2NZUG

Structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
275
structure length
275
Chain Sequence
KKTTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite control protein
publication title Structural Mechanism for the Fine-tuning of CcpA Function by The Small Molecule Effectors Glucose 6-Phosphate and Fructose 1,6-Bisphosphate.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transcription
total genus 99
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2006-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nzuG01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nzuG02
1KGSA 4B09A 3KYJB 5EWJA 1YIOA 1GUBA 1U2PA 5DCLA 5EWMA 2BGGA 3KJXA 3OMXA 3HJFA 3HO1A 3HM9A 2VK2A 2FSPA 2ID7A 3F7NA 1Z17A 4MR7A 3QLTA 3O1IC 3JY6A 4G97A 1RXIA 1NATA 3FFWA 1LBIA 2DRIA 2M1ZA 4RU1A 3A0RB 1LJUA 1DZ3A 4WT7A 4LZLA 4NV3A 2FN8A 4F3TA 2HQBA 1M5TA 4RXTA 5E3JA 3Q41A 2MYUA 1UDRA 4MQFB 4EUKA 4PE5B 1W25A 2PMCA 4IMJB 2R48A 1DBPA 2QVGA 4PEVA 5D2CA 3JTEA 1BDHA 5IUKC 1F4VA 3MYYA 4PICA 1A0OA 3NNSA 2RGYA 4G0MA 3SAJA 4YV7A 4KFCA 4WXEA 3H5OA 3F73A 5KC8A 4NQRA 3TX6A 2LP4Y 4XARA 4XASA 4XAQA 1JFSA 4ZJPA 1D5WA 2PUGA 5TE9A 2CD7A 1EFAA 4RKQA 3OLXA 1RNLA 4KZKA 3KSMA 3A3KA 4GPAA 4MYRA 2HPHA 1QQBA 3DLBA 3JPWA 4ZYLA 3H5VA 3ILYA 3KHTA 3OQMA 3A0UA 1BDIA 3OO1A 2KYRA 2A9QA 3DBIA 3LUCA 5KQMA 1MAVA 3N75A 5IEJA 4Z4EA 1MB3A 1YVUA 3A10A 3Q9SA 4YO7A 3FDFA 3LUFA 2LIVA 5HM6A 1EWKA 2VUHB 3IPCA 4WUTA 3T38A 1IIBA 4KVFA 4HNSA 2MYNA 1Z18A 3H1EA 3URMA 4WWHA 4XLTA 2CWDA 1ZN2A 1LJLA 3QX8A 3I42A 2JB9A 2FMHA 3BRSA 1DBQA 5TPWB 2HJ9A 2HQOA 3LUHA 4KREA 1ZY2A 3M9XA 4D74A 4CBVA 1NXVA 3DGEC 1PEAA 2JVIA 3OLVA 3EJWA 4JOQA 5DKFA 4JB2A 1FSPA 1D4ZA 4MRMA 4RXUA 1NXTA 1KMIY 3MMNA 3QELA 4RK1A 4OLAA 3O2SB 2F8SA 3JPYA 3C3KA 3HK2A 1BAPA 1QQAA 1DC7A 2GKGA 1SRRA 2E4YA 3H5WA 3CZ5A 3OLWA 4F12A 4D6XA 1Z2DA 5EWLA 2WMYA 4Z9BA 3EODA 3JS5A 5HSGA 4TN5A 5IULC 1QO0D 1VPWA 3H6HA 3K9CA 3H1GA 3HV2A 3N0RA 2TMYA 2P4UA 3NNDA 2AYXA 1GUDA 4EVSA 4KK3A 4JP1A 5C5CA 5I4CA 3NNNA 1RPJA 4RK5A 3LUDA 3BILA 4L4UA 2P9HA 4MR8B 3HZHA 1NXOA 4W5NA 4E7OA 3M9WA 3QEMA 3RVNA 5F64A 5BRAA 5KC9A 1USKA 4HNQA 5T7BA 2QXYA 3H5IA 1JFVA 4G0YA 4IGAA 1TMYA 1C4WA 5FBHA 1ABFA 4YRZA 3E61A 1E2BA 4O1HA 1CYEA 1QMPA 2JVKA 3QLVC 4IILA 2NUBA 1FFWA 2NZVG 3EQ2A 5CNIA 3G85A 4RK7A 4MS3A 2QR3A 4N47A 2MYPA 5JS1A 3Q7TA 4G0QA 4W5TA 4O5AA 4DN6A 4RSMA 2NT4A 2WY2D 4Q6WA 2O20A 3IP9A 3ROTA 1ZESA 4EVQA 5TQ0A 1DP4A 4HNRA 1LBHA 4MR9A 1EWVA 4S05A 4QPJC 2RDMA 3CTPA 1VKRA 3O74A 5FWXB 3OMWA 4TLLB 2N9UA 5HQJA 3H6GA 5IEBA 5IUJC 1ZGZA 4XXHA 3RVOA 3GWGA 1ZHHA 1T34A 5IX8A 3VNBA 1DBWA 3NBMA 3MA0A 3H75A 3JVIA 4YR7A 1QP0A 1QP4A 5GOTA 3GBPA 2L2QA 3RQIA 4G0XA 2PL9A 1OXKB 2FMKA 1TLFA 2FTKE 1QNLA 3IPAA 1NXSA 2FMFA 5DTEA 2FQWA 3C3MA 1H9CA 4ZMSA 1EHCA 5IC5A 3I09A 1OXBB 4NICA 4Z4CA 4UHJA 2QZJA 1ISSA 2WB4A 5FWYB 5T3YA 1NXPA 4OATA 4Z4HA 4YP9A 1ZITA 4JAVC 4W5QA 4EYOA 3QEKA 3OQNA 2WJWA 3TO5A 3O2JA 4RKRA 3HS3A 4KRFA 2RJNA 2M98A 4XFKA 3N53A 3RVSA 2IKSA 1XHEA 4QYMA 1U8TA 2FW0A 4EGSA 1YK1A 3HSYA 5TPZA 4FE7A 4RV5A 3RVJA 5BRJA 4Z4FA 4ML3A 4ETIA 1YK0A 4FE4A 4OLBA 1JFTA 1M5UA 2ZWMA 3O1HB 3TB6A 1L5YA 3KKEA 3BRQA 4MS4B 4Q6BA 5IUNC 3Q7RA 4MQFA 4G0PA 3LUAA 1F51E 3EDCA 4MPTA 3M6MD 3EAFA 1D2AA 5JNRA 1SXGA 2FKAA 2YHAA 1LK0A 3FFTA 3RVRA 1M2EA 3TD9A 1YS6A 1FFSA 3N0XA 3GA5A 1RZRA 4MLDA 2A9OA 2RJOA 3LMKA 2FQYA 3N0WA 1DCFA 4QYWA 1DCMA 1JDNA 1JH9A 4YS6A 3I5AA 2CHFA 2IPNA 4UHKA 1Z15A 2FQXA 4F11A 4MGEA 1SXHA 3S99A 1NTRA 3IP5A 4LE2A 1EAYA 4QICA 4MQEB 4YWHA 1DG9A 5KWSA 2JBAB 2FEWB 1PNRA 3F6CA 5TQ2B 1PNTA 3LFTA 3C6QA 5TQJA 2LUOA 3RVLA 5JNUA 3SY8A 1YMVA 2PUDA 5KQLA 2PKXA 3D02A 3HVRA 4N41A 4MS1A 3RVKA 1K68A 2FVYA 4L85A 3LOPA 3O2QB 3R0JA 3Q15C 4Z4IA 1NXXA 1HEYA 2V0NA 3OLYA 1FQWA 1ZGGA 3UUGA 3W9SA 2WWVD 1KRWA 3CLKA 2QV0A 2H0AA 3CG0A 3RVQA 5TPWA 4KQ9A 1PUXA 4P1ZA 3DLHA 5ED4A 3O21A 1AB6A 4ZPJA 4W5RA 1JYEA 4E7PA 3QLUA 2FMIA 4O1IA 4EY3A 4P98A 3SG0A 1A04A 3GV0A 2PUCA 1B00A 3CG4A 1A2OA 2I6FA 2MSWA 1NXWA 4F8JA 1C0EA 1P2FA 2FLWA 3G1WA 2CHEA 2VYCA 3O1JC 2L18A 4MLCA 5EWJB 5EWMB 5DGCA 3CHYA 3HDVA 2E4ZA 2E4UA 3MIZA 1ZVVA 4RDCA 3GYBA 3HUUA 1PHRA 3NHMA 4MR7B 4DQDA 4H3HB 1Z26A 4RK0A 3I45A 2WJAA 2YHBA 3L49A 3OM0A 5BQ3A 2L19A 5JNWA 1ABEA 2E4WA 5PNTA 1SD5A 2W42A 4OG2A 4GNRA 1WETA 4JASB 4MR8A 2IPMA 1YS7A 4F06A 2IOYA 4LDAA 1VRVA 2LPMA 3KTOA 1E6LA 2E4XA 1ZH4A 5DLEA 2NT3A 1QKKA 3GRCA 2VUIB 1VLZA 2OENG 3P9YA 3MQ4A 3HCWA 1JL3A 2L17A 2R47A 3CKMA 3FFXA 4IRXA 2FLKA 4ETNA 2AYZA 4KMRA 2IDMA 5B3JA 1FFGA 4RK6A 3KYIB 3SQNA 2F8TA 3UKJA 2PE5A 3KLNA 1U2QA 3D8UA 5JNSA 4JA2A 1KRXA 2QVCA 4JB0A 3LUGA 1JX6A 4PZ0A 3KCNA 1NY5A 5FWXA 4WXMA 4KQCA 2A9RA 3DGFC 5C5EA 4KPYA 1L5ZA 1QP7A 1PEYA 5TPZD 3ILHA 5ABPA 1ZH2A 1CEYA 1XHFA 5KQPA 2FN9A 3FGZA 3T95A 4PYRA 3VNAA 3LTEA 2E4VA 1I3CA 2PJUA 7ABPA 3QLVA 3BREA 4G86A 4TMYA 3CRNA 2A9PA 1D1QA 1JHZA 2HSGA 3IDOA 3JVDA 3RH0A 3IP7A 5JNVA 2PL1A 3FMVA 4Y9TA 4Z99A 5CNMA 1SXIA 3MF4A 3HUTA 1URPA 4EYKA 6CHYA 2IPLA 1Z13A 3CS3A 4OBBA 1Z12A 4HYEA 4IF4A 3RVMA 3LKVA 4Z0NA 4EYQA 4MRMB 8ABPA 1RZRD 4OTZA 1TJYA 2MYTA 1P6QA 3QELB 5FWYA 4Z4GA 2IPAB 2Q5CA 1MB0A 2GWRA 4RXMA 1USGA 3QLUC 4YLEA 2LBPA 2GX6A 4KNYA 2B1JA 2XDYA 3KLOA 2R25B 4MS1B 1P6UA 5HKOA 5EWLB 1E6MA 1TVMA 3T8YA 4RY9A 2QU7A 3K4HA 1DRKA 1APBA 2MSKA 4LRQA 3QX9A 1YTUA 3SM9A 4H60A 1USIA 3GL9A 3QK7A 3MM4A 1GLGA 4ETMA 1JF8A 4ZMRA 1TM2A 1BDJA 1MIHA 4RK4A 4RZSA 3OQOA 4MS4A 4YCSA 4EYGA 2GI4A 3F6PA 3N8IA 3QEMB 2ID9A 4KK4A 2NZUG 1XWWA 1YMUA 2PAFA 3CNBA 3CZCA 3LUKA 3HXMA 1MVOA 3EULA 3DZDA 4D6YA 1DJMA 1S8NA 1ISRA 4RY8A 4LDZA 3EGCA 3RVPA 1DRJA 4TLMB 4N76A 4NCAA 1E6KA 4Z9AA 2QW1A 2WRZA 2FEPA 4LX8A 2IYNA 2JK1A 5KI6A 3T6KA 5BR1A 1GCAA 4MS3B 1CHNA 3B2NA 1QPZA 1Z2EA 3GT7A 4N03A 1ZDMA 2FEKA 3HEBA 3N6VA 1K66A 3KS9A 4IMIB 2JRLA 5CNKA 2PUAA 1JDPA 5JS2A 4MQEA 6ABPA 2J48A 2JVJA 4W5OA 4S04A 2JBAA 1QO0A 4YGXB 3ROFA 5TQ0B 4MR9B 5FBKA 1DC8A 1JBEA 5TQ2A 4FB4A 5B3JC 1ZAYA 1RXEA 1U0SY 2GBPA 3LKBA 4RS3A 3H1FA 1Z25A 2HQRA 3BBLA 4G0ZA 5IBQA 3EQZA 2PUFA 2PUBA 1P8AA 1R8JA 2PLNA 3OM1A 3Q7SA 1JWLA 2MSLA 2OQRA 3O75A 5JNTA 3L6UA 1W9HA 1Y1LA 2B4AA 3OLZA 1GCGA 4RWEA 4DADA 3SNKA 3KG2A 4N0PA 4N0QA 1U04A 1Z16A 3UK0A 1JLKA 2PUEA 2QSJA 2H3HA 2ZAYA 3H5TA 4MAAA 3TMYA 5GQSA 9ABPA 1BVHA 3C97A 3CFYA 5CHYA 4Q7EA 4G0OA 1EWTA 5CNJA 4M88A 3CU5A 4KV7A 1BA2A 3HDGA 1AB5A 1JYFA 2FXIA 3IP6A 4H3KB 4LE0A 3H5LA 4WZZA 5KQGA 4RY0A 1M2FA 4EVRA 3NHZA 1J56A 3GBVA 4LE1A 4NCBA 1D1PA 3OO0A 3E3MA 2R4QA 2JCGA 3C3WA 3LUJA 1DCKA 2X7XA
chains in the Genus database with same CATH superfamily
1CYDA 3N7UA 2X2OA 3NXSA 4J7AA 3FSEA 2OD7A 2J3HA 4B31A 1E3JA 4YX9A 1R88A 1UAYA 3P2EA 4FHDA 3CONA 4JGIA 4E13A 1U7HA 4F1JA 1MZPA 3OJWA 5LD2C 2WYOA 4FI3F 4RGQA 4B3RB 4EP1A 4WLVA 1JE1A 1V1JA 2F1IA 3GUHA 3IBSA 4E4YA 4F9FA 5BV1A 3EVZA 4YMTA 2ZK7A 2BMVA 4PX9A 1XCJA 1KMNA 2QLLA 2G4LA 4WZBB 1MNAA 1KKMA 1XBTA 3STYA 3AVUA 4DM3A 2I76A 2XMCA 3I05A 3ZXXA 1CJMA 3ESZA 2FUKA 3OKAA 4XQ0A 3HA7A 3QVTA 3R3YA 1GR1A 3GJ4A 5SZKB 2Q7OE 4JR2A 1GPYA 1D5WA 1NQUA 1V6SA 2CHUA 2QTMA 3KBOA 4EGCB 3G79A 4MYRA 2GJKA 2PIDA 4YQZA 2O1EA 4G24A 2EFGA 4RA6B 2FFAA 1UT8A 3OJXA 4BFYA 3RUAA 2RHOA 3MTIA 4MULA 4P4UA 5ADWA 1FW6A 5F7JA 4E30A 3WMEA 3T3NA 1JLHA 3SE0A 2A9QA 2DM6A 3T5TA 3MJCA 3VKFA 4D42A 3D4IA 4Q02A 2O8CA 3FBGA 1GHTA 1F60A 2GBGA 4Y2TA 1Q0TA 2HJRA 1ZOIA 3KOZA 3WWPA 1U31A 2Q8NA 3JWEA 1C14A 3HGTA 4HL6A 1Z3CA 4F7WA 2XMZA 2F9LA 3CO5A 1A4UA 1TM7E 3L77A 1YR3A 2D5BA 4JKIA 4D3FA 4F3RA 1G4AE 4JJ4A 3VC1A 5MFZA 4XQGA 1RMQA 1D2HA 4QLBA 3AOGA 1C7EA 4RLQA 3GLRA 5GGXA 3TTXA 1AQNA 3STVA 5JNLA 3PQCA 2G70A 1O57A 2E18A 5JCOA 1TT5B 3OHSX 1ZSYA 2QTCA 3HBLA 5ULLA 2HWYA 3HDTA 3RAEC 3VNUA 1VMIA 3PXGA 4NJEA 4MTLA 4FFWA 2GN9A 2OBLA 5TB5A 2Q46A 5DK4A 3M6VA 2P6MA 4E11A 4DV1B 1PK7A 3VHXA 3ZXUB 4Q1AA 1T8UA 2EXXA 3KVVA 3IUYA 1II0A 4RH1A 3P9KA 4H6WA 1QVWA 1RCTE 3NQ41 1QTRA 1KR2A 1K2VN 4OLAA 2L42A 1JDVA 2ZYUX 1KVQA 4Q4HA 2RH9B 4EWLA 1SRRA 3GRPA 16PKA 1L5SA 2DFTA 4M1KA 5FPHA 5U4XA 4F5WA 3D7RA 1XQWA 4NLLA 2O3UA 1KZYC 4RADA 5EWLA 3EODA 2AQIA 1VPWA 2ZTLA 4X41A 1XDBA 1XNHA 3OQIA 4IW3B 3TLBA 4BGIA 1JNYA 3GMIA 2WIDA 3FNEA 4MJXA 1JG2A 3AUJB 3NH6A 2GGSA 3I9FA 3NT4A 1Y34E 4DQXA 2IYPA 4XQEA 4EVSA 1NURA 4FMCB 3TOXA 2HL6A 1QDUA 3ZH2A 4GW3A 5G3YA 1I4TD 1SURA 4BLUA 5EHQA 1YFJA 4LFCB 1PZGA 3DBRB 3MUOA 4K28A 4K6CA 4OB6A 1SOUA 5YASA 3UKDA 1EUCB 1JFVA 1JILA 2NAPA 2SCUB 1C4WA 4IGAA 4ZQIA 4O02B 5KYXB 2LV8A 3KQLA 3E61A 4OBXA 1E2BA 4E94A 4Q9HA 1WRBA 2JVKA 2R6GA 1K7SN 3ZR4B 2X23A 5BVGB 4Q1DA 5INTA 1JHVA 5JIBA 1Y1SA 1VSUA 1Y7HA 5IM4A 1E2MA 2A86A 4MS3A 1P45A 2J9GA 2JARA 2Q1YA 2QR3A 2ORVA 4WFKA 4D8XA 2KM1A 2ZWVA 2YN4A 3QKSA 5CX4A 5JZSA 1U5BA 4I3GA 4UHFA 3RBAA 4BX3A 2QY9A 1V1RA 1OLUA 4KR3A 4ZCLA 3EXHA 1NXQA 5I7RA 4ZAWA 3ILVA 3LL7A 5TQ0A 1U0GA 3F1KA 4R71A 5HRAA 2BEWA 1W2HA 2QVLA 3BERA 5IMBA 1GJRA 2VDJA 4IGKA 3ZVMA 1RQNA 4NC9A 3GIWA 4X1KA 3CY6A 4Q47A 2QDXA 3EEIA 4D80A 4YRBA 4QD3A 2C2ZA 1XROA 4LBWA 3U44A 2O8DA 4XYMA 2OSBA 2FW6A 3D54D 5CH5A 3UMGA 3NBMA 4LVNA 2V9PA 3TVDA 2CV0A 1FU4A 3QIAA 4C4PA 4OU4A 4LMPA 4LXGA 2CXHA 4LWZA 4N3BA 4Q48A 4Q9KA 4S1TA 1IAVA 3DNPA 2QRHA 4KUHA 1QRUA 2WPNA 2RHHA 1AG9A 4L3WA 4ERXA 3EA5A 4AFNA 3DE4X 3KZNA 2FN7A 4OHZA 4RHXA 3SZMA 2JFNA 5A0VA 4JVOA 3BIWA 4HQRA 1IUOA 1WPGA 2RAVA 1YE3A 3HBFA 4J75A 4TV9B 2NU8B 1JI3A 1DINA 1J8FA 1QIFA 1TZBA 3KSDO 5CK5A 4IP0A 4EUNA 5DCYA 3GNSA 3BG5A 2HNAA 4H18A 3ODPA 3WYDA 5JS7A 2H6EA 3QBVA 2X8AA 4JAVC 1MQ9A 4BLVA 4NFLA 4B6OA 4MITA 1QV9A 3TI7A 1K0FA 3O92A 4R2KA 2BGUA 1C4KA 4RORA 4YRSA 2FNAA 2BL4A 1M1YB 2Y0BA 3IULA 2M98A 3V80A 2EZ9A 2E4AA 3QEOA 4FYWA 4QEZA 3WK8A 1Y8ZA 4DLVA 2YX1A 4HX5A 1YK1A 3QRWA 3VJKA 3BGVA 3PT5A 2R751 2I7DA 4UNPA 3D7NA 4Y67A 5DN9A 4FE4A 1GKLA 4FOPA 4P7GA 1GTSA 1M5UA 3GAFA 3QVGA 3R7LA 4XDYA 2OHJA 2B5OA 1BXZA 1G5RA 1ONBA 1WCIB 2PO5A 4PVCA 5TS3A 4IOLA 4ZCSA 3BTSA 2J7KA 3HDYA 2AFHB 1H6BA 1OUMA 1YFZA 2W6JA 5AM4A 1T35A 1GNLA 1GRCA 1IZYA 4RPHA 4UZEA 3HSKA 3Q11A 5EMKA 4EEXA 2ADMA 2B4QA 1M1ZA 3WL3A 4XTCS 4WJLA 3ADBA 1DWPA 5C51B 3DO5A 5B1SA 5CDSA 1Z2AA 3OTQA 3HUEA 3TEMA 1T0IA 1H4QA 3K0CC 1AD2A 4C14A 3QI2A 4P92A 1U3GA 3QMPA 2W2TA 4XCQA 3DTTA 1U1IA 1N6LA 3DAGA 2IW1A 2AOVA 1ULUA 2P9EA 1P7PA 3I5AA 3R5FA 4FHFA 3GJ7A 4B32A 1AHNA 1QG0A 3ON5A 2ZAMA 4QICA 1LPSA 2B25A 1GRQA 1DG9A 3S2UA 3EIXA 2VPXA 2FEWB 4EQ6B 5H9VA 1U8UA 2N3ZA 5EJAA 3PDJA 1Z34A 2Q4TA 2P1ZA 2ATEA 5DTRA 1UBUS 4X24A 5TDHA 4F2PA 5JNUA 4IJVA 4U5XA 2ZUTA 3Q85A 3BCRA 1AZLA 3N07A 1HF3A 1P1RA 4ZAGA 5ESRA 3R24A 4MS1A 4RM2A 3DDWA 4YFVA 4YRFA 5K1ZA 4UM8B 2PY6A 3SK0A 3CVWA 3JWJA 4W9RA 3MCTA 3NCTA 1B7GO 1NA5A 1WO8A 2DHCA 4WECA 2W2QA 1U3CA 2HNKA 2FR8A 2JJQA 5LIPA 2XZPA 1I13A 3R0XA 3WRXC 4JK3A 2F67A 1A5ZA 3VI3B 2BKAA 5F12A 4YUXA 3NEAA 3H7IA 3DMYA 2GXSA 4OM8A 1RAAA 1ZP6A 4PQYA 1RXVA 1WOYA 1WCXA 4KO4S 3GMDA 4HNUA 5FRDA 4YAEA 5LA6F 5HKKD 4RKEA 4CLEA 2YMPA 3KWFA 1MPXA 2DFLA 1HNWB 2EZ8A 1KFJB 2PWPA 2XBMA 4DA7A 1UC9A 4M7PA 3BCSA 4YJHB 1MN6A 1XB2A 1RC1A 5KTRA 4KO8A 4BNNA 3HVUA 4OD0A 1B00A 1X9HA 2J9ZB 3NHLA 4JBHA 4C2UA 1TAHA 2XKJE 5FTLA 4FU0A 4MW6A 1K3TA 3I39X 2QI9F 5M7EA 3PVSA 1L5WA 2DHDA 4AIRA 3ONWA 2EOAA 2FDRA 2ZE8A 1W9MA 3AIOA 4OQZA 5JXIA 3QJ5A 4L5JA 3QFFA 3ESBA 2ISCA 5IKOA 5A9TA 4EPXA 4F9GA 1MXFA 5DHUA 2G9ZA 3PHGA 4HWOA 3S2YA 1YHYA 2XB6A 4FT4A 4ZT5A 3WG9A 4Y1FA 5CHEA 4WFJA 3AYXB 4TVOA 3RFXA 3VNRA 5JJ5A 2J5XA 5BQ3A 3Q88A 5FA5A 3WY9A 4AROA 1KTVA 4EHJA 4WBXC 3AF6A 2GTHA 3IHTA 4DIDA 2DR2A 4H0FA 1WETA 4PTZA 2VT6A 3VH2A 1YU9A 1N7HA 2AG1A 1KO1A 1BQ4A 3QPCA 4MR8A 4RPJA 4X71A 3AVWA 1OF1A 4YI5A 2PUJA 2QYOA 3WLEA 4PVDA 2OCYC 2WDPA 3I4FA 3EFOB 2FWJA 4XRRA 4K8RB 4EFNA 1FVFA 3D1VA 3MNFA 2NT3A 1QKKA 4N12A 1GYPA 3LWNA 4FONA 4M37A 4ZHQF 5K8VA 1CUDA 3PHIA 2I29A 3L5KA 1LPMA 1PR0A 3ZHYA 4AG5A 2EAUA 3H4VA 3WK6A 3TZKA 4LZJA 1RYNA 1E5VA 2R6JA 4L02A 4M76B 5B64A 1UZUA 4U8HA 4KMRA 2O0MA 2PANA 3C7KA 3LT5A 4TZTA 3SLKA 4RDIA 2A33A 4Y0VA 1KEVA 2FOLA 2ZQYA 1TLTA 2O8EA 5DGXA 4BIMA 1MXHA 2WI8A 3ND6A 4F86A 1SXQA 2CNWA 5CFMA 2QGZA 3DEYX 4PZ0A 2I3AA 3ORQA 5FXMA 4KQCA 1BKYA 1U3FA 3GVPA 3WYCA 3D31A 3TZEA 3ILHA 2PZMA 4PHFA 4OXKA 2XKAA 3T7EA 3I04A 3TBHA 3HVJA 3VNAA 2FPGB 4WH0A 4B4WA 3JQ8B 7ABPA 1NQAO 4U00A 3JZDA 4RIGA 3ML1A 3SQWA 1HYBA 1QUFA 2XF2A 4FSHA 1S4QA 3QNUA 4KUEA 2B37A 3LNTA 4OI0A 5JNVA 3TGLA 2GBLC 1GRVA 1DTEA 1O4WA 4FKZA 4WY8A 2WYIA 3SBEA 2CJWB 4W1QA 6CHYA 2V9ZA 5IDYA 4U7TB 4QYTA 4OBBA 1H4TA 3WR5A 4CM9A 1J70A 2WJ3A 5ADUS 2F8LA 3WICA 3V8RA 2VAMA 4QDKA 5AI6A 1FFAA 3V00A 1DL5A 1JPVA 2BFDB 3PFCA 2MR5A 3ADPA 5C81A 4CJXA 2R1UA 1WEHA 3I6BA 2BFNA 2IHTA 4G5FA 5SZJA 5KREA 4JXXA 1L6RA 2Z98A 2I2DA 1DCTA 4BJ5A 1SXJC 3HBMA 3U6KA 4EHLA 4FNMA 2WT9A 2WK1A 2RHDA 3ZU2A 5T67A 4HUQB 2AFIE 1MP0A 2J0UB 2XOKD 3FWKA 3GA0A 1USIA 3D7SA 4DJJA 1I3LA 1U7PA 3CUKA 1DAMA 1FMCA 1GD1O 2EF0A 4UUNA 5EXEA 3K53A 3AJAA 1IRIA 4HP8A 2QUBA 1ZD1A 3G2LA 3SJAA 1LY1A 5LYJB 2C1XA 1JXQA 3LWBA 5E6UB 4MWCA 1ATIA 1WW3A 4UEOA 4E5NA 4GE3A 3QEMB 2GF0A 3H1BA 3ZWWA 1I1QB 2ZJBA 4DB4A 3DR5A 3LQFA 3TLAA 4CMJA 3LLCA 1F8YA 3ESCA 2BFBB 5AK4A 4OI4A 3PKIA 3V4PB 1VMKA 2FGJA 4DREA 4ZCRA 4FC6A 4XI9A 1ISRA 4R3WA 5DCWA 1RM4A 1NFFA 5DRTA 4N76A 3IT1A 4WKNA 4D9EA 3T7IA 4LX8A 3ZJ5A 4E09A 2IYNA 2YZMA 3HDQA 5CT4A 3VVMA 2REBA 1P9LA 3WE7A 1DTWA 5BR8B 3B2NA 1XZMA 3L7LA 3PQ8A 2QA5A 4OI1A 2WSBA 3C3YA 3FVQA 3LGSA 1IMOA 2BFPA 3PXDA 1TM5E 4OKNA 4Y2QA 2FRVA 4AJKA 5M2QA 1YDWA 1CUZA 2ONKA 3PR1A 4LBVA 3TS1A 3PGKA 2FFRA 1JIVA 1RWWA 3E0XA 4FIDA 4JI1B 4DJEC 1KH1A 3AY3A 3UWPA 4XRGA 3S2ZA 2WUWE 4ZCIA 2HRCA 1N1EA 5FBKA 1O6GA 5TQ2A 4KI7A 1M34B 1ZJYA 4WEOA 4ND8B 1ZR4A 1BU8A 3IQDB 3JYLA 2DP4E 1WNFA 4LC9A 1A7AA 1G5FA 1VYUA 4K40A 4JU9A 2YVAA 3EVNA 5AJHA 2XVXA 4LXYA 4WK0B 1U3TA 2H07A 2WF9A 1OCEA 2O50A 1POXA 2XTNA 2I22A 3FMGA 3Q4GA 4HXGA 4NJMA 3Q7SA 3TN7A 3ZJ4A 4J7XA 3KKOA 3FUUA 3TD6A 3DSRA 1PS9A 2X2EA 3Q3VA 1PJ4A 3ZY2A 2VSNA 3WO1A 4XWWA 2OHGA 1UF9A 4DSZA 1PDWA 2C9BA 1I10A 5E2IA 1PX2A 2YTZA 4DADA 1XVVA 3LH5A 1QRAA 5LA6B 3AINA 4PLPA 4M98A 5HIIA 1XRJA 1J09A 4FCTA 3H5TA 2ZTUA 5HQTA 1JFLA 4CF7A 2LKCA 3CIOA 4PXSA 5JROA 3MMPA 2Y0PA 3CSDA 5T3UA 1A69A 1SD2A 4I99A 1SA0B 5HZKA 1CUFA 3HKEA 4U2CA 3JV7A 2AJ8A 2FSSA 3OJEA 4WZZA 2I9PA 3NGMA 1LLUA 4GYKA 3NOXA 5DI3B 3OUTA 4UDYX 3BAFA 3WNCA 1FXUA 4Y2JA 2ZRMA 2QTHA 5F2OA 4B9EA 3W3AD 4IJMA 1ESZA 1J06A 2X4LA 3WI7A 1Q6ZA 4BNJA 4HZIA 3V8QA 2JFBA 2V0CA 3F5FA 1EJ6A 1T91A 1YB1A 1WP4A 1NJ2A 1Q0ZA 2AI1A 3KOMA 4IZOA 3FKSA 3JD0A 3ZE6A 4C0LA 2ZSBA 1WM1A 4NV3A 3M89A 1W47A 3C4JA 5KSZA 1ZUNB 4QUIA 1TYEB 4FDMA 2OMKA 1Q3HA 3CJTA 2CE7A 5JQGB 2C99A 2MINA 2VCEA 3CYFA 3THRA 4A91A 5MGBA 1XG5A 4PLWA 2UXBB 3TUIC 3C4QA 4EW6A 1VG8A 1J24A 3MJFA 3NNSA 4HTFA 3RGWS 2XKKA 4ZQEA 5CLGA 1PF7E 3F90A 4XUEA 1MO6A 2C61A 2ZB8A 3NP7A 4YGYA 4EY7A 3ELBA 3TRIA 1X19A 3JARB 4JB8A 5A6SB 4LJLA 3GLFE 3DV0B 3VR5A 1Q91A 1HTWA 2ZREA 3DTVB 4IJWA 2PL3A 2W4QA 1KFKB 5E9AA 4EITA 4IWYA 2J7PD 3CX4A 3HVKA 1OJ7A 3BH6A 4DIFA 1HE5A 5C8VA 2ZTVA 1QF6A 2IVFA 4KDFA 4X91A 3BX1A 1FQJA 3CRRA 1CDZA 3D3WB 3LUCA 4I4CA 3DP7A 2GEJA 4AP9A 3RB8A 1HEIA 1KIMA 4A92A 5LMZA 1SCUA 1MB3A 1LDNA 2MMGA 4DE5A 4J3JA 4F60A 1K86A 1QYRA 3PCXA 3CZPA 2VZ8A 1U9JA 1USWA 2JCBA 2Y71A 1QYIA 3E1SA 3GLTA 4MW0A 4WA7A 4YAJA 5T5QA 2CFOA 1EVYA 1FYFA 4PQFA 5EMMA 2PR7A 1YDEA 2X2PA 3B38A 3V2HA 3TZCA 1CTQA 5CEFA 2WAMA 4L76A 4GPBA 2C82A 2JAOA 2C4KA 3LBAA 2JB9A 4FVTA 2YV1A 3QVOA 4OL9A 3RLIA 5HYVA 2GZHA 4MV6A 3I4CA 4FOSA 4IUCS 3PLAE 1GG9A 2GTIA 2MT9A 1ZH8A 4PIVA 4ALKA 4ILEA 4AWBA 4W7IA 1QHXA 2WUEA 1UBSB 1GZUA 5DTIA 3E53A 3WOHA 5EHXA 1SULA 3HN7A 2PT9A 3G9QA 4BZQA 2RGBA 2QDKA 3P26A 5AVOA 1NUPA 3HBNA 2QF7A 4JB3A 4L7VA 3SJZA 5JC1A 2I8AA 1MX3A 2F17A 3HKDA 4H3VA 4R51A 5AW4A 1FPQA 2ODPA 1TZ2A 4Z3KA 3QOXA 3RM3A 5K6AC 1M2HA 2IODA 2P9TA 4H7IA 5FKJA 2BCJQ 2YINC 3ZZMA 3CKLA 5FPQA 1ZMOA 1N2ZA 1RMYA 2Y05A 2YZGA 3FZYA 5B7NA 6NULA 4I2NA 3G7UA 5KCZA 2CW5A 1XZGA 4ZVSA 3TJZA 2WE8A 4D92A 3CISA 3PHCA 5T64A 4Q21A 4ENWA 4X94A 2VHQA 3ZU3A 5AVXA 4K9DA 3K9BA 1VKJA 3AQ4A 3NNDA 2ICAA 3HB9A 5CR9A 2AYXA 1GUDA 3I0NA 3L8CA 5KBYA 5I7HA 4JP1A 5D5QA 3NORA 2YDYA 3T7DA 3DMRA 2RBEA 3NNNA 4MPDA 3OX2A 1PS8A 4N7RA 3S44A 1KARA 5FYDA 3MAAC 1KAHA 4IXTA 1UAGA 3VYRB 3IR6A 4E22A 2YY5A 4E6PA 1Y6QA 4N5DA 4HNQA 1XRRA 3U4AA 4PQGA 1V4VA 2VIIA 2OEPA 2QROA 4IEIA 3TMKA 2H06A 3EGXA 2YWRA 1RADA 3VKWA 4UFNA 3VUFA 4D46A 2BHTA 1R10A 2H5IA 3ITEA 4WFIA 3ZZUA 4XD7A 2ZCJA 2K7FA 2GPAA 2V4MA 3FPKA 3BTUA 1QOZA 4YRTA 3UICA 3ZWNA 5C5IA 5KJ6A 1X80B 4GMGA 5A1JA 1F38A 2R8YA 1ZXLA 3TQOA 1BN7A 1Q1QA 4HNTA 3KRTA 2DTDA 4ZEXA 3ENWA 3E4CA 4GBGA 1Z56C 3NALA 2C88A 3GZJA 3ETHA 4O25A 5JBIA 1TUEA 2WOOA 4QXOA 4EVQA 2OMEA 1FNNA 1LBQA 5JCPA 3LPNA 4QPJC 4YT8A 3KHSA 3X3HA 4L5YA 3OMWA 5HQJA 5F1KA 1JJBA 4O4JF 1WL8A 2P65A 2P2ZA 3H6GA 4GE0A 1AU9A 5ER6A 3WLPA 3HN6A 1JA9A 4X1YB 4B6GA 4CHGA 3FLBA 1ZJ6A 1F06A 3BEOA 3WGUA 4R1PA 5D1NA 5C2JB 1DBWA 4TOIA 2JRCA 1GL7A 1RBZA 1XLUA 3DL7A 4NIMA 4KE7A 2ARKA 3FSJX 5THXA 4NBLA 4AVYA 1YJQA 5C52B 3TB4A 3C8HA 5LXTF 2RD2A 1DQSA 1S2LA 4W9NA 3U7FB 1MABA 1TLFA 1JRLA 2Z5GA 3A2LA 3FNGA 1NXSA 4WOPA 4A0FA 5IH7A 3I2FA 3G0GA 3RYCA 3AFMA 1Y3DE 3I09A 2FSVC 3ABQB 1W88B 3RSOA 2PMWB 1IOWA 3EEYA 3ZW7A 1UKZA 4QUEA 3TW8B 5C35A 4X61A 5FWYB 1TB4A 3ZJYA 1G16A 5DV9A 3MTGA 3QFHA 4Q3NA 3SIRA 4FQ8A 1AF7A 4PSAA 2P5SA 2XF8A 3TOSA 3UIEA 3MRVA 4EARA 5CXUA 3ZKWB 4C4RA 3VKUA 1QG6A 3G5LA 4RKRA 4WDRA 1YD7A 5DT2A 1C7JA 4BO0A 2G6BA 2HHJA 2J5RA 4IVNA 3F0TA 1XHEA 2CUTA 3UAZA 3MGAA 2EVWX 4M86A 4WKCA 4KMMA 1GILA 1ZCZA 3WB2A 5K3SA 4DGSA 4AZ0B 3FHJA 2ZWMA 1JALA 1JHYA 2NYAA 3AR3A 1FYWA 1GFSA 1W85A 4NMMA 4YC7A 3SFZA 3UT5B 3FZEA 3DV2A 3HXLA 2HA3A 5KDOA 1FQOA 1GPKA 1NOJA 1AXRA 2Q27A 2P41A 1J9GA 4MVWA 3VO1A 5LNK6 2A2ZA 4I8DA 3MINB 3HLTA 3RBXA 3VPCA 4Q7MB 1T2UA 4LWQA 2C7PA 3DZGA 5COBA 4BPBA 3LVQE 5EMLA 3ZNNA 3QTBA 4MPTA 1TW2A 2FKAA 4FMDF 1ZVKA 4JXZA 5BQPA 3BPSA 2YKGA 3DM5A 4OQ4A 5FLYA 2JDIA 3T7KA 4E14A 1Z62A 2FWMX 1KXJA 1TI7A 1YC5A 1QS0B 1P75A 2A57A 2JIBA 3B1WA 3HP4A 3IVAA 4QQRA 1DCFA 3BYZA 1DC4A 1REQA 5G4KA 3ZD7A 1MDFA 1RRGA 4PV7A 1Y48E 4CM6A 4HWSA 2VXOA 1Q0PA 2QTAA 4WGFA 3LW7A 1B8PA 4LYJA 3DE1X 1OWMA 4M46A 1KBZA 2OK8A 4FJ2A 2RIRA 2EWWA 2V7EA 3ZDFA 3GJRA 1J90A 4NZNA 3EN0A 1THTA 2P8JA 1ZYUA 3EQ6A 4DMFA 1L5FA 1MRNA 4D5GA 1N5JA 4WZAE 3KEFA 1UANA 2QTNA 1F0NA 1E5XA 5F23A 4GL4A 2JATA 3VRHA 1CEXA 1D7OA 5AJXA 3VO8A 4E12A 2H4JA 4K9OA 5C18A 3BSWA 4KP7A 3STWA 5HZHA 3TF5A 3HVRA 1PSDA 2D7JA 1EXWA 1T4GA 2V7BA 3F3YA 3LI2A 1AT1A 4I1RA 3UB4A 1G66A 3USZA 2JIDA 3W79A 3MOIA 3CTMA 3Q15C 3U4CA 2GJ8A 1HEYA 3O4FA 3ZI4A 2VDPB 1KOLA 3A4NA 5JAIA 3V9PA 5A03A 1K7XB 1V7PC 1YL5A 2J3JA 4J43A 4JSYA 3ICPA 1TX4B 4LI0A 1VL2A 5LBTA 2P2SA 1CY4A 3GXBA 3FXAA 3PQDA 2UYGA 1W46A 2Z2ZA 3QTLA 4MICA 1ZZGA 2D1YA 3B85A 1W87A 3IODA 3V8VA 3PXEA 5AW0A 3UOGA 2X7JA 4MA0A 3G0DA 4MGZR 1F6DA 3ZQUA 5CM9C 3RSSA 4E7PA 1L7EA 3ZY6A 1ZJ5A 1BEEA 1CRLA 3CQ9A 4QELA 1YOBA 5E9WA 3KETA 2F1RA 5EXSA 1R9JA 1V8ZA 4Y1RB 2MSWA 3QFCA 3DBOB 3DVAA 4OU5A 3II6X 3N2IA 1KI1A 1LFAA 1USVA 2PKEA 5C8DA 4DLNA 1SOAA 5H82A 5LB2A 4K86A 4KBYA 1PL8A 1YZUA 5IKMA 1EUQA 1CVLA 1QTNA 1LLQA 2XHEA 5GZ3A 3UJPA 4QFBA 3INNA 1EBBA 3WFJA 3NTOA 5JAHA 2FV8A 3WJ1A 2XY4A 1L7AA 2R86A 1M6VB 2C5HA 4W5HA 4V0KA 1XVTA 4XDGA 2XA9A 2P90A 4Y2RA 3ZWYA 3ZZTA 1YFKA 1GDDA 1GOTA 4IHAA 2VO1A 2YS6A 4CYMA 3IE1A 1RHQA 1I5EA 2NADA 5CVVA 4GMDA 2CYBA 1V26A 3PU6A 2L69A 3Q5DA 4GUDA 1X8LA 4HI0E 2BEKA 1XD8A 3GRYA 4XZ3A 1Y9DA 4Z51A 2LPMA 3CWCA 3EEQA 4TYPA 3BHIA 1CHDA 2ONZA 3MFQA 3LBNA 4HAIA 4C04A 1F1JA 1ULSA 1ZIPA 3P7MA 4TTSA 1D4OA 1GUZA 1Q7CA 1ZK0A 1E2GA 4M7WA 2FJUA 3W3AH 2O7VA 2YFKA 1LNQA 3HCWA 4CT0A 5JTUA 4YBRA 4ZIRB 1ZN8A 1AK1A 2CKDA 1P19A 2P91A 3FFXA 1SZCA 2F43B 3QX7A 4C5AA 3CNQS 1SQ5A 2OWDA 1V16B 3IDZA 3KXIA 3QKRA 1JJVA 1XCBA 4Y6OA 4EECA 1T1IA 2B36A 4IGFA 3ZHCA 2PE5A 1PWEA 4BFWA 1TF7A 2B2XA 1U7DA 4WL0A 5FBLB 3WBFA 1BKSB 3NC1C 5A06A 3HR8A 4M1SA 4AN0A 1JH8A 2AI2A 1USUA 4O4JB 4BDTA 1R6TA 1V2HE 2CY0A 1KQFA 3ZZNA 4YBZA 5AVRA 3EDQA 3COPA 1G5QA 2QZ9A 3ETDA 2DWPA 3G2PA 1L7PA 4LQDA 1N4DA 4QOJA 4R31A 2IHKA 3MQFA 1L1RA 3RQSA 4EX6A 5F2EA 3KTAA 1D04A 5BQXA 1LKZA 3IDOA 4C0AC 1T36A 3SBDA 2QPAA 2QD2A 2ONJA 3EHEA 5CIWA 1QHHB 5CNMA 2ZKIA 3IYLW 1E2IA 1QP8A 4M6WA 1QAQA 1URPA 1Y8CA 1UH5A 2O06A 2WA2A 3INRA 3QF4B 3BFKA 3FGNA 2GFQA 2W0MA 3KZVA 3LOQA 3CUYA 4LC1A 4UBKA 4E1BA 1MJGA 4EHHA 1UKAA 1ZONA 3L79A 3QELB 1MMFB 2PLWA 3EE6A 3F96A 3PEUA 1Z73A 4IX1A 2GZ1A 2VPWA 3A28A 5LLSA 3JSXA 1T26A 3UOWA 2B1JA 1HQYE 2B9VA 1TJ3A 1X1CA 1JSXA 1GZHB 1LZLA 1N2OA 2PYIA 4YJ3F 3AUKA 2RB5A 2E9SA 2FPPB 5H7XA 2JJ2D 2WDZA 3K4HA 3ZBQA 1GZ3A 1P7ZA 2XNJA 3MWFA 3CGGA 4MVXA 2YWEA 1AX9A 5BNWA 1GTJ1 3AG6A 3V32A 3QEAZ 1EFPA 1KKUA 2O05A 5EIAA 3BXOA 3IOYA 2NM0A 3SC3A 3M5WA 4LNUA 3UHPA 4GYJA 1XRNA 4LHEA 3ROQA 3ABSB 2V7PA 5BSHA 3J7AC 1L3BA 1T3LA 1ZEJA 3N2EA 1ZR2A 2ZAGA 1W4ZA 2VLIA 3LUKA 5K9ZA 3I23A 1F4LA 1VE7A 1ILWA 2G1KA 3EGCA 1AO0A 4P84A 2B9EA 4OK6A 3RYHB 5J1SB 4IEFB 4A0HA 4X65B 1HTTA 4X44A 1JLRA 1OGIA 1RJEA 4GR5A 3JAKB 2Q6IA 3BRWD 4UMVA 3VPSA 4O2AF 3EXAA 4XCVA 2G09A 4CDGA 5IJ0B 2WD7B 1R6VA 2F62A 3NVMB 4Z8YA 2P78A 3WKEA 4EEKA 3DBLA 1W29A 3CLRC 1AURA 3OKCA 4YJGA 3FPBA 2PKRA 3BMNB 4OAPA 2B8NA 2YRXA 3D7MA 2Q49A 1KMQA 1QQ6A 1U90A 2FPMA 2NYRA 2P68A 3KJZA 4QXMA 4RVGA 3RANA 3T3HA 5I51A 2QUJA 4F5YA 3LKBA 3UO8B 3GVHA 4KXFB 5DTMA 3B1XA 4NZPA 2QU8A 5AXDA 4KIFA 3ICOA 2FG6C 2FP4B 4CN9A 2I2CA 1TA4A 4UW9A 4ADSG 5BYBA 3ZTYA 1OFUA 2DPYA 3VR0A 1JWLA 3T52A 2V65A 4NARA 4HMPA 3LFHA 4IHKA 3VZDA 1ACMA 1GSAA 1XIVA 3CH7A 1YB5A 2QTWB 4L8VA 2DH6A 3K0CA 3PJDA 4G4SP 3WQBA 2YUTA 1NOKA 1ZRSA 1OXTA 1EUDA 1HG1A 2J3KA 3BWXA 2C9DA 3PC4A 4JJZA 2D2VA 5F77A 4QZVA 2VTBB 5D8DA 3TECE 1EUZA 4JYPA 5FWNA 1Y8QA 3ENZA 2VYFA 3N2NA 4JJIA 2JLZA 4AKIA 3EK2A 4EF5A 2FA9A 3U81A 5KNLA 4L8FA 1FNSA 2XQGA 4KQGA 4ND4A 1KEPA 1FNBA 3IP6A 3WHLA 4P3KA 1OAAA 2EJTA 2WE7A 3R74A 1JSCA 4K6MA 3I2JA 1B6SA 4TS3A 2P5TB 2I71A 2ORED 4EJ0A 5C3MA 1B0UA 4K2AA 3SIWA 3FR8A 1Z07A 3OO0A 1F1BA 3WV5A 5IJAA 4V1CA 4O4HB 3HN2A 2QLMA 1JHUA 3UK6A 2RMKA 4AKEA 2BGGA 1SWWA 1GUBA 4D41A 3JQBC 4BYGA 2F2TA 3WRXA 1Z4MA 2C2BA 3F7NA 1TFUA 1UXJA 4E70A 1PJTA 3N8KA 3HG7A 1ODSA 3PUIA 5DLPA 5THQA 4WZ6A 3SFTA 3HCPA 3OOJA 4FILA 1ZM3A 4OPMA 4RF4A 5FO0A 4D44A 5JC8A 3A0RB 1DG1G 2QN3A 3QUCA 4YMLA 5JZMA 3GFOA 5KDLA 4UAGA 4EUKA 3DM9B 3JQGB 2Y1DA 4B3HA 2BGWA 1YR6A 4Q66C 3JRNA 4PEVA 5AFSA 4R1SA 4WJZA 3NTUA 4AS1A 5KYGA 4PICA 3O4VA 2VKTA 3MPUA 1C7ZA 4WXEA 5C0OE 1EFRA 4F4JA 4NK4A 1XJ5A 4WNAB 5E7JA 4CM4A 1LJ8A 3GMSA 4XARA 2WIKA 4YAUA 1N1GA 3FNFA 2XA2A 1C8VB 4TSRA 1KQNA 5LWQA 3INGA 1RNLA 3O9ZA 2PMDA 1DDOA 1TECE 4QT4A 1M8KA 2OT3B 1KJ9A 3RADC 1BVYF 2P35A 3OZAA 4L5BA 2E1RA 3EIEA 2QAJA 4PLYA 1SJ9A 2YHSA 2ZJYA 1ECBA 3JYQA 5FWAA 3EMBA 5TGTA 5KQMA 1MAVA 1R5BA 4RENA 1VYHA 3COYA 2QLNA 4HAOA 3MWJA 4IJUA 1GCOA 3A10A 1JQEA 4GICA 2ZBPA 3LUFA 1R0BA 4TMVA 4I81A 3O82A 1IY1A 1K4KA 3T38A 2GILA 2IU6A 3R7WA 3ZDAA 1LBEA 3Q6NA 1FRQA 1IZ0A 4PAGA 4PAMA 2GPTA 4DNXA 1BWQA 5D85A 3CX8A 1RWPA 3EXIA 2QY6A 3KNZA 4B43A 3LQQA 2HXGA 2H9AA 1YBHA 2GPYA 3FN4A 3ZCRA 3OIFA 3ASUA 1THGA 4BEWA 3U9TA 1X14A 3C3PA 4FGUA 1UJ6A 2WFZA 4ZOLF 1M2OA 1ULZA 3EZ2A 3Q9UA 4LMRA 2HAEA 4TVKA 1ZWLA 2ZRHA 4LXQA 5EZ6B 4CQMA 4CBVA 2ZROA 2ZRAA 1MPTA 1VCMA 3PTAA 1QZ3A 3U19A 1H1LA 2Q6OA 1G8YA 2GN2A 6Q21A 3X1JA 3AP1A 2AFRA 1PL7A 4CEJB 3KLMX 2H1RA 4ZEOA 3M0EA 3OQJA 3OPVA 2NIPA 2VN8A 1BHO1 2P9CA 4IDFA 4NFHA 1LPPA 3F78A 4CLRA 2JEZA 3ZCQA 2Q3BA 4YJ3B 2SKDA 4KHZA 1TM1E 1XL1A 1NQWA 1R8QA 2XA1A 3AZQA 3AOEA 4TUYF 3H1GA 3AWIA 4ZVUA 5B57C 2EP7A 2OORC 4TRJA 4LVUA 2GBLA 3AT1A 1SHUX 3C1UA 5IBPA 4CKEB 4DF3A 1HDCA 1WMAA 2ZU0C 5IMSA 1M2NA 4K9KA 1HO3A 1K9SA 2HOQA 5F5XA 1CZHA 2J5KA 5DSTA 1TEXA 2H7VA 4R1UA 3DQPA 1VLJA 2B1GA 2WYWA 3R3XA 4E7OA 4ZT3A 1CV2A 1ECLA 1I6MA 1PQYA 2A5YB 4Q03A 4RF3A 1ZXXA 4UMFA 5F64A 2Y1FA 3OZTA 5FI0B 2IU4A 2ORWA 3SJUA 1RRPA 2IYTA 1G4HA 3E7DA 3E9NA 5FBRB 1J0XO 1EM8A 2ISQA 3GLUA 2CUZA 4MIOA 2CMGA 2QG4A 2ZS7A 4JODA 3CNEA 2V8OA 4JLDA 3A1TA 4G5QA 5EP4A 1JIUA 3QEBZ 1SXJA 4IILA 3QXXA 4O2AB 3CWZA 2GZRA 3E9QA 3ME5A 2CMKA 1TT7A 4RHCA 2P7IA 3RSZA 1X9IA 4PNEA 2ZXUA 2B2CA 1DX6A 2PKWA 1NUHA 4DLSA 4BLPA 4M21A 3UV6A 4WOBA 1S2NA 1Q5PA 1C1HA 4PFJA 4UTXA 5JISA 2G5CA 1AKNA 1M2KA 1HY3A 3HKBA 4ZXPA 1UFQA 1UFOA 3OVMA 2AD1A 4LJYA 3ROTA 3WB1A 3WNBA 4HNRA 2CXTA 2IEYA 2RI6A 4HCJA 4P4LA 5L3ZA 2JJYA 4OHYA 4D79A 4CEIB 3PC3A 4MVYA 3RRYA 4K7JA 2E7ZA 2RBKA 3OJ0A 5EKSA 1VSBA 1T34A 3O1LA 1B76A 1ZL0A 3PNBA 4UBJA 3A6KA 2W2MA 1XTIA 4GLLA 1WZ2A 2WAXA 3GLFB 2DECA 2O1SA 5FQOA 3Q8LA 4F1WA 2ZXEA 3VR2A 1Y5IA 1WJGA 1CDEA 4IQ0A 4G0XA 1OC2A 4RMGA 3RS8A 4CODB 4WN9A 1QNLA 1DIAA 2H17A 3F5SA 4LK2A 4YH1A 4H27A 1IY0A 4JL8A 4NVRA 3V6MA 4W1SA 3HZOA 2AG5A 3C3JA 1R1DA 3HZRA 1SVNA 2ZVJA 4F6LA 1SIWA 1H8ED 3V1MA 2EF1A 4ZEMA 1XRPA 4CKWA 4G8DA 3ZGZA 5IN5A 4A2CA 5B3KA 1ZITA 1E7SA 4MTCA 4DM4A 2C9MA 2OBFA 3AU8A 1UMKA 4CM5A 2RC5A 1UPXA 5CX1B 1AKTA 2ISSD 1KDVA 1ML3A 1SK8A 3G7SA 1E7WA 1O95C 4QYMA 5LDGA 1X7WB 4S12A 1PJCA 4XGKA 5I9BA 5HPYB 1OZGA 1D8TA 1KDPA 4R9SA 2O6LA 3WVNA 4EJSC 3LY9A 2Y93A 2BLNA 4Q3EA 5KYTA 5K0JA 4KQJA 2G7ZA 1IRXA 2WC1A 3S3TA 5KNBA 3D9QX 2AWNA 5EQTA 4NDAA 1P2VA 5FP0A 5BYJA 3E2MA 3FNIA 2NACA 4MP3A 3L8DA 1B8VA 2IXFA 4I1UA 4RTQA 5KYYA 1I9CA 4WLNA 4P4TA 3W5UA 2LDXA 3V1LA 2QE6A 2YHAA 4NYJQ 1G41A 1GGKA 1GQRA 4NAUA 3RFUA 4P0TA 1VG1A 2N1MA 2X9QA 3UN1A 4D4IA 1TCVA 5JANA 4W1PA 5BW6B 4KEAA 2XGJA 2DFVA 4P86A 2BMFA 2YWJA 3IOMA 1K6MA 1IY2A 2CJWA 1H23A 4TT3D 1EE1A 1NTRA 3OCCA 5HRCA 1E4EB 4KXUA 3BTVA 4XB2A 4LZPA 4EMTA 4F4HA 5HNKA 5A5EA 3BDVA 1OD6A 2W2VA 2Q3EA 3NIFB 3HU3A 3QA3E 5CLHA 3WV4A 5FAXA 3B53X 2XJ9A 4MI3A 3KUDA 4F45A 1LBSA 2ZE6A 3S68A 1PK9A 2C9YA 2BKLA 3EOBI 4FMBB 4LJAA 2CWWA 5AOAA 5B5SA 2O52A 1J97A 2XEXA 1WSWA 5H9WA 3N7TA 5E6RB 3WXMA 2BF4A 4HEHA 2BGMA 1ZU4A 1ZAKA 3NBAA 4HTAA 1GL3A 2JAPA 4NENB 4KFUA 1I32A 1XDDA 1TEZA 4HNAB 4PAQA 3TOVA 4HB0A 3Q12A 4F3YA 1ONPA 2Y1LA 2CXRA 5CP8A 1LCIA 4XGNA 5KHAA 5F4ZA 3CO0S 5HDBB 4RDHA 3A9CA 2XRYA 1U2RA 3C74A 1KQOA 4K9LA 5H1YA 2UZ1B 4D45A 1KVUA 3LCCA 1PV4A 2QVZX 1SPBS 3KDSE 4ALLA 4EPTA 3GFSA 3AK4A 3IDSA 4ZICA 4KSBA 1PK8A 1QF9A 3UMRA 2JJ8A 5HJEA 4BQOA 4MRPA 2W8BA 2CJPA 1TCAA 1WUKS 2IWRA 2VDUE 3LPCA 3ZEIA 4JI5B 1W5EA 2AD5A 1KYQA 3BL5A 1F7UA 5EXXA 1GKYA 1HORA 2CL0X 1NDUA 5B2ZA 3OEYA 5EVCA 3L4SO 4JI8B 4TUYB 1PDVA 1C8LA 4UQOA 3L49A 4UUOA 3BIOA 4OM7A 5BWOA 2WINI 2VJLA 3HB1A 2MSEB 5CFOA 1FMFA 1W93A 1TIBA 3KXDA 3M4ZA 4RABA 1QAMA 2C58A 1X7ZB 1PFYA 1LVUA 4G5YA 1DELA 3A6PC 4P36A 3LYLA 3EYAA 1EZZA 3FCYA 2A1IA 1UBHS 2BELA 2PPVA 5EY5B 1JB9A 2AC7A 1L5HB 1Y8AA 2BP7B 1XPOA 5F9FA 1MHPA 5HBGA 2I7XA 1WDMA 4R0VA 1GSOA 4W8OA 5FFFA 5K6AA 1ZBDA 1P17A 2A59A 1Q11A 2AEFA 1VLZA 1U7XA 2J0SA 4C05A 2KB0A 2HMVA 3RUDA 1ZGHA 4QPNA 1BE0A 3WGKA 1D6JA 3FPLA 4HWPA 1RCFA 3BWBA 4MVJF 3JZIA 4G23A 1JE0A 1G64A 3JVUA 2O07A 4D8TA 4M53A 3UW1A 4V0OA 2EKLA 2GAAA 4Z54A 4DMCA 1Y5LA 2I7CA 3IJRA 4F11A 4GI7A 4EL5A 4HDCA 4BO4A 5CT9A 3REGA 1OQAA 3WQRA 3JW8A 1G5PA 4NMXB 5LUAA 1XHFA 2FN9A 2QZZA 5LZ5A 4QFDA 3R3ZA 1GP2A 3C3AA 2PJUA 5H02A 4PSCA 1WHTA 1EVLA 3CINA 3VR5H 4IHQA 4ZYYA 3NBQA 5F9MA 4HDMB 1DDIA 5H70A 1YAHA 4ITRC 4ZJYA 3QNWA 2R2AA 3MWLA 3HJHA 1ZCAA 1ZUNA 3KDAA 3MF4A 3NOVA 4U7PB 1V6CA 1D1SA 4XIIA 4GC5A 1YUNA 1AH2A 2SBTA 1QIIA 2Q28A 4BRSA 1C3EA 2ZUCA 2DG2A 4ZI3A 5EGSA 4YYEA 1XR3A 5I9LA 1YH3A 3OWHA 4RXMA 1AV7A 4QBFA 1C1XA 4B48A 1B6TA 4ZHQA 4GZ5A 2R25B 5BUSA 3U7IA 1E6MA 5EL0A 1SZJG 1TAQA 3HA2A 2ZSFA 3PQ7A 4YMHA 1DE0A 3B89A 1OMOA 3QX9A 3DAYA 4J6EA 4Q7JB 1FU8A 4QPDA 4TYWA 2DY1A 3CB2A 2QM0A 2RHMA 3MN1A 1RLUA 2FSVA 1C9YA 4BFTA 2FVXA 3KEQA 2VP4A 3CE9A 1NVAA 2OXTA 5CFQA 2QE7A 2HFJA 1KH2A 3QQPA 4EBFA 4MVJG 4IDGA 3VVBA 3AHDA 4EHAA 1Q2UA 4BTLA 4NCKA 1Z28A 2WTXA 4Q9LA 1JLSA 2QW1A 3IHLA 4FLFA 4QVKA 3VR4A 2C07A 4PZYA 3GGPA 4N6OA 5KI6A 2A5GA 2O7RA 5I7UA 3KT3A 2C7OA 4HVTA 2AJDA 5B37A 4JZYA 1NJ6A 3NCHA 2OV6A 2ZRGA 3ZCSA 1L7MA 3N2KB 4M7OA 3CCBA 5DTJA 4NZZA 1IM8A 1N9GB 1FFDA 1UMCA 4OV6B 4CQLB 1CS0B 1AOXA 2Y76A 4NZYA 4D0GA 2Y0CA 4Z49A 6ABPA 3C6ZA 1ARZA 3EWAA 3AM4A 4QOHA 1BS2A 4MRRA 2RHGB 4WLOA 1RE1A 3ROFA 6REQB 2DHQA 2FCAA 4JWTA 1QIMA 3JQAA 2WAYA 4DPMA 3WGMA 1I36A 3D8NA 3LF2A 2ZZKA 4UTVA 2FZWA 1P1IA 3PFIA 2ZULA 3IVXA 4F8YA 4HUTA 4C20A 2ADFA 1Q1NA 4FW8A 5JNTA 2WIAA 2PXCA 4M4SA 2B8WA 1Y1LA 2PSEA 3DC2A 1T3GA 3JALB 4EB6B 2WJIA 4AY5A 4RPKA 2P77A 4PW0A 1F8UA 2FEXA 1NYLA 2HA2A 2PBFA 3D6VA 4U02A 3SOPA 2ZWPA 3BEDA 3M5CA 4L4SA 2NUPB 1EDBA 5CNJA 3CSUA 4URYR 3O31A 3AO0B 1L5NA 3W5SA 3IL2A 1UJ4A 3QITA 1T4BA 3V4OA 2EWVA 1HH4A 2JA1A 3O4HA 4G1BA 1SCBA 5GV7A 4ND3A 4I9HA 3NR2A 2W37A 2WILA 2HSZA 2XUQA 3E2PA 2P9GA 2W93A 4B09A 3NS7A 3ZNQA 1FLDA 2R8RA 3P45A 2FSPA 2G8NA 4IVPA 4PRYA 2HLDD 5ITVA 1OFGA 2XCSB 2QRZA 3JY6A 4G97A 3MC1A 1A8HA 1NATA 5CVCA 1YKSA 2M1ZA 1P1JA 1LJUA 4DJDC 2PG3A 2NN3C 2X19A 3BMOA 2FN8A 2NPFA 4RXTA 3VR6H 3ZV3A 1MB2A 4KX5A 1G8AA 2FX3A 4ILKA 1E1RA 5C53B 1P1CA 4Y6RA 4JQOA 4HVCA 1WAMA 3HCFA 4M99A 4PZDA 4C0HA 1YRQA 5FTKA 2VF7A 3OI7A 4NEQA 3PNOA 5IBRA 1O4VA 1YOVA 2CT8A 1FYEA 1G6OA 3G88A 1KO4A 2IEZA 2P9ZA 1H2XA 2M9MA 4Y0NA 4BO5A 1JPUA 4KH0A 1FRZA 3VH1A 1CQPA 3PI6A 3DKKA 4Q4JB 3W4JA 5LOVF 3F7OA 2R8PA 1VIYA 4KZKA 4NS4A 4WHMA 5K99A 5K8IA 1AUOA 4EZBA 1SUSA 1V3TA 2X0KA 1M0EA 3QUQA 1NGSA 1JU9A 3LJKA 3OZDA 1HWYA 4G84A 3QBDA 4D0LB 4TTQA 2KSQA 1VE9A 2NO0A 2R6ZA 3M5DA 2VUSA 3FCUB 4G4IA 1Y6ZA 4JJ6A 3DZCA 3N75A 1E9BA 3ABZA 3IS3A 1D2EA 3PITA 3KFVA 3DVRX 4G1EB 4KIWA 4US2R 1VFNA 1R18A 5EZYF 3GEEA 4EPYA 3A31A 3ZIUA 5ALWA 5IJWA 4DZZA 2FR0A 5MF6A 4X6XA 1GGMA 3RF6A 1L4BA 4DW8A 3D2LA 3TQFA 4F6RB 3CVYA 1VG0B 1Z18A 3OWOA 3L6CA 1HNNA 4P3XA 1FVHA 1E2FA 3IAS6 4B81A 1NW6A 3E27A 4LDQA 5SV2A 3BA6A 1OLSB 2IYUA 1BQEA 3R9KA 2NXEA 5AVUA 2HJ9A 3L0SA 3LU1A 1XZHA 3EWNA 1Y1QA 2Y99A 2HRDA 3MJTA 5AP9A 2VRBA 3ET5A 1XEXA 3QPAA 3EJWA 5T6BA 4DLPA 4HH1A 4JOQA 1RE0A 4RHTA 1KSHA 4CLHA 1WQ1R 1R4MA 1TJNA 3F97A 1D4ZA 1MDBA 2VNJA 1QLJA 3HFGA 3OFNA 4IIEA 1RIIA 4KAFA 4MRMA 3NUQA 3UUWA 5JRJA 5EMJA 5F7OA 3AVYA 121PA 4GLBA 1VC2A 4JJGA 4ZT7A 3GCZA 3I64A 5HS4A 4EI2A 3P97A 1RJ9B 4RHUA 2UUPA 1NJGA 2ZJ0A 4WNYA 4FX5A 5JT1A 3O8OB 2GVNA 1U28C 4MCAA 1GGEA 1IJKA 1YBAA 1TUBA 2PQ6A 3JS5A 4TN5A 1P61B 4AF6A 1Q21A 1SB9A 1QV6A 5KJFA 3P2YA 1VE3A 4BKMA 5K8CA 2CDBA 2RHCA 1L7QA 4KFRA 3T1OA 2JFHA 5IYZA 1TAUA 3GOHA 1JI0A 3RU9A 4K0KB 4O29A 1L5RA 2J87A 1H8HD 2X1LA 2FZ5A 5HJ2A 3WA6A 2QD4A 5CDFE 3BOSA 2A0WA 2H0RA 3M6AA 4L8YA 1PDOA 4AT1A 1EKXA 5F3RA 2IEGA 1MH9A 1RTKA 1XEWY 2VT2A 4HZUB 4DMHA 1MIOB 1TMYA 4JLUA 4UUAA 3B2EA 1UXHA 3OC6A 2I6XA 3DFIA 3TUZC 1QV7A 2AKAB 1NVGA 1FDOA 3RODA 5H16A 3E7WA 5CMLA 2IH5A 1QMPA 4O3FA 1EZ1A 4CCYB 2Y27A 1B26A 3FMIA 4PX2A 2CHVA 1T3SA 2RGXA 3C3CA 2FPRA 3GGJA 1Y4UA 4MUAA 4QOSA 1JR3A 5TMDA 4RK7A 2C4HA 5BOVA 3QXGA 4O4LF 4O2BF 2P3QA 3EOZA 4RD1A 3A1EA 5I4BA 4DV4B 1L8AA 1SUCA 2DZDA 3AEQA 3A25A 4JYMA 4O5AA 1QIDA 5JJLA 2J0VA 1YRBA 3LQ4A 5LN1A 4OHFA 2F55A 2X4IA 1DP4A 1BZYA 3E15A 3HCDA 1ZK3A 3KWJA 4CRWB 4X66B 1O5TA 1LSOA 3L0OA 1NQXA 4KQHA 1O3YA 3IURA 1WUIS 4WBNA 5IDXA 3L0CA 4FFSA 4FGSA 2F1HA 3DW1X 2Z3WA 2Z6QA 3HL0A 1RD4A 4NECA 3OIYA 2IUUA 3MGGA 3TW0A 4EUHA 1ZHHA 1YZQA 4GIBA 1UBKS 1GPJA 3PPVA 3VC3A 2HIGA 4I7EA 4FHEA 1SOVA 4HDNB 3MA0A 4AQYB 3R8XA 3HMQA 5FEUA 2H57A 1H5UA 3LUBA 3T35A 1JQJC 1UQTA 2B5VA 3CIFA 3TFWA 3ZUGA 3W9UA 3JQCA 1ENOA 3V8MA 5J4YA 4J0EA 4U3JB 3IPAA 4CIAA 4B79A 5DTEA 2A94A 2C94A 1H9CA 1AKRA 4TV8A 5KNCA 2PTGA 5EJIA 1KK1A 3BA1A 4JBXA 1HA3A 1LPBB 1UBGA 4ENUA 3I30X 4LRTB 5JHHB 3TZBA 5ALNA 2JFOA 5KWIA 3DOOA 3TH5A 4BNLA 3M6XA 4QUKA 2BLLA 2J46A 4KYIB 3KUXA 1AA6A 5G0SA 4C03A 2W8ZA 4RL4A 4PNZA 4LDJA 2F3SA 3QWFA 1NVWQ 4Z2AA 4HSGA 1PR5A 2XWJI 2J41A 4KQKA 3FRHA 2XCUA 1XTZA 3E4DA 3OC0A 4N7BA 2DMRA 2LKDA 4JH0A 1MFZA 1XLTC 3D5TA 4OSOA 1JMYA 4GDFA 3PK0A 5AKGA 1FEZA 2ZJ5A 2AOUB 2CLMB 4ZIRA 2JI7A 2V3WA 4B87A 2Q2WA 1B42A 5BUCA 1P5RA 4KRYA 4QTXA 2F8MA 2VJMA 1IN5A 4FE7A 2OKGA 2CDRA 2HH9A 5EKDA 3T1VA 2IOHA 1DXQA 3LPLA 1RFGE 1RC0A 1UJ5A 4HWTA 4ZU1X 5CA0F 1UKBA 2HJHA 4IZIA 1Q1ZA 3B51X 1SKAA 3G3EA 4TVSA 1I01A 1IQRA 3SYTA 4BB6A 1BGWA 1ELOA 4XCXA 4LYDA 2QQ5A 3CSSA 5KYUB 1O6FA 5H80A 1XAHA 1TKAA 2J5BA 1CUUA 1U1CA 2X77A 1LLCA 1DGQA 1LB1B 3T5BA 4GBED 4CCWA 1O6ZA 1XN4A 1ZIOA 3ICQB 4JVSB 1QPBA 1RIFA 7REQB 1KI4A 1WCV1 5LXTA 4DR2B 1OLXB 4AZWA 2HC9A 4ZCQA 4D98A 1HQCA 1DCMA 2XUFA 5BVHA 3I6MA 5LOVB 3JQBA 4EKNB 3KOWA 4GOKA 3AEUA 4A23A 4F0JA 5ISMA 3QF4A 1SXHA 4YRRA 1SC9A 1M0SA 1BDMA 5GVRA 1K8YB 1T9KA 5IVHA 4ZGWA 3GLIA 2JBAB 3IQIX 2CVPA 2GZ3A 1I6KA 1K98A 3QYJA 4TWIA 4RYDA 3ZXIA 2FFBA 3LDFA 3K1YA 4D8WA 4DCNA 3NZEA 3ZW9A 4OK5A 4EKDA 5JALA 3G5TA 4LVOA 2XDQA 5EZYB 2CUKA 1OWOA 4L28A 5HK8A 5KQLA 1U0RA 1RI1A 3NT2A 4ARAA 2RH4A 2WBLC 3AMVA 4PG6A 3L0YA 4PSKA 5DM2A 5H0IA 1XEFA 2G82A 4KJZA 4BO2A 2NUAB 4CF4A 4U9IS 4WKGA 3W77A 1NV8A 2Q1XA 3D64A 1J39A 3N8GA 2B35A 1VJ5A 4C3VA 2CVZA 2D8MA 2OHXA 2O3SA 4N5MA 1IN1A 4CMIA 4LRYA 2Y92A 2OM6A 3AFHA 3DMPA 3HFSA 5E9JA 2Q3CA 5GWXA 3I4LA 4AUMA 2OESA 1KWGA 1KBQA 3CG0A 5AM5A 1J2EA 2XZLA 4TKVB 2C0CA 1A9TA 1CFJA 1UDBA 4MA4A 1GRRA 4CKZA 4O33A 4RAOA 4X0EA 1ZEMA 1SVSA 2IEBA 4C01A 3LY5A 3ICCA 1OX6A 5LMUB 4UBMA 2V5AA 3SG0A 3T9FA 2CBXA 3CG4A 3RYIB 2WVHA 3RIMA 5EE5B 2H9YA 3EXEB 3KPJA 4MP8A 4WMLA 5GGYA 3JAKA 4TGLA 4UM9B 1IJEA 1WG8A 3ENVA 5DX1A 7ADHA 1GYQA 2PSHA 2KPOA 5J4LA 4CR7A 1QO9A 1SQGA 3K0FA 1GG5A 3N0VA 3RRXA 1NOIA 1B16A 1EP1B 1PFWA 2ST1A 4LX0A 1VECA 5CU7A 2QMQA 1NYQA 3LD9A 3PGXA 3K1ZA 4PYLA 3SCZA 1FJ2A 1NMXA 3WNDA 1IEWA 3DULA 3FBWA 3HL4A 3CCCA 1ABEA 2E4WA 3BMXA 1KDOA 3EH2A 4KQXA 2QL9A 3H9QA 1CY1A 2ZSJA 3TINA 4CQJA 4ANFA 2R7MA 4UJ3A 2FX2A 1HFJA 1FXWF 2GEKA 2AHOA 3EX7C 2FP4A 1XELA 4QPCA 4IXNA 4DUZB 1VRCA 4JUIA 4Q18A 1H6CA 4N9WA 2CMDA 3UXHA 5HR5A 4B2YA 3DEFA 4N7JA 1IHPA 3EVCA 1AC5A 1IOZA 2IOYA 2NTVA 2PS3A 2Y9PB 3B78A 1Y3AA 4V3BA 4I9UA 5TY0A 2CV2A 1ZH4A 1ZGBA 2HHAA 2CJYA 3GP3A 1I7DA 2BEUB 3P9YA 3QWBA 3ZI7A 3HR4A 4HQ6A 4U7GA 3MQ4A 4OGFA 3C7DB 3OCXA 3R5JA 1JL3A 4RCYA 4BP9A 1M76A 1NW5A 4OHBA 2WP0A 2P2NA 4O4LB 3W2GA 4O2BB 1K7FB 1BH2A 4M55A 1YUBA 2AYZA 1UK9A 2OORA 1ZSVA 2ACVA 1PKXA 1U4NA 1R9NA 3ZWKA 2GTPA 1E1NA 2FY8A 1L4NA 2Y4OA 3GFGA 3N2GB 4XJXA 4CVNA 4D97A 1T10A 1U2QA 5EJFA 1O6CA 1JGTA 1RHJA 1PZMA 3ZV4A 1NR7A 4D3ZA 4JA2A 1PGOA 4ABTA 3X1KA 1KRXA 3CXUA 3L8YA 1PHPA 1NSFA 1JX6A 1U80A 2EBWA 4S1OA 3UA3A 3OT1A 4WXMA 1S8FA 2QVBA 3GYGA 3P4XA 5JAQA 1YASA 3MLBA 3TTTA 1T6XA 3W7VA 5ADHA 5JH7F 2O3QA 4JBIA 2KBEA 3LG2A 3FUWA 3A1SA 4LTDA 3BMQA 3OQ1A 1P7CA 4BASA 2AK2A 4NYMQ 3ESDA 4UTPA 4RANA 3TGWA 2NU9B 4MWDA 1ITZA 1SVUA 1GXSA 1QHSA 5LP6C 5FUBA 4IIVA 1FS6A 5BOSB 1AUPA 5DGHA 5FL7A 3NMUF 4GOND 1SQ6A 4O8CA 3LDAA 2YHIB 2OQ2A 5ICCA 1V8FA 3CF4G 4A8JC 1Q19A 1HKHA 3A6FA 1YR9A 4O4IF 4EYKA 4H0CA 4G6ZA 4IUBS 4JITA 1F6WA 2BGNA 1PTJC 1SC6A 4QUGA 5FA8A 4DRYA 1GAXA 4QHYA 1N0UA 2ONYA 3NBFA 5BRNA 2WYHA 3BULA 4LXHA 4Q01A 4AG3A 5D3MA 2FUEA 2YFQA 1PV2A 1DV2A 3D0RA 4RMNA 4RSGA 3IIJA 2YOFA 3DTVD 5ALOA 3P27A 2I2AA 1JT9A 1GKUB 2AFIA 2NNLD 3N2ZB 5EJ6A 3T8YA 2WJVA 2WZBA 2C77A 1FSFA 2DVMA 1KU6A 2HSDA 1LX6A 4HBZA 5FL3A 3ZOKA 2FAXA 1JA1A 3AC0A 2V98A 4ASUA 5C7YA 1ZK2A 1EXDA 1WD7A 1UAAA 1NZFA 3MM4A 1VFPA 2PCLA 5LQSA 3ZQKA 3SC2B 3IPLA 4CLOA 1VZ3A 3ORRA 3F7MA 1O5OA 1I4EB 2X8WA 5ALYA 4GSLA 4P3YA 2Z8XA 1DT5A 4PYQA 4QDXA 4ZO4A 5IWAB 3D4PA 3GXOA 3PDIA 3U5ZB 2GK4A 1T6YA 1GGVA 5CUQA 4AO6A 2GJ4A 1UKCA 4PG4A 4QU5A 5T4EA 1YZHA 2ZDHA 1LV7A 1KHHA 1NC1A 3MWYW 4IRUB 2PXAA 1GQSA 2CFCA 2WOJA 2I54A 4LRUA 1T9GR 4NZOA 1E6KA 4BGUA 4XDHA 4MO2A 2JK1A 2X7HA 3L3BA 4LV5B 2Z2YA 3RC9A 3T6KA 3K7EA 4N82A 5K7SA 1T9DA 1O95A 2R44A 3C3BA 3UJ3X 1PI3A 2B99A 4WEQA 2UUCB 2QXTA 3L7YA 2HYIC 5J5CA 4EJSA 2XLCA 4C2BA 1K66A 4MJ3A 4ZDIA 5FI3A 3TLEA 1XAIA 2EKPA 2V54A 3LX5A 3U6BA 4Q9AA 4BXOB 2XNDA 3AR5A 4ITUA 5JG7A 3SX2A 3V4LA 4Z7JA 1FLAA 2IHYA 2BGKA 1IY9A 1WKBA 3G2JA 3NGLA 5JTTA 5DZSA 2XV1A 4JUDX 3ZHOA 3BFPA 1RRVA 3HXKA 3PNSA 2IHBA 4J0JA 1ES9A 1O97C 2EBFX 2QUAA 1P8AA 1MJGM 3HU5A 1WTCA 1M74A 1II9A 3WWDA 3NONA 1PZXA 2F3UA 5DW3A 4DBVO 1TEHA 2ZPUA 4X1IB 3HRKA 4FGJA 5B6JA 1T2CA 3EDRA 4WBSA 1L0BA 3CLSD 1AQ6A 4UNQA 3ROPA 1WUYA 2AC2A 2HBZA 2G5TA 3O83A 5FNZA 2PCJA 1GPDG 3L7BA 3I9V1 4V0SA 2BTQB 3AFNA 3EG9A 4HSEA 1AGPA 2J0QA 3WLSA 4DNOA 2ZAYA 4JBNA 3TMYA 3IEPA 2XUGA 3MUNA 3IDAA 1SKQA 3ZVRA 4B7AA 4UULA 3OF2A 1PLKA 4Q9IA 5FI1B 4D9MA 4DRZA 3QY9A 4LE0A 3ONDA 1TA9A 3QYAA 1N32B 2NU7A 2G1AA 5C7OO 1F17A 3FD8A 4IX9A 4ZRDA 4U0JA 1PFVA 5SYNA 1GITA 3GP8A 3E0QA 3UM9A 2CCKA 2V59A 3TRHA 4QATA 1FVXA 3TDMA 3S1SA 1JKXA 2XTZA 3CZRA 4RD4A 3HO1A 1IULA 4RZ3A 3H7AA 3BFXA 1Z6GA 1RR6A 2IYZA 1F48A 4ZHSA 4JEIA 1DDGA 1UDAA 2H92A 1RXIA 4CMGA 4JU8A 1IG0A 4U7FA 3AB8A 5LQMA 2GEVA 1ZW6A 1QC5A 4RFSB 4ECAA 2CMFA 4RZ2A 3AY6A 3D6MA 3DZHA 3K71B 1A71A 1DIOB 2HREA 5A4KA 4PZUA 1JAZA 1O0CA 4TZ6A 4II2A 3WLJA 1F8FA 3TWOA 2IJGX 1JJFA 2B4TO 1G9SA 5KMGA 1SHJA 2ODBA 1LC0A 1XJ0A 3W7BA 5I48A 4KXVA 3GEPA 1RLOA 3GLFA 5AJUA 2QLJA 4Q4AB 2O8FB 1UFVA 4NQRA 3FVWA 3WMGA 1NT2A 4H08A 5C1DA 4DMMA 1UDWA 3G49A 5C7IO 4QTTB 2WTUA 1G8FA 3A3KA 2BH9A 3GQBB 2BFEB 5L7YA 4CDMA 3DXYA 1P2BA 4LOKA 5ALZA 3TSZA 4MLPA 5B6PA 1PZHA 3EGOA 1CUCA 4LV6A 9MHTA 4KGVA 1J22A 1O8CA 1YQQA 4FX2A 4TT8A 2IRWA 1GKIA 1XTPA 2ILTA 2Q0SA 3E3OA 5T57A 1V3UA 5ITZA 3RE1A 5BNZA 2HBYA 2XMBA 3D1LA 3NEYA 3BKWA 4JP2A 2CVQA 3AJ8A 4G4GA 1V1MB 2O0KA 3E6AA 1PFQA 3A6ZA 2PJRA 1THMA 4F96A 3PRHA 5IZCC 3ELWA 1Z5WA 2LIVA 2DYKA 5ESWA 1CQIA 1PYOA 2ZSKA 5AKIA 4BNDB 2IOQA 1A8PA 1J2RA 3CUTA 3LRXA 3V8NA 1L4YA 2CFTA 1X7WA 2GHIA 2UYHA 4YMGA 1NJ1A 2WSSD 1PWYE 1MAWA 3CX3A 3H3JA 1JA0A 1E6EA 1GUAA 2QX8A 3I42A 5C3UA 1RZ3A 1D4AA 3R6WA 4A73A 1Q3TA 2FWBA 5C7LO 3PYLA 1G9XA 1SKBA 2PH7A 3AUUA 3MWDB 2IIVA 2PTHA 3K1TA 4TKUB 4W6ZA 4BQSA 4O4IB 4BKRA 5HK9A 4X62B 3FI9A 4RLFA 1MC4A 1NXVA 1YT5A 4PYKA 3DCIA 3GJ0A 1DQZA 4JB2A 4OH7A 1KE2A 5A9RA 1B4DA 3FDIA 1YJBA 2RK3A 3K35A 2PEYA 5A9SB 3PEEA 2BMEA 1OT5A 4NULA 1VE1A 5F2NA 2EBUA 4H7DA 1QGUB 1TXGA 3CUSA 3EFBA 5ALEA 3V7NA 3VYSB 4O63O 3RFVA 4XIJA 4J9UE 1ZN9A 4NJOA 2NZ8A 4WESB 5DNUA 4DEYA 4YYZA 2JHCA 1A9XA 2J4CA 2WMYA 5J23A 4JLBA 4QDUA 3HKCA 3T7JA 3UW3A 4HYYA 3B70A 2PQ2A 3K9CA 2ETXA 2Z5VA 1D2GA 2V97A 2JH9A 1NSTA 3SDZA 2P4UA 1EG7A 1I5RA 2ZETA 4YPVA 4BNUA 2XUHA 3H17A 3EVEA 2XBLA 3OU6A 5C5CA 4OQQA 1JEQB 5FPTA 4XA8A 1GU7A 3K8YA 5AI0A 2E5LB 5KOHA 2ZYRA 3SSMA 3IBTA 4DR4B 3M1IA 4G0UA 3G0CA 1EWRA 2ZTSA 3TXYA 5E6RA 3BCHA 4YTEA 2UZ0A 3HWX1 2P75A 4I14A 1RBMA 1E63A 3B7GA 5IANA 4DCSA 4TLBA 4N01A 2X8JB 1UWVA 3SYLA 4NENA 4BNWA 1M6WA 1WDTA 1KEEA 2ZIEA 1EDEA 1CT9A 1GPH1 1P2UA 3GD5A 3PCTA 4ZOLA 3TW6A 2X6TA 1XCMA 3MSCA 3LX6A 2P0AA 2QIOA 3HXTA 2VDLB 2BD0A 1GEEA 2MYPA 3OZRA 1PCXA 1T9AA 4ENQA 1EGQA 5TIIA 1AXGA 5HTKA 1XQVA 2PMFA 1Z7WA 2YCLA 4OKSA 4IHJF 4OYHA 3TVYA 3UJ6A 4RSMA 5JV5A 3G2HA 3IXLA 5L3SA 5CYFA 4N5NA 3G6KA 3RV3A 3RU3A 2OYSA 5LM3A 1BSVA 4TSFA 4UHEA 2VBGA 3MQ2A 1W6RA 3MRTA 2X6RA 1HV8A 2QUHA 2QUIA 5CTAA 1G4UR 4UHDA 1ADYA 2BI8A 5IEBA 1HM5A 1ZGZA 3RYFB 1NYTA 3T3PB 1DAIA 1IEVA 2J9FB 2ZYVX 1CUVA 1G38A 2BBOA 3EEBA 4HDKA 2JAWA 3IDFA 5BNTA 5L4LA 3JVIA 1N2CE 1VB5A 3QW2A 3UAVA 4LY6A 4B5LA 5K4HA 3SVLA 3GBPA 2BMAA 2X0IA 4IZHA 1KYYA 2PU5A 1NKVA 4LOJA 3U3DA 5IPFA 4XH9B 3FMFA 3GRRA 3KQKA 4F5EA 2LXNA 3P19A 2HYDA 1GNSA 1BE6A 3DMTC 1XNGA 4NKRA 4EIWA 2XQKA 3IQHX 3PNVA 3JTMA 4FDAA 2FUG1 1ISSA 2G83A 4D4JA 5U4QA 3H9EO 1G6HA 1F0KA 3Q7IA 1RJWA 2ZUWA 5ALPA 5EHIA 3C87A 1GTVA 5J1TB 3SYNA 3WYFA 4W5QA 2JANA 5JEDA 3LC2O 3W5BA 1TK2A 4X84A 1EUYA 2X9LA 1HGXA 1U2TA 3BWVA 2WFLB 5AD1A 5C46F 1A77A 2B4YA 2RJNA 5JECA 1R8SA 4ABYA 4BVJA 4RCZA 3ISVA 4JMPA 4WQMA 3GJXC 5AJZA 3BN3A 3PB3A 4EKYA 3STUA 5I3ZA 1J49A 2CSXA 3I9KA 2CXSA 2ZUFA 3NC0C 3WAKA 1NW3A 2DUUA 4BNMA 5KINB 1YK0A 2OPHA 1PX0A 1KF0A 3K9HA 3JCZA 3NUZA 2GOYA 4G5OA 4Y6PA 4BO7A 2CV1A 1EK5A 2RCNA 4WD3A 1E7YA 1JIIA 1QPGA 2Y77A 1C3JA 3V46A 5IUNC 2W22A 4RMHA 4NOMA 4Z3OA 5JAPA 1HLGA 4CMHA 4E21A 1EESA 1F12A 3BXEA 4MQFA 1Z6XA 3W7AA 3BE5A 3CJRA 3GGSA 3OE4A 3FOAA 3O4IA 1E9AA 1NKSA 1SFRA 1QGZA 2RGAA 3MS4A 3PKZA 4I46A 3RVBA 2H18A 3DP9A 4ZVLA 1VE5A 5B55A 1JW9B 2ZIFA 2Z08A 3A4YA 3H2KA 3IJPA 2BM1A 2G08A 1ZGJA 1ULTA 2A9OA 1AKEA 3IMCA 2RJOA 3GD7A 1KYXA 3A2MA 2QG9A 1EXMA 1PEDA 3N0WA 1P33A 2WM2A 4OQPA 4PXAA 3V97A 4TTIA 1A98A 1Z2CA 2NU6B 4P81A 4HFMA 5CM2Z 4QASA 3PIRA 1Y7IA 3F1LA 2ATCA 2FQXA 4YDSA 1FK8A 1N2GA 5KVVA 3IP5A 4S3MA 3VAZA 4RC9A 1WMSA 3EDYA 3AETA 5E3IA 5I9IA 1MV8A 5ECYA 3FCEA 1PNRA 3D6JA 4WZAA 2VDVE 3PCRB 1BFKA 3EA0A 4Q7QA 4JLJA 2BM0A 3FHCB 5TQJA 1M7BA 1H94A 1XT6A 3HJCA 2XRZA 2JGJA 4J1QA 3DR3A 5EP1A 3ZV6A 4OFXA 1K89A 1KVTA 1XXHA 1ZHFA 2P4QA 3R3JA 2X58A 4HLUA 4NBTA 4BE4A 5HZGA 1GSIA 3TBFA 3VR4H 1R9MA 1VHWA 1W59A 3OECA 3RVDA 3TXAA 5IC6A 3HB5X 4YAFA 3HY6A 4REQB 4FT2A 5DEOA 3D59A 4QA9A 5EIWA 3UT0A 5BUZA 1HBJA 4YLYA 5AKHA 3UK7A 1BWPA 3GO4A 4DJFC 1C3XA 3HR7A 5B6IA 5NLLA 1ZI8A 1SD1A 1UWLA 5JAUA 2DHRA 4Y8VA 1T25A 1Z88A 4FYHA 4MKFA 2PMEA 3WS7A 3K92A 1AO3A 5L3QA 3R7SA 1SVKA 4TS1A 4D96A 1EHIA 2W83A 5GM1A 4BN5A 3DE7X 3KB2A 3D81A 4H7JA 4PNPA 3GRUA 4BVLA 1Z75A 2I3ZA 2L18A 2DC1A 2G40A 5EWJB 1TD9A 4EB0A 3AQIA 3BFJA 3N2KA 4KV9A 1DUSA 2ZSDA 4G1VA 5ALRA 3T5DA 3UK2A 5EE0A 3JQDA 5EE9A 2CLEB 1YS1X 3B9PA 3PFGA 2HMAA 2VP6A 3PENA 4IS3A 2XNSA 2XTAA 2O2SA 6GPBA 1A5BB 3K05A 2I3GA 4R7ZA 3T5GA 4CKBB