA 2NUTA 5J2TA 4AY3A 4QO8A 3SR4A 1JQ3A 4EGAA 2H0QA 5EHIA 1BH2A 3PXEA 2QTNA 1OTHA 5I7RA 2C78A 3GLGE 2ABWA 4RDCA 4TRNA 2ZUEA 4KXFB 5I7OA 4EKEA 3UXHA 4FJ2A 1GU1A 5L4NA 2H07A 1JAYA 4BEJA 1FSSA 1DAPA 1Z0FA 2ZTHA 4KE9A 3WHLA 1IOZA 1HEYA 2IA5A 5KNCD 2EW2A 2QRKA 4N6OA 2VUUA 4HVTA 3W5UA 4TSRA 1GEEA 2P27A 2VYQA 1BG6A 2X19A 4F2WA 2O8DA 2H2HA 2YR0A 2XXBA 2FWMX 3FR7A 1YIOA 5EP3A 2ZRHA 2NTNA 5L45A 2P2YA 3O9VA 3UQZA 1E0AA 1PL7A 2HQRA 1MXHA 3E05A 3NHRA 4XB1A 5JATA 4RTNA 2YV2A 1A77A 1U8UA 2C1EA 1U63A 1K6MA 1JEOA 4AMBA 2ZSUA 4JGBA 2FSVC 4LISA 4RWEA 1OLSA 1W581 2C3PA 4DA0A 2XF8A 4JNKA 4KDEA 4MS3B 5LA6B 4D9NA 1DELA 2NQTA 5SICE 1Y9EA 3LPNA 1AUXA 1I7SB 1H5UA 1W5EA 3CS3A 1JP7A 2ZSHA 4NS4A 1H93A 4BQIA 4N0EA 1RI1A 4IUYA 2F48A 4BBZA 2MHCA 1UDRA 1I4OA 3DEYX 3TMKA 4HSEA 3VSCA 1CXZA 1CY8A 1SOAA 3USZA 1SIOA 1DMRA 1RRGA 1W4ZA 3NU1A 5E8JA 4L74A 5LBUA 4C0LA 5B55A 1MAVA 3U0BA 3OPQA 1RYBA 3M1LA 3OTHA 4PFKA 4EY4A 2A1TS 3OP4A 3PGXA 2QI9F 2H1RA 2ZJZA 4HB2A 4YO7A 1I8TA 5DO9A 5FWDA 3K20A 3BSWA 3UHFA 3CRMA 1M1YE 1HDYA 2HIAA 3D3NA 5TGZA 3AZQA 4F1WA 5LYJA 5FL7D 4DEVA 1ABEA 1NX9A 5FOXA 2BKLA 3GQVA 1ZCAA 3P9XA 3K6SA 3B7GA 3U6KA 1PGNA 2XCTB 1L1EA 3R20A 3PLRA 3WNVA 5BVGB 1LV8A 1NVMB 2BEUB 1VDZA 4HDAA 4JT2A 3ZY2A 1B8VA 1IWOA 1ZU5A 3Q6IA 2QQ5A 1O54A 2B4RO 2NVWA 3I1JA 4R1QA 4BU1A 4IMJB 1LLCA 1THMA 2XUGA 3LUPA 3PFFA 5FLEX 4CF6A 1PWYE 3CE9A 5B4VA 2JFXA 4EPYA 1UJCA 4X66B 1NASA 1PI3A 2RBGA 5D7NA 4Q1AA 1UBKS 3VVMA 4AURA 3MUNA 2P9QA 1OT3A 1YJAA 1A8UA 1ZGGA 3IVAA 1DZIA 5CNMA 4N6GA 1NG9A 2BR3A 4L8FA 5C1PA 5ALNA 3OZTA 3MYRA 3WQSB 2NZXA 3L7KA 1M5UA 2F00A 3ONFA 3TFQA 1NN0A 1CKEA 1JHZA 4O2AB 1A7JA 3EY4A 1C1DA 1H65A 3IDSA 1RC1A 4HJXA 4ID9A 5JMPA 3U16A 4KPYA 2UXCB 4PG4A 3NBMA 1FUIA 3O8OA 1TZJA 4O02B 2AD1A 3LC7O 4PXYA 3COJA 5TPWA 4YHHB 3VC1A 3ZWOA 2PZMA 3WJ2A 1HE2A 1POWA 2BI7A 1QDLB 1PGOA 2V8BA 4OREX 2BDTA 2QRPA 1QS0A 1NAIA 1J9ZA 1CC1S 4C07A 1ORVA 3GZJA 2V7PA 4YC7A 3S55A 2FUKA 4AF8A 4DEXA 4F4HA 3SFZA 3D3EA 5BWNA 5HQ3A 4L9AA 4BQOA 3T35A 3WK8A 1QVVA 4NBSA 1DB3A 4DDVA 1U3DA 4IUBS 4L95C 5BSGA 1E1NA 2WLSA 4ZCMA 4KH0A 5KTOA 1MKYA 2Z58A 4JVSB 1P5HA 4HHEA 2YWDA 3EGOA 2XUFA 3TEFA 4XCVA 3TLAA 4HVCA 1GVHA 1W0JD 1SQ6A 2BFOA 1FRQA 1VHWA 4KN9S 4KOEC 4A9AA 4D0NA 5AESA 5JI3E 3O03A 2HMWA 2J0UA 1OT5A 2IY8A 2PKWA 3F1LA 1RBYA 1V25A 1SVLA 2Y1XA 5JG7A 4P83A 3X43A 3DOIA 1MO2A 4LGVA 4ENSA 1KQGA 4PHFA 1W5TA 3CX7A 1ACMA 4GOXA 4F9TA 1U31A 4XRGA 5JSZA 1NDQA 2V9ZA 1ZM2A 3H19A 2Z83A 3AF2A 1H3FA 3HCBA 1N92A 3W4IA 1M54A 4V39A 4Q21A 4KE8A 3NBZC 5AVUA 4NTZA 1N32B 2WICA 2Q1WA 4CMIA 4ARSA 2GCOA 4DL9A 4BV8A 2OXTA 1R4NB 3AB7A 3TQOA 1PCXA 2VXYA 2XUHA 3D4IA 4MWGA 3BDAA 1RBQA 5AI5A 2UUBB 1N2SA 3W3AA 2QE7A 1MC8A 2CY0A 4Z2YA 3A06A 2V6JA 3UV3A 4XJVA 4EJSB 5HP4A 1U0RA 3AUTA 3NNNA 1SVOA 2A86A 1H2ZA 1RWNA 3ITDA 3HWWA 5TQ0A 2PS0A 3RVQA 4F2GA 5IN4A 1RZRA 1HE1C 3BMNB 4N3NA 5AJWA 1MXFA 1MW8X 4P4LA 3KIPA 2RK4A 2R8RA 4UMFA 4UJ5A 4C6HA 1XDWA 5BMVF 3QQPA 4MEBA 5HKAA 5IW8A 5BSVA 1ZCFA 4N8EA 4JC8A 4JI7B 4O4IB 2H06A 1DTWB 2AFIA 3H3FA 4DDHA 4HUTA 5KQGA 4CIXA 1BEEA 3G7SA 4FLEA 4I66A 4KQ1A 4A8JB 2XV1A 3MSXA 2VDLB 4MW6A 4CCWA 3GK3A 4Y0VA 4RTPA 1YBVA 2Y4OA 3KJIA 3BK7A 2CHQA 1UBTS 3KDSE 1TMOA 3VZPA 4REQB 2Q21A 3WLNA 1JS1X 5TX7A 3ZGOA 4RABA 5L4SA 4TLAA 1TT5B 3AT1A 4R68A 2HJRA 5FBLB 2HLDA 1Z4MA 3JWIA 4HT3B 2WF8A 4AO6A 1JDSA 5A4KA 2VOJA 3FMGA 3LFUA 1KO8A 3G88A 1CQPA 4I1RA 2H7YA 1VGVA 1VYUA 1XGKA 4CR7A 1XAIA 1L4HA 1ZKDA 2JK1A 4XM1A 7GPBA 1XEFA 1WXXA 1RYYA 4D9FA 1SN7A 3ETNA 2EFGA 4PTLA 4MIKA 1KMHA 1WDTA 3H8WA 4UHHA 3L7NA 4D3DA 4NNJA 2ZANA 4RA9A 5BYAA 3KUKA 1JI0A 4UU7A 5D3QA 4EW3A 4TXHA 3NMUF 1JHQA 5KDLA 5LSAA 1KEPA 3SF8A 4EYQA 3QTLA 1I2MA 1N9GA 1W6UA 3IKVA 4LRQA 4OQNA 4PYOA 3TLZA 4DCOA 1A0OA 3KTOA 1WLSA 4GKVA 2CLIB 1ZRSA 5ETJA 1JKFA 3UMCA 2XI4A 3V8RA 3VPGA 3ZXUB 1GCIA 2LR0A 4C3ZA 1T8SA 4AKSA 4I55F 3HEBA 1NN1A 1P0FA 4HPXB 1UAAA 4DJDC 3N2GA 5FORA 1HC7A 3DAOA 2VK8A 4GI7A 4CR8A 1N3YA 1XZDA 2ZUTA 1JFFB 2X1HA 1KJQA 2G1KA 1KK0A 2HU5A 4XYEA 3AXSA 1NKVA 1D4ZA 1FP6A 4CKXA 2IIVA 4GPTA 1A4IA 2B35A 3LBHA 4QQNA 1ESNA 3H13A 2YJ6A 3E1SA 5LD2B 1A2QA 2F64A 2BFCB 2AFRA 5TC4A 2Z6UA 2NO0A 1CIVA 1Y5NA 1HQCA 2WU8A 1J1IA 4DAOA 1SUEA 2JAQA 1EX1A 2LRHA 2OZVA 4RIHA 3A6EA 3FOWA 3PENA 5AXAA 3RHSA 2F8LA 1YFKA 2ZREA 3BE8A 5JHHB 1KETA 2YQ5A 3IQFA 1MB9A 4M37A 4Y6LA 3ZU4A 4FMBB 3T3IA 3EAGA 3EFHA 2JC3A 1G5RA 3OEHD 5K0EA 1XF9A 5CW1A 2J1LA 4AW9A 1ZSYA 1FYWA 3O8CA 2IXEA 1DX9A 1S7CA 1XZMA 1HOXA 2A0FA 2H1IA 4IH1A 4O2BF 3QITA 2QZPA 2ZRFA 3JQ9A 1EEXB 1U0GA 4BIMA 3REGA 5JADA 4GOOD 1YQWA 3ZWVA 5A4IS 3EGVA 5K7SA 2RGGA 2BD0A 3TWOA 1JR6A 4W9MC 4C78A 2ZJ0A 4QVGA 4WW0A 4A7PA 4D43A 2ZJ7A 1N0UA 1OAOC 2CNDA 3JTEA 1JQEA 4IILA 3AWIA 5KTKA 1WXGA 2NZWA 1MEOA 3JQ7B 3ZDEA 3C85A 1U2TA 1T9GR 2ZJ4A 2NYVA 3IESA 4FIDA 4FKZA 3H84A 3VKUA 4E31A 1GN9A 4JB0A 2QTLA 4XGIA 3CX6A 2OCLA 3LLSA 1GY8A 1EI9A 3IIEA 1COWA 1UDBA 4CKBA 1U1FA 2PANA 4YGXB 4NKRA 4ZO8A 2FZKA 2QSZA 3HCDA 3F8WA 5M2QA 1UR5A 2JH8A 2RKWA 5DYTA 1VMAA 2MYNA 1CDZA 1K3FA 4LTMA 3ICQB 1K5GA 4F92B 1IM2A 4PGFA 2NU7B 2XNHA 1HUQA 3G0IA 5GIPE 4IIVA 4TXLA 1GSIA 1DNPA 4L9WA 4OX9B 3AVWA 1XZIA 2JAPA 4P31A 4W63A 1G1MA 1MO3A 1PKEA 1ZNYA 1U99A 3KKOA 1QIFA 5IT5A 1P73A 2A3NA 4DG9A 1EVLA 3B5IA 3NC0C 2Q46A 3QVWA 1UKVY 2ZM5A 3KJEA 4EEKA 5K20A 4O4JF 3M4JA 1SK9A 4EDHA 1VIMA 4MW7A 1RVDA 1JLLA 3CVJA 2IHTA 5FAXA 1YOVB 4PM4A 1TAQA 4PHTA 1JDTA 3IAS6 3MYYA 3CKMA 3PVZA 3QFFA 4QOJA 4XPIB 3OX2A 4V0NA 5ALTA 2WJIA 3SPXA 5J4VA 5JRDS 3RAPR 1DARA 3HPQA 5JSFA 3RSGA 1ETHA 1CIPA 3CTPA 5DYYA 2GESA 3AJ9A 4M86A 3LL4A 3KWJA 3VU3A 1Q1BA 2O0JA 4DANA 2Z4TA 4YPVA 1OJ7A 3TS1A 3UMFA 4DHWA 2B8TA 3HPRA 1J7JA 2OCKA 4P7JA 3WK5A 5KNCA 3S68A 4OXKA 4RMIA 4CQJA 4J9VA 3T7JA 4F2PA 5CITA 3EXHB 3C4VA 5BW6B 2BMJA 4UFPA 2GO1A 4YQYA 4H4DA 3RHZA 5A62A 2DF8A 2HLNA 1R4MB 3KKQA 3MD0A 4LV6A 5JECA 1J09A 1J06A 2JAUA 4LBWA 4M38A 1L7PA 1NATA 3F9IA 5IVPA 2ZR9A 1KXJA 1H4VB 2X9VA 1JYFA 3I34X 2C54A 2H7XA 3RUEA 4MA4A 1OLSB 5E4YA 3VJRA 1W88A 2BEVB 2K2QB 1I3OA 1ZJ6A 3AUYA 3BK1A 3TNYA 1AMOA 4EFNA 3LVQE 2CLSA 5DKFA 5NULA 1CUWA 1E8NA 4JA2A 1IN8A 2P90A 1E2BA 2H08A 2I6TA 3DW1X 4CI0B 3JYHA 2GN6A 2IDMA 4A8JC 3W4JA 3GXBA 1NXXA 4V0QA 2AX3A 5CDYA 5HM8A 4F04A 1F14A 4XIJA 1G98A 5DXAA 4EVQA 3KZCA 1Y8RB 3KQKA 2OK7A 2GBPA 2WR8A 2VAWA 4FT4A 2XOKD 4CLOA 2QRQA 1PK8A 3V5NA 3I32A 1Z25A 2AZDA 3G8CA 4Q66C 2X0NA 1AURA 2D74A 3MJVA 4WZAA 2XQGA 2HGSA 1IJBA 3IUYA 2A5DA 1LS1A 1TF7A 2AT1A 1G2PA 5FL7A 4RHUA 4F7DA 4ZU1X 4PLPA 1EFUA 2QM7A 5CD9A 1E2MA 5IDWA 2ZCUA 2EYQA 1WD5A 3ZY6A 5HK9A 5JMWA 2QN7A 1FMFA 4HS4A 5KVSA 1QGED 2ZS8A 1U7TA 4GQIA 4YCLA 4XFJA 1JFLA 3CG0A 4BNTA 4G0QA 1DKNA 2CDCA 2X5JO 1Q7GA 4I3GA 4JYMA 3TGWA 3VHXB 5FTMA 3B2NA 4M9RA 4RANA 1RRPA 3FZYA 4NBKA 3TRHA 3W7VA 1SH7A 3GRYA 4XASA 4MR9B 2PWPA 1G0NA 2WHEA 5KQRA 3G5AA 4DLRA 1TM2A 4XWGA 1HETA 1EGVB 2W6JD 4FNGA 2JKVA 4LJ6A 2ONKA 2X3UA 3OIDA 4FR0A 2K4MA 2ZSKA 4R1TA 1G4UR 4RVCA 4TZTA 2WUGA 3UCFA 2GWRA 2Q4DA 1PYDA 1SRQA 2OAP1 5GZ6A 2GZ1A 1ZL0A 3EZGA 1P19A 3O8OB 5D5QA 621PA 2PUDA 1G6OA 4LBVA 5FL3A 1PUIA 4WXYB 2WSYB 4N0DA 3P5BA 3PNQA 4KWEA 3H86A 1UT6A 3JQQA 4HTAA 4CM5A 3QEMA 2XSZD 4UNRA 3G0CA 1JDJA 4HL6A 4QNNA 4ADSG 4PC3A 3BC1A 3ED5A 3K0FA 1DUIA 3TIFA 4LJYA 2PBFA 3FR8A 1Z73A 4C76A 2QG9A 3QWIA 2R66A 5D8DA 1OYYA 521PA 3CR8A 5DBOA 4TUYB 4C4XA 5JYBA 4QPCA 1PHRA 1W44A 1F6BA 2QUJA 3L6DA 5DNEA 1G8PA 3DMHA 3F9RA 3QFTA 3DO8A 1ZH4A 2GKGA 3OLZA 1EDBA 4DTCA 4DR3B 2C4NA 4F7WA 2AWNA 3CUEF 4L76A 2HADA 2X23A 4LC0A 5T57A 2UDPA 5F76A 5LFAA 1DSSG 2JCYA 1DKUA 2XCOA 3E7XA 3PFHA 1NR1A 3FPBA 4LMAA 2O5CA 3FWPA 5GJCA 1DKLA 1WO8A 4S24A 4QEDA 1SCIA 5JQGF 3A14A 3JSAA 3TW8A 1PW7A 3ZE0B 1SBYA 3PTLA 2Z2KA 2JCXA 4IZHA 3CQ9A 1YZKA 1JSZA 2OBBA 3HA2A 2MINA 3ICVA 3T6KA 3FUXA 2J30A 2M6LA 3TUIC 5A6VA 5I51A 4LXQA 2H4JA 1PKXA 1WP4A 3P2YA 4PHHA 4HDSB 1JWLA 5B1EA 5LP6F 1ZHFA 2J3KA 4NZPA 4BKOA 5BR4A 4DCVA 2C58A 2OENG 2G5GX 4HVLA 1SKUA 4Q6WA 1Y81A 4HDQB 4N41A 3HZHA 1R37A 2NO4A 1ZM4A 2JGRA 3UOWA 2XQFA 3LHSA 2R47A 1DC5A 1H22A 4KQ6A 1M8JA 3TOVA 3GRPA 1QNLA 2OB1A 3LQQA 3ZCQA 1OU4A 2GCOB 2ZSAA 3SM9A 4B47A 4WEOA 2Q0HA 3NUQA 4MJXA 5THQA 3VX4A 2XDAA 4OQDA 3SHVA 1T0HB 4DMCA 1WQ4A 3CNLA 2OHOA 1FYFA 4W99A 1GTVA 1O57A 2GN9A 4A6EA 4E6PA 4P0QB 4QPDA 1GPLA 3IBGA 4P7BA 2JCSA 1Z0UA 2H17A 1AVTA 2KPOA 4G5OA 1P1RA 1I4EB 3JATA 3OCZA 3G8BA 3FGNA 2HMYB 1EDDA 3K35A 2ICAA 1PF7E 3TZEA 3H1PA 4YAWA 1G20E 1X0XA 4ZANA 3VNQA 2HPVA 2OGSA 3DBIA 1JALA 4DBLC 1RLOA 4AT1A 3ZZ1A 4FSXA 4C4TA 2NO5A 4KYUA 4MQ6A 4JX8A 2KE5A 4D4LA 3EVTA 1PLLA 3RSLA 1AHNA 4MWDA 4LI0A 4FZVA 3U09A 2Z5GA 2P2CA 4IDDA 2Q99A 4GEGA 2VXCA 3IDFA 4I7EA 2BGKA 3GUZA 1W4CA 2D0DA 2Z6VA 3CWZA 1J8YF 4KAFA 1QCZA 1RQRA 2GLUA 4NMLA 4ZOAA 1ULZA 2QD4A 4FZ5A 4D92A 5EPOA 5JZBA 6ABPA 4XARA 3UBMA 3MWEA 1N9ZA 3KBBA 3KQYA 3B51X 4ZI2A 3U7FB 3RG2A 3NHFA 5AXBA 1YE5A 1BWSA 1PIWA 1VXOA 3DL4A 1JR3E 2A67A 1VLMA 4G5RA 1O6FA 2OHXA 3G3EA 4LYEA 3PK0A 3BAFA 2QJTA 4YCAA 4YR9A 2QTAA 3GUHA 4UUMA 1E3LA 1EWQA 1NQTA 3KQVA 1BH6A 3GDFA 4W5JA 1H9BA 5AM1A 3W5SA 4ERNA 1U3CA 4WNIA 4DCPA 1P0IA 5C3MA 5AVSA 1N33B 3HG7A 1XJ5A 1BA2A 1JIQA 1AUQA 1N9GB 1PQUA 2C61A 2JVJA 1DQZA 3T3HA 3NUGA 4RK4A 1CFJA 3SIPA 2G7ZA 3IXQA 4ZN6A 1I1QB 4RTOA 4OEHA 1EFAA 1IBCA 2P11A 2PCLA 4YRPA 1KZ9A 3A4TA 1GITA 2C3YA 3AEQA 1R8JA 3UHAA 3N6XA 4FC6A 5CJ2A 5I7WA 1JEQA 3N86A 4HQFA 4M9ZA 3G0GA 5B57C 1K4MA 3P9CA 5FUBA 1PWZA 5GAJA 1RWXA 4Z54A 2ANBA 1MDBA 1STOA 1GGVA 3AP2A 1LBSA 4FDLA 4JBYA 4C5CA 1N8KA 1G41A 3I9V1 1CJSA 4GWLA 3HUFA 1KOJA 1JEDA 3I1FA 4DLYA 4EGSA 1ZH2A 3JSXA 4GNRA 1GR0A 3ABZA 1EVIA 1Q84A 1WG8A 3SC2A 5G3YA 5F23A 4QXPA 3DDCA 1YACA 2Q2OA 3K6JA 2FUG6 4DDKA 2EP5A 1JWAB 5J4KA 3I5MA 3OEHA 3MG9A 4B9EA 3RH0A 5ADHA 1PSWA 1IHYA 2ZVQX 1Q22A 1CYDA 2V4UA 4MQ5A 3CPSA 4OXQA 5GOTA 5CG2A 2IUTA 1NFRA 1NQOA 2A2ZA 4JC4A 1X1TA 1PTJA 1DU4A 1NV8A 1GNSA 3ZI4A 4UU8A 2XRMA 4YRGA 3Q9LA 5KWVA 1U3VA 1Z82A 4GH5A 1KTVA 1JNXX 2AOVA 3QLEA 4CM3A 4Z1MD 1V0JA 1VCIA 3PFKA 2GAAA 3OURA 3ASVA 1NVBA 4MCAA 1A1VA 4LHVA 3FYSA 2WAXA 3WZ2A 2Y92A 1BWPA 4QFCA 3PYLA 1M8GA 2EGUA 4LDQA 1X92A 1G2OA 2R8ZA 3PUHA 3IODA 4TS4A 4URUR 3GGGA 1NIPA 1RFLA 3AYXB 3DZFA 3H2KA 4U00A 3SQXA 1XA4A 1Q17A 1KAQA 2IVFA 1W0KD 4EJFA 1M7GA 1SCDA 3VISA 1EVQA 1W36C 2IYVA 1ZMRA 2Z5VA 1PJZA 2QL7A 1RQNA 3K1JA 3PNPA 4XDHA 5EGNA 4PLZA 3NPAA 4ZI3A 1FYXA 2IX3A 3W5IA 1QBGA 3NGXA 2P3SA 4H0NA 1CW2B 1LU9A 2IYRA 2ZS9A 3NWBA 4Q7QA 5C2JB 2XY4A 1UPUA 4G0XA 2PS3A 4BGDA 1A69A 2F3RA 5KTRA 1FB5A 2CLFB 3N74A 2E7ZA 3RUHA 4MMYB 4C0QC 3ICPA 2HMAA 4BO4A 2YXNA 3QMPA 2ZPAA 2P41A 4QARA 4F6RB 4I1PA 2HSDA 2R3SA 1XZJA 2HTFA 4NQRA 5JD4A 1QE5A 1A97A 3UW3A 4QXMA 3B8EA 4NL4H 1ZS9A 4IS3A 1UBNA 4MRVA 1PT7A 5JD3A 4DCMA 3VTZA 3DDOA 1OH6A 4Q1DA 2NXJA 1NHWA 2WU4A 5K3FA 4XUDA 2AE2A 3OFSA 3I5AA 2C7PA 2QU7A 3D3QA 3QP9A 5I8WA 1M34B 1T9AA 3THRA 1EE9A 5C1BA 2BR4A 5FF9A 3PE4A 4KXVA 1X7XA 2PRKA 1CQZA 3MOGA 3I6BA 3ADBA 4FJ0A 5HJEA 1I5RA 2ID4A 4EX7A 1Q7EA 1ZINA 3E82A 3FZEA 1CZHA 2AEMA 3ZYCA 4R40A 3SOPA 5I7SA 1IJKA 2BTQA 1G63A 4HNRA 2PCJA 3IAEA 2XZOA 3PKJA 3A1VA 2EWMA 2XNKA 3L7IA 2FWAA 1NUTA 3HKEA 4A6PA 1CRLA 3HVUA 1JLRA 1CLUA 2R25B 4JHLA 1QONA 5DASA 1YR3A 4CMEA 3HB0A 1W1IA 3HA5A 2BC9A 4XWAA 2OBXA 3A1FA 1GSAA 5IAKA 3SMVA 3B82A 5DGIA 3ZW8A 3JYNA 4TLMB 4YJ2A 3RTEA 1NDUA 3WGUA 2JBHA 1YQEA 4G4GA 2JRCA 5E4FA 1TEHA 4DY6A 1V48A 1YVRA 3ZTWA 1U80A 3UVEA 4QWMA 4JWTA 4PICA 1IQRA 3HUTA 5CFRA 3UATA 1A9XA 4BN0A 1Q11A 4JT8A 1T1IA 2B5OA 3O1IC 3R0IA 1R0XA 1S2IA 2HA5A 5FX2A 1UWKA 5AUNB 4XFKA 2WOJA 2C4TA 3ND5A 2YZMA 5K0BA 1FQJA 4E2WA 3CUTA 2X8LA 4IZOA 2QMEA 3AFIA 3C3XA 3V4SA 2ZRAA 3WMFA 4NAHA 3RCBA 1A5AB 2XOKA 1U8EA 2NUBA 5AH0A 2JHFA 1JLMA 1KYZA 4R1LA 3WKDA 5HKKD 4UXJA 3SEAA 3HKDB 2X4LA 1ISJA 1LTQA 4RFLA 3FZQA 4QYIA 2IEAA 2Y71A 4NCXA 4WY8A 4HFMA 2JFGA 2WMYA 1WPQA 1YONA 2I3DA 3ONDA 4OTZA 2WU1A 4D6XA 4DQUA 2OFXA 2G88A 4D25A 2PL3A 1O6ZA 2ZGVA 4PY2A 2YZ2A 3LPCA 5KSPA 4G9BA 2HTEA 3H0CA 3KWMA 2EKDA 4LDPA 1AZSC 4JQCA 2PJZA 3GVCA 5JT1A 1S3FA 2FFQA 1L7VC 3JXEA 1ZJZA 4AY5A 4V02A 5H5JA 1VLHA 2FW9A 3S27A 4E2YA 3SEFA 4RZXA 2C7RA 1ZC4A 1T9HA 2VK4A 3OLWA 4WE3A 1QIKA 3DBOB 5SYNA 4G8BA 1FXWF 4OOFA 1WY7A 3JD0A 2XCSB 5JFGA 3GRAA 1ODCA 3ZPXA 3R0JA 1AKYA 3VPAA 2C88A 1NI4A 2A92A 2P78A 2W6JA 4IHJB 1CY4A 4A0HA 3ETLA 3V2IA 1VJ1A 2FPGA 2VHEA 2CE7A 3OIFA 1SG0A 2P79A 2PX0A 2WG1A 1U5BB 4FWBA 4NK5A 4N0QA 3IHTA 4AN1A 2J3JA 9GPBA 5DNDA 1P81A 1SOUA 4HC4A 4IDBA 4CMKA 5BR1A 2IIQA 3RSQA 3Q5EA 2YL2A 5L6LB 2WYWA 1D1TA 1L8OA 4PYRA 3W78A 3PDUA 3WGZA 2AGVA 2O2IA 3SN6A 2MSCB 5CGQB 1REQA 3Q88A 4AUNA 3W04A 4YRNA 1QHNA 4QJIA 3N2EA 4A15A 3LC1O 1O96B 2X76A 4RZ2A 2HRCA 3M9XA 4GMDA 4JJ8A 2AYXA 1IY9A 2G67A 3B1JA 3H4MA 3K0FB 1QTRA 3QVSA 3RU9A 2NZJA 2PO5A 4DVGA 4C05A 3QPDA 1IHPA 5D3MA 4OQQA 5ALJA 3QU5A 2DSNA 3JQ9C 3M83A 5IC6A 5BYBA 1L5OA 3S2EA 2WJPA 3S3TA 4OQZA 3UXEA 5JNUA 1E3SA 5CVTA 2IHKA 4U7JA 2QMUA 3EQZA 1ZOPA 3JD2A 3MB8A 1N3BA 4RPHA 4U2GA 1E9CA 2RHHA 1LF5A 3LY5A 4I3FA 1FUKA 4O25A 3KZMA 3D8HA 3CF0A 3INYA 1MHTA 5ALZA 1S3GA 4HX9A 5HWSA 3CSDA 3AERB 1YT5A 3Q41A 4D9GA 2A0WA 2V0CA 1NRIA 2AEEA 2Q4TA 1NQAO 3HKCA 5J40A 3VX3A 2C5FA 4DKJA 4OHZA 1C3EA 1EG2A 3AKZA 1P72A 2NO9A 1RHQA 3H6GA 4IEIA 2YQ4A 5DE3A 4V3BA 5ECGC 4FNAA 3T1HB 2G6BA 4NXNB 1R74A 4AKTA 1ZXBA 5KNBD 3KXPA 4KDFA 1UBEA 2JBAA 2IUSA 2AJLI 2VEOA 4J75A 4CW7A 3GNQA 1AB5A 1RJ9A 5CX1A 4LXUA 3AIOA 3NWOA 3CZ4A 1P0MA 3EVGA 1X0VA 3HH8A 2PUVA 3EJ6A 1N1EA 3IQXA 2VEDA 1J0CA 2Z9CA 3NT4A 2WYVA 4X3CA 2XT9A 2BEWB 2G8NA 2TMDA 3RVRA 4GKBA 5EE0A 1H42A 3DEKA 3Q12A 3U48A 1SQGA 4NBWA 3TEMA 2FGJA 3U4MA 3QJYA 4L8WB 5PGMA 4EATA 2XXAA 1J8FA 4DEYA 2Q62A 3PIDA 1Y8CA 1HF3A 1Z36A 3M81A 5ITSA 2BH2A 1NMSA 3O4VA 4KREA 3M8KA 1LDEA 3NKFA 4PYKA 3WDKA 1FLAA 1XR3A 5KZMB 3I45A 1RE0A 3OFND 5ESRA 4PQFA 2CSXA 3CF4A 4G0YA 3LI2A 4JBGA 4KQMA 1JAHA 1RWQA 2W48A 4Z3KA 4KIJA 2HSZA 2YZKA 3K1YA 4D0RA 1MZPA 3GCXA 1YIDA 4U39A 5J2UF 3N58A 4I50B 4EZIA 1AH2A 4WBNA 1PEDA 1XVTA 1VLQA 1WMBA 2PH7A 2QJWA 5AIBA 3HRKA 5JR3A 1FEZA 1I0LA 2Q1TA 4L4YA 4L5BA 3TTVA 1UEXC 1XKLA 5C31A 4DM7A 4KBYA 4MRPA 5JPDA 3KQHA 5IHPA 4RD0A 1BU5A 1EA5A 2AFVA 1ZUWA 1KJ8A 2GF9A 3DL7A 4QGHA 5CVUA 3HACA 4I6EA 4KFTA 4C6SA 3TLYA 4QT4A 4N8SA 1RAGA 2BFFA 2O2JA 3E7DA 2CHVA 4EX6A 4F72A 2FE4A 4KBFA 1JDBB 3I09A 5E7IA 1BW9B 4JS0A 4IJ5A 4ZGBA 3B1WA 5C8DA 1J1UA 3U7RA 3BSSA 3FPSA 3VR6D 1Z29A 1TYAE 2FEXA 5JDIC 1UOOA 1MC4A 3CLVA 1BAPA 3FLAA 5AT1A 3UK2A 2FFRA 1KFBB 1KPHA 4OGKA 3LSTA 5IBRA 3E3NA 4GHWA 4B6SA 5LP1A 3SVTA 3M2TA 2ZWIA 3GLHE 2KHZA 3LP8A 3LT5A 4AJOA 4HEJA 1D8TA 3NCTA 1YB2A 2OT3B 4RSMA 4M6WB 1RKVA 1RJDA 2OQIA 2IP2A 2GUWA 2B25A 2PQ0A 1X94A 3QU4A 1EBFA 4FR5A 4N7BA 3UHPA 3EZYA 1GPKA 3KHUA 1KP3A 2DOKA 1NUUA 4L1KA 4O4LB 1U94A 3NHBA 1YVUA 4KGVA 5DVZA 3RUDA 421PA 2FUCA 1KZ6A 4DV6B 3BD7A 1T1EA 3FE2A 3JTMA 2IOFK 1EJ2A 2GPAA 3FIJA 1WW3A 1DWUA 4YV1A 4D02A 1V47A 1RYDA 1BMQA 5HJ2A 4K6MA 2G83A 2CXHA 5LLTA 1MF7A 3BHJA 4CQLA 2REBA 3R8FA 2M1ZA 4DIDA 2OM6A 3AETA 1S2MA 3IAUA 1MX9A 3ETCA 3FPFA 3IP8A 1UMBA 5E6SB 3OZRA 3PA8A 3VHLB 4A0FA 4JD5A 2OA0A 4C4ZA 1CS4C 2FR0A 4YONB 1ENZA 4DLAA 4Q47A 4E3ZA 1UBCA 5C7IO 1PJLA 1ZJ4A 3AFHA 4DWOA 4JJKA 1H85A 5KOJA 2FK7A 2BI8A 1DPGA 2HR1A 2UYQA 5EP4A 1F1JA 4P3KA 4Z1MA 1P2TA 3SXPA 4C14A 1SA0A 3AI3A 5ELXA 2X2OA 1R6AA 4U02A 1WULS 4BCDA 2QBYA 3EOZA 2GN0A 3G9XA 1WAMA 2XR1A 3X44A 2H8GA 4ZV7A 1Z15A 3NDIA 3PF9A 4Q3KA 2ZR0A 2WWWA 1YTLA 1PK9A 1EX6A 3FI0A 2Q0SA 4RA6B 3ELBA 2EKLA 2IYUA 3TQRA 4N0MA 1YDHA 4D8VA 2JDID 5H3HA 3ZCTA 2P2SA 4G8JA 1G2QA 4HQ0A 3V8PA 1TU3A 1W0KA 1BS1A 1T2EA 1XLTA 2QLJA 4QHYA 2HDNB 4M9UA 5ICFA 3RREA 13PKA 2ZBRA 3GFPA 4ENUA 5ALGA 5KNLA 4NOJA 1LTHR 2Y9MB 1T0IA 3SVZA 1JZTA 1SXPA 4AO8A 3KSBC 1PT8A 3G1UA 3OZUA 3J81A 2FI1A 4LSGA 1KZ4A 3AZPA 5CCXA 3GAMA 4RDXA 4FI3F 1DV2A 4UUNA 5DWQA 3C3BA 3IAFA 4OD0A 3R3SA 2FUEA 4AG3A 1IXYA 1JJIA 4OUKX 2C7GA 1NE2A 1G55A 3LOUA 5BN1A 5JS1A 1E2PA 2A35A 2I6GA 3VPXA 4ER3A 3CVYA 3HY3A 1OFGA 3QYAA 1XMJA 2E87A 2VWHA 3Q7EA 4DPMA 4DJEC 3KQLA 3FMOB 1OLXA 1YOBA 1J0EA 2ODTX 5FLYA 3BG5A 2FPPB 1BJKA 2ZYRA 3LH5A 4MRMA 3ZCSA 2CVPA 1R27A 3SY8A 5JPIA 1T2NA 3EXEA 2XWSA 2YWBA 3DULA 2GBGA 2OOSA 5AXCA 3SSOA 2XGJA 3DE1X 3JQAB 1QUFA 1XLWA 3AW9A 2QTMA 3DLCA 3FYTA 1A9QA 1XWIA 3HNRA 4TVKA 1B3BA 2W2KB 1RXYA 3H5NA 1AUVA 2L42A 2O8FB 1N2ZA 2PR7A 1WD7A 2AW3A