2NZUG

Structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
275
structure length
275
Chain Sequence
b'KKTTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite control protein
molecule tags Transcription
source organism Bacillus megaterium
publication title Structural Mechanism for the Fine-tuning of CcpA Function by The Small Molecule Effectors Glucose 6-Phosphate and Fructose 1,6-Bisphosphate.
pubmed doi rcsb
total genus 99
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2006-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nzuG01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nzuG02
2GWRA 2FSPA 3KYJB 3N0XA 5E3JA 4XARA 1BDIA 3MQ4A 4WWHA 3KS9A 1BVHA 4Z0NA 1USKA 3GV0A 3F7NA 1VLZA 4W5QA 4O5AA 1KRWA 3TB6A 3HV2A 1MB3A 2CHEA 3QLUC 3HM9A 1ABFA 3RVPA 3JTEA 3EDCA 4JA2A 4G0QA 1Z26A 4YGXB 1JYFA 3T6KA 1ZH2A 1D2AA 2BGGA 2JVIA 3N6VA 5TQ0B 3JVDA 5TPZA 2M98A 1JLKA 2R4QA 2LBPA 3A0UA 5HM6A 4WXMA 1RXEA 2X7XA 5FWYB 2FLKA 3MYYA 5C5CA 3UK0A 4H3KB 1M2EA 3O1IC 4RU1A 5EWJB 2KYRA 1USIA 3C3MA 5B3JC 1TLFA 3HXMA 5C5EA 4PICA 3KLOA 1Z16A 4NCBA 4MPTA 5JNVA 1ABEA 4ZPJA 1FQWA 4DADA 4FE4A 2OQRA 3B2NA 4MS3B 4MQEA 2PLNA 1URPA 4WUTA 2CD7A 2HSGA 2FMHA 3K9CA 2P4UA 3UKJA 2FTKE 3CHYA 4ETNA 4KREA 4GNRA 4MAAA 4Z9AA 4KQCA 4LDAA 2NT3A 1GCGA 1H9CA 2FKAA 2PL9A 2LPMA 1LK0A 3CS3A 4MGEA 3Q7RA 3OQOA 3EAFA 3BRQA 5FBHA 5ABPA 1QP7A 3TO5A 4JOQA 2AYXA 9ABPA 3H1GA 4G86A 1QP4A 1NXSA 3HSYA 3LUJA 3O21A 4Z4CA 3FFTA 3IP9A 3FDFA 5B3JA 3RVKA 2L18A 4F3TA 3HDVA 3VNAA 2MYNA 2W42A 5DLEA 1EWKA 3JY6A 4MR7B 1ZESA 1JX6A 1PNRA 4TN5A 1DZ3A 4KNYA 3IPAA 1W25A 4N76A 5IC5A 3DGFC 1GUDA 4GPAA 3E61A 2E4WA 4S05A 4D6XA 1QQBA 2RJOA 1DBWA 1VKRA 4P98A 1Z2EA 1QP0A 4Z4GA 2R25B 1U8TA 1Z17A 2CHFA 3NHZA 2JB9A 5EWMA 4OLAA 2PMCA 4ETMA 4YO7A 3GWGA 3QLTA 1QO0D 4KFCA 3ROFA 5BQ3A 4F12A 4Q6WA 3H6HA 2QR3A 2IPLA 3H5IA 1Z12A 5EWLB 3OQMA 1YVUA 5CNMA 1E6MA 2FN8A 3EQ2A 2LUOA 3LMKA 2RGYA 4N0QA 3QEKA 2FEPA 4YP9A 5IULC 3RVJA 3HCWA 3O2JA 2FMFA 3MF4A 3RVRA 1OXKB 4G97A 4G0ZA 4TLLB 4XFKA 4H3HB 4MS1B 1P6UA 4KPYA 5IUJC 2FEKA 4JB0A 2JVJA 2WRZA 3QLVA 4OTZA 1QPZA 1D1QA 3IP7A 1XHEA 4W5RA 4RK1A 4MR7A 1EFAA 1PEYA 2L17A 1CEYA 1TM2A 3LTEA 4MQFA 4EVQA 4RZSA 3TX6A 1C0EA 2M1ZA 5KWSA 1S8NA 1LJLA 3KTOA 1BDHA 3H6GA 2QU7A 3LKVA 1TMYA 3CNBA 3LUFA 5TQ0A 1JFTA 4Z4IA 3NNSA 1P6QA 5T7BA 1USGA 3I5AA 4KVFA 4IILA 3CU5A 5FWYA 4NICA 1JFVA 5KQLA 2IPNA 1Z25A 1B00A 4RK7A 3EGCA 6ABPA 5HSGA 1L5YA 5EWLA 1C4WA 3N8IA 1BAPA 3OO0A 1YK0A 3LUHA 4D74A 4N47A 1JWLA 1RZRD 1P8AA 4LDZA 4QICA 5IX8A 1QQAA 3L6UA 4ETIA 3HUTA 6CHYA 3C3WA 2PUDA 3N0RA 3OQNA 3D02A 1GCAA 3OLXA 1A2OA 2FW0A 3Q15C 3FFXA 1RXIA 4MS1A 1A04A 1VPWA 1R8JA 1YMUA 2YHBA 1Z18A 2ID7A 5JS2A 4Z4HA 3QEMA 3FGZA 4YR7A 4LE1A 2HQRA 2FEWB 1DCFA 1DRJA 2AYZA 5T3YA 3H5VA 2WY2D 1BA2A 2FLWA 4QYMA 5CNIA 3ILHA 1VRVA 3Q41A 1AB5A 4NQRA 5HQJA 1EAYA 1E6KA 2JBAA 4Q6BA 4LE2A 4WT7A 5IEBA 4YV7A 1ISSA 3OLVA 3G85A 1D5WA 2E4UA 4EYKA 1U2QA 3TD9A 1E6LA 5GQSA 1F51E 1EWVA 3LUCA 1NATA 2CWDA 5PNTA 4F06A 1BDJA 4DQDA 3D8UA 4MRMA 1NXOA 2FMIA 5KI6A 4RDCA 3C6QA 2PUFA 3NHMA 1FSPA 1JBEA 2RDMA 1JH9A 2IPMA 4LRQA 4OLBA 4TLMB 1DBQA 2E4YA 3KCNA 2IPAB 2JCGA 2PUCA 1MVOA 1LBHA 5EWMB 4MS4B 2QSJA 3Q7SA 3SY8A 1DCKA 4UHKA 2HQOA 3ILYA 3JS5A 3O2SB 2ZWMA 4O1IA 4YS6A 4EVSA 1MB0A 3R0JA 4LE0A 5DCLA 4Z99A 2A9PA 3H5OA 3M6MD 1PEAA 3L49A 1U0SY 4G0YA 3QEMB 1U04A 4MLDA 2P9HA 1DC8A 4PYRA 4W5TA 3DLBA 4Z4FA 1JFSA 2B1JA 2E4ZA 2Q5CA 3EULA 4XAQA 2IDMA 4EYOA 3Q9SA 1PUXA 3O1HB 3OMXA 5CNKA 1FFSA 3URMA 4MLCA 3RVSA 3LUDA 1PHRA 4RXUA 2L19A 3T38A 3MA0A 3DLHA 2B4AA 4RK4A 5CHYA 1NXWA 1K68A 3TMYA 3S99A 4XASA 1ZDMA 5DTEA 2GX6A 1SRRA 3JPWA 3QELA 3ROTA 3EQZA 1JYEA 1J56A 1ZHHA 2FVYA 1CYEA 2E4XA 4IGAA 1KGSA 3C3KA 1QKKA 4PE5B 4LX8A 1MAVA 1ZITA 1NTRA 1SXIA 4MQFB 5KC8A 1CHNA 3OM0A 2A9QA 3RVNA 3BRSA 1JDPA 3LUGA 2GBPA 2QV0A 3LUAA 3MIZA 1AB6A 1Z15A 1ZGGA 2A9RA 2NZUG 1M2FA 2XDYA 3CTPA 4RV5A 4F11A 5I4CA 5HKOA 3O1JC 2FN9A 4N0PA 2F8TA 5JS1A 3E3MA 4MYRA 3I09A 3OM1A 4YWHA 3NBMA 1TJYA 2VYCA 4PZ0A 5IEJA 1ZN2A 5BR1A 4RK0A 3MMNA 1NXPA 1Z13A 4DN6A 1W9HA 2WB4A 3M9WA 4EGSA 4RWEA 1DBPA 1FFGA 2NT4A 2PUAA 2H3HA 5FBKA 1QO0A 2ID9A 3SAJA 4XXHA 3RVLA 1YS7A 4KQ9A 4RK5A 4YCSA 3HEBA 2VK2A 2OENG 4H60A 2JVKA 3SNKA 4IMJB 5GOTA 4OBBA 5BRAA 3HO1A 3GT7A 1YK1A 3CRNA 1DG9A 4RY8A 3FFWA 4FB4A 2PUGA 3CG0A 2YHAA 2GKGA 2FQXA 4RKQA 4RXTA 3QELB 2IOYA 3QX8A 4EUKA 2FQWA 2ZAYA 4L4UA 3UUGA 5FWXB 1DCMA 3CLKA 3KYIB 1U2PA 1RNLA 4JB2A 5IUKC 3RQIA 4YRZA 3O2QB 3N0WA 2MYTA 3DBIA 3RVOA 3GRCA 2R47A 3GYBA 2MSWA 3HS3A 4RY9A 2FXIA 3EJWA 2WJWA 2JBAB 3HZHA 8ABPA 5JNTA 2PL1A 4ZMSA 3OMWA 3QX9A 2V0NA 3KKEA 1JL3A 3LUKA 3DGEC 4M88A 1YMVA 1OXBB 3CFYA 4ZYLA 1YTUA 1D4ZA 4RSMA 4YLEA 2NZVG 4N41A 3T95A 3HK2A 4MRMB 3OLWA 4MR9B 1LJUA 4G0PA 2HQBA 4B09A 3RVQA 2HJ9A 1Y1LA 3CZCA 2PKXA 3LFTA 5TE9A 2WMYA 3IDOA 1Z2DA 4E7PA 2WWVD 4NCAA 3EODA 5TPWA 1M5TA 5KC9A 4ML3A 2O20A 3P9YA 2I6FA 4KV7A 2QVCA 4S04A 5JNWA 5BRJA 1WETA 2TMYA 5TQ2A 2H0AA 3QLUA 4HYEA 4MS4A 4JP1A 4JAVC 1SXHA 3KSMA 5DGCA 3A0RB 3JPYA 3T8YA 5KQGA 1DC7A 1LBIA 4EYGA 2IYNA 3IP6A 4IF4A 3HJFA 3O75A 4JASB 1KRXA 1HEYA 4MR8A 1JDNA 1GLGA 2MYPA 1NXXA 3QK7A 3SM9A 2FMKA 2QW1A 4Z4EA 1DRKA 4L85A 5FWXA 1APBA 3I45A 3IPCA 3HVRA 1MIHA 1ZY2A 2PJUA 2QVGA 3VNBA 1RZRA 4F8JA 2PUEA 1F4VA 2L2QA 4WXEA 5ED4A 4RK6A 2J48A 1JF8A 4P1ZA 3DZDA 2HPHA 3KG2A 1T34A 4O1HA 5TQJA 3F73A 5IUNC 4UHJA 2VUHB 3KLNA 4EY3A 4ZMRA 1ZAYA 1D1PA 4QYWA 1ZGZA 4NV3A 5EWJA 4RKRA 4MR9A 2NUBA 5JNRA 1L5ZA 1ZH4A 3BREA 4ZJPA 4EVRA 3LOPA 2QZJA 4N03A 3IP5A 2RJNA 2PE5A 2GI4A 3H5LA 3H75A 4KMRA 4MQEB 3F6CA 1ISRA 3GA5A 3N75A 3W9SA 4Z9BA 1XHFA 3GL9A 5IBQA 5TQ2B 2MSKA 1NY5A 2IKSA 3QLVC 4Y9TA 3OLZA 3H1FA 3K4HA 3NNDA 1EHCA 3H5WA 5TPZD 1YS6A 4KK4A 2E4VA 1RPJA 2LP4Y 3FMVA 4MR8B 3I42A 4IMIB 3H1EA 1A0OA 4KRFA 4Q7EA 1XWWA 1YIOA 2JRLA 4OG2A 2LIVA 3SG0A 3BILA 1IIBA 4E7OA 2WJAA 1GUBA 4RS3A 1EWTA 2VUIB 3A3KA 2DRIA 4G0OA 2PUBA 3OO1A 1P2FA 1DJMA 3LKBA 4G0MA 2F8SA 4G0XA 2R48A 1SD5A 5DKFA 4HNRA 5KQMA 5JNSA 2N9UA 4FE7A 3KJXA 4LZLA 3RH0A 3O74A 1UDRA 4CBVA 1PNTA 3BBLA 4PEVA 4RXMA 1FFWA 4XLTA 3M9XA 1SXGA 4KK3A 2A9OA 1M5UA 3F6PA 3NNNA 4IRXA 1ZVVA 2QXYA 1I3CA 2JK1A 3OLYA 4RY0A 4KZKA 5KQPA 4W5NA 2PAFA 1JHZA 3MM4A 2MYUA 3JVIA 4HNQA 4EYQA 3HDGA 3A10A 5CNJA 3Q7TA 5JNUA 3G1WA 1NXVA 4WZZA 1DP4A 4TMYA 2FQYA 1QNLA 4D6YA 3CG4A 3GBPA 3HUUA 5F64A 4QPJC 3GBVA 1K66A 3SQNA 4OATA 1QMPA 3H5TA 5D2CA 4MS3A 3RVMA 7ABPA 1KMIY 4W5OA 3CZ5A 5TPWB 3KHTA 1TVMA 3C97A 3N53A 4HNSA 1E2BA 3CKMA 1NXTA 2MSLA
chains in the Genus database with same CATH superfamily
1Z4PX 4MINA 4CQMB 4PC3A 1SZJG 5C2JB 2X3YA 3IVXA 2I3BA 4P58A 1V5GA 1AQLA 1FNCA 3M6IA 4O2AF 1XTJA 4R8MA 2ID8A 2JFHA 1EGVB 3AYXB 4RVGA 4Y0AA 5P8WA 1GTJ1 1A4IA 3SEFA 2KWIA 3CB2A 4RMJA 4E2XA 4ZDIA 2NTEA 4KU4A 2X0JA 1ZHOA 5D5QA 1OD6A 4JBXA 3SJBA 3IAUA 2IYXA 4R9VA 1G21A 1CQXA 5ICSA 1TUBB 1QANA 5GMOA 4WA8A 4PN7A 2JVIA 3AF6A 2YS7A 2AQHA 2ONJA 3VR6A 4OY3A 2KE5A 3THWA 1BCSA 2P0EA 2WHRA 3ASZA 1I5RA 1EM8B 3AEXA 3LL4A 5EMKA 5FWYB 3TPCA 1KR2A 3GNTA 4BJ6A 2XYGA 1LI5A 4DQXA 1RQLA 3WLAA 3EXG1 3SLRA 2OXCA 3NWEA 3M83A 1TE2A 5F5LA 3ANSA 1SURA 1CBUA 4TVBA 3TIFA 5BN4A 1RJFA 5TMEA 5KMGA 1A77A 3ICOA 3KEGA 5IW8A 2QZ4A 1Z3CA 1M2JA 1QHSA 3A6HA 4AKHA 2DLCX 4MV6A 2RHGB 4NABA 2CLHB 3R8XA 1A8PA 2NSDA 1N3YA 2B34A 2B2XA 2P4UA 1HYBA 2XRMA 3IAS6 5FADA 1TI7A 1ZINA 2XTJA 4CU2A 3U60B 1HSZA 4LTMA 3QUTA 3VO9A 4N0DA 4WV3A 2O2HA 2ZTLA 5C51B 1D4OA 1F8FA 3CS3A 1AIPA 1KZ7B 2OM2A 2QUAA 2WJHA 4HR7A 2R8EA 4PX9A 4QDUA 3SZOA 1JB9A 1P72A 4W1RA 1E9FA 1MQAA 2OCLA 1ADFA 1UK7A 2JKZA 2R8BA 3CUYA 4Y1RA 5D51S 3JCZA 5A3RA 2I78A 4IWNA 4MVJA 1QP4A 3MMPA 3WGGA 3EXIA 5CFNA 3F97A 1U2TA 3MCTA 3LUJA 1KFBB 5BW6B 2C83A 3NAZA 3EFEA 2ZIZA 4PXAA 5HKBA 5JS6A 1EFRA 2JGRA 3CNHA 4PWZA 1DQZA 1NWHA 1I6LA 1CUCA 1TUBA 2RH8A 3GI1A 5DNAA 2AZXA 5KYXA 3FW1A 1LBQA 4HDSB 1GTZA 2EDAA 3DJYA 5YASA 5CXUA 2W42A 4I4IA 2VAPA 1Q74A 4DMRA 4Z1OA 1CRZA 1EUDB 2DMRA 1QE5A 1PFQA 2GRJA 1Q22A 3GAAA 3O8OA 4TRNA 3AM3A 3TRIA 4F4FA 1AHHA 1RU3A 1Y0BA 3E61A 3DAPA 4P83A 4TT8A 2YNMA 2H65A 3J81k 3EGXB 3H3FA 1E9AA 1I5EA 3DP9A 5J58A 1QZ3A 4KGDA 5B3KA 1QFXA 1T8RA 1ADYA 1R5OA 2UXDB 1GNPA 4QFBA 3UIEA 2G7MC 1TW2A 2X3FA 1CY4A 2P2ZA 1PW5A 2N42A 1LA2A 4P8RA 4F12A 5BQ3A 2F9LA 3HLYA 4PHGA 3U4AA 1XQ9A 2XKJE 4BATA 5I9LA 4IDQA 2QG6A 1KEEB 3EPKA 1K8XB 5FPPA 1U1IA 4RORA 3PFCA 2DFKB 3I0NA 1HY3A 1D4FA 3DEZA 2P8SA 2ZATA 1P2GA 3BCSA 2NO9A 5IAJA 3W5SA 3ZR4B 3ZS9A 4G9GA 3FWZA 3CJRA 3L0SA 4GR4A 1NW9B 4K88A 4KW7A 5BSWA 4XQ0A 2CW5A 2IYQA 4DAOA 1AV7A 3OPYB 5FF9A 3HXQA 3FF4A 1AY0A 2C2ZA 2JD2A 4P2GA 1D9XA 5JE8A 3T41A 2YFYA 5KS2A 3GLHA 3TIVA 2IS6A 1ONBA 2DG2A 2I2AA 3F6BX 5L3SB 3DOOA 3PKJA 4IVNA 3I9JA 2QSYA 4RK1A 3PXGA 1DEKA 5BSRA 1ZMRA 2EBUA 1T8TA 3B85A 4QGHA 3P2MA 3J80A 2HRZA 1AKQA 1PL0A 3HWSA 3OX3A 5DASA 1V5EA 2KLBA 5K7SA 2PRJA 4ER5A 1SU7A 3V7UA 3B6IA 3TLZA 2AR7A 1GQOA 2BRUA 4IIVA 4QPCA 4Q9IA 4E15A 3BF7A 1ETUA 1BA3A 3K0EA 3H2YA 2VPIA 3NOVA 1KZGB 4D79A 5CFLA 5CK4A 1G64A 1NN5A 3O7MA 3D43A 3ZNQA 4JN6B 1SWVA 4ARBA 5ALWA 1S4MA 3EG5A 5SY6A 1USGA 2R751 1Y6QA 3RIGA 4DQUA 1NOIA 1HR0B 1T3GA 2ZG6A 3DMHA 5CDFE 2P9ZA 4UVDA 1JFVA 2QXUA 5KQLA 1SH7A 2QSUA 4TXLA 5DP2A 1RSZA 1P9LA 1SCJA 2C2XA 4IX1A 1GD1O 5FI1B 5TF0A 4P08A 2D1QA 1VE7A 2QOEA 1DC5A 4QIHA 1H22A 2ZM5A 4W8GA 5MN4A 3JWGA 3W1VA 1ZRSA 1BS9A 1JWLA 1JG3A 1KY2A 2VSFA 3FVQA 3OE7D 4LDZA 4LVCA 3U7GA 1LDBA 1JIIA 2AFHB 2WM3A 4U1RA 4WINA 1JPVA 2XUAA 1VIDA 3GEMA 1VIMA 1RRFA 5JZMA 3OLXA 4BLVA 1RXIA 3LX8A 3V46A 2J5RA 2A33A 3BSWA 1VMAA 4L4YA 3D8HA 4O4HF 3SQLA 3WGLA 4RQTA 3ZYZA 4O2BA 1U0OC 2Z08A 4RCZA 3STUA 2Q1TA 4H6XA 5IZCC 2G07A 4N3BA 4RD6A 5CIQA 5L3SA 2DXIA 4KJXA 4ZOAA 5C8ZA 5AOBA 2FEWB 3TOVA 4JQOA 3CNEA 2FW7A 3W7VA 1CZUA 3RANA 1QKJA 3TUJC 3GGCA 1BJTA 1X2EA 1QJ4A 1XZQA 2R7KA 1BGWA 1GWNA 2GBFA 4CMCA 4L07A 4O8ZA 3K9HA 5KJ6A 1HQKA 3ZHRA 1CS4C 4G5HA 2C8JA 2JBAA 4MYHA 1NVVQ 4WT7A 1T13A 4C6SA 3TF5A 4K9MA 4BQEA 1PTKA 4LC1A 4W63A 4Y1GA 4ZREA 1MPTA 5EC8A 3LUCA 4BXOA 4MXDA 5PNTA 5JC1A 3MBKA 3FAKA 5FR1A 5CYFA 3DFIA 2NGRA 3RF7A 4PNZA 3ZHXA 2XADA 5BR8B 1PVVA 4NK4A 1ZKDA 1JBEA 1KAGA 1KI9A 1Q50A 2JZNA 2W2XA 2XA2A 4EB8A 3WHLA 2BCEA 1BVRA 4C87A 3MWYW 2AZ4A 5C1OA 1KYTA 3AI3A 1K2WA 2JCGA 5E3IA 1O6ZA 5AVOA 2E85A 3PE4A 2D6FA 2PKEA 4HQKA 4R84A 1WCWA 4UD6A 3DCNA 4OJMX 2XEXA 3WNDA 4BQFA 5GZ3A 2FF7A 3ZPXA 1YWGO 1DHTA 1KS2A 3JAKA 3L7JA 4L78A 3JD2A 4LS3A 2VHCA 2P4HX 2OXTA 4IX9A 1NOKA 5F7OA 1PW7A 3KB6A 2O14A 3T34A 1TYCA 3E35A 3QVKA 2H2GA 1DEOA 3MT8A 4V0OA 2H6EA 4UZEA 4MCAA 5AK5A 4NG4A 1Q1BA 4PAWA 1ISJA 1U0NA 3G2OA 3L9XA 5EKTA 4D6PA 5C32A 4TQAA 2CJYA 3V4PB 2Y1WA 3LYLA 4EYOA 2WVAA 5FAKA 1Q17A 4FGUA 1DQNA 4I46A 4TGLA 2HCBA 4WZAB 4DJ5X 4ENVA 1N2CA 1RRCA 3Q40A 2DR2A 4MPJA 1GRCA 3VSEA 4XEUA 1M7BA 4FQ5A 2Y92A 3O4IA 3OEEA 4IWXA 3OVMA 1U0BB 4RK4A 2J4DA 2X6QA 5HZKA 5ALZA 4GRDA 2G76A 2DUWA 1U81A 1HFKA 4JBHA 5BYAA 4DV6B 4OM7A 4PZ9A 1RIFA 4L76A 1PR1A 1WMBA 4G1MB 3S0JA 1FRFS 4ZARA 1FMCA 2D0OB 2NUPA 3L07A 4J9UE 1Q6YA 2W4MA 3EE6A 2V6MA 1JDPA 2OE2A 2DOKA 2PZLA 1QOQB 2NO1A 1P0QA 3E2MA 4MICA 1ZMTA 4XVRA 3RG8A 5IU6A 3L0YA 2ECKA 1EJ6A 3ADKA 3KKMA 2OZLA 1ONNA 5HKOA 1N2HA 1WUYA 2H1FA 2R5FA 1FNNA 1O8CA 1Z4NA 2YDXA 1WY7A 3CW8X 5CVDA 3T3PB 1G8KA 1NVDA 1ZCAA 2A3NA 1Z8DA 4GG1A 4TSKA 4V0NA 4XE5A 2JZOA 4PYQA 3OOSA 4HNVA 2RE8A 4MIKA 1HLFA 3ZI4A 2HO4A 3PR2B 4TTTS 3EAGA 3MOSA 1HDXA 1RM4A 1R8YA 2WPDA 3ZV5A 3ID6C 1QIJA 2NU9A 1EVYA 2ID9A 3I53A 4TMXA 2ECOA 3ZGNA 1FFYA 3DC2A 1ZHFA 4DA0A 1RTKA 2VK2A 3OICA 4OB7A 3LQRA 1R6DA 2ZR9A 2JVKA 3IEIA 4NEHB 2PG3A 1UK8A 3GT4A 2DAPA 3PGMA 2OKGA 1IU9A 1YOVB 1OW3B 3OIVA 4G89A 4KDFA 1NWCA 4XCVA 2Z1MA 5COBA 4P35A 1VG1A 1V96A 3VKHA 1YQ9A 3FPLA 4TWBA 1RAAA 2ILTA 3G9TA 4BRSA 4EH1A 4ZJUA 2PGJA 1EFDN 1EMDA 2FOIA 2FQWA 2W22A 2HJWA 4KI0A 3T3HA 3VKWA 2VJKA 3DOUA 1W48A 1LPOA 3P9SA 3N0WA 2QS9A 5DRYA 3TQCA 2Q6KA 3R9WA 4YAUA 2MYTA 1HX7A 2QVXX 3WGUA 1ADJA 4RY9A 3NG1A 4QUBA 2EXXA 4RF5A 4MGHA 3ZK7A 4C88A 2FSUA 4P7BA 8ABPA 3AFIA 3TR5A 1U2EA 3A4NA 1Y4SA 4XX1A 2RHWA 3MOIA 5EA2A 5HRCA 1NMXA 1SUPA 4NJOA 1SZDA 1M8KA 4UEOA 5LLSA 1DIGA 1Q20A 3W3AH 4C3VA 1YTUA 4YLEA 4ROSA 1WLSA 5HGXA 4AQDA 2AN1A 1S9HA 4D4IA 1MNAA 3WFIA 2HC9A 3BGOS 4X71A 4YC7A 5ALYA 4DMFA 3D4OA 4ERXA 2CV2A 4Z2YA 2B5VA 1LY1A 2WMYA 3EVNA 3HJHA 3JYQA 3MWLA 4BJHB 3N8KA 1J8YF 1N3IA 3L4EA 2B78A 3P9CA 5TPWA 4B80A 3RFUA 5KC9A 1ZN7A 1EX6A 3LUBA 1ZLXA 4L6CA 2GM5A 1IM2A 2G25A 3W4KA 5IF3A 1SVUA 2YZNA 1WETA 7REQB 2VBFA 2WSIA 4J7UA 1GRQA 4EHLA 4G8JA 5COQA 5J2TA 2P27A 4ZYUA 1ZJ6A 1LBIA 4IF4A 1P1KA 4S1OA 3JYPA 1AD2A 1YA8A 2ENUA 3GFQA 1JRLA 1RLOA 4NAUA 1E3MA 2GPTA 1UMBA 4HADA 1VKNA 3K6RA 3QK7A 2ERYA 3P2KA 5FKJA 4EKIA 2QN3A 3P4YA 1POWA 1GQ2A 2VHXA 4MAMA 1GPUA 2EARA 1RI1A 3AVPA 3B70A 4BP8A 3HJUA 1PEKE 3IODA 5K0NA 4F8JA 1MO4A 3BD9A 1FQOA 2H08A 5FLXA 5DGIA 2OY0A 4PC7A 4UHJA 1OAOC 2N46A 2O0HA 2XNKA 1N4AA 3BF8A 4GX5A 5E2BA 2FR8A 3O47A 4MW2A 1ZUNA 3F7TA 1KWGA 1ZGZA 2V4UA 4CIWA 3MN1A 2NUBA 2PGDA 4BVBA 3BREA 1QCDA 2DUUA 1LH0A 4JEMA 3PA6A 1UKBA 2GZ1A 3FCSB 3KTAB 1NTOA 1UF9A 4NE7A 2C9OA 1FZQA 1VMDA 1WPGA 2HZ7A 1UC9A 3CRW1 3G8DA 3H75A 3I8SA 3EEYA 5GONA 4DLYA 1OYYA 4MWOA 3W9SA 2DLDA 5DM70 3V2UA 3M2TA 1M2OB 2YV4A 5JADA 1J90A 3EPRA 7REQA 4PYKA 3FJ1A 1TA4A 3WXMA 4DPLA 1KVTA 5L7TA 5ES3A 4DCSA 1VKHA 2I6QA 4S3MA 3UHFA 1W0CA 4YRSA 2VXOA 1P1RA 1YRAA 3B9RA 3M5DA 3TQTA 2YIDA 5T4HA 2X9LA 4YRQA 4LZAA 1E1NA 2K7ZA 3VUEA 5BWOA 1AQUA 2PQ0A 2Q45A 1HYGA 3OTWA 5CXSA 3WBFA 4UE2A 1AQIA 2FPSA 3B6ZA 1Q7CA 4EOGA 1FU7A 4EG0A 5ICGA 4QO8A 1RWQA 1PG0A 1I32A 5F1OA 4JI2B 1YR2A 2IZOA 3CZQA 1EGAA 2X0KA 3JQ9C 5DTIA 3M81A 1C2YA 4R1PA 4XLLA 4YR9A 2WIBA 4BGVA 4RS3A 1W4RA 3QIVA 1V45E 1QOZA 2I2XB 3REFA 2IH5A 3U0VA 1FJGB 1ISHA 1NV8A 4N5DA 4Z3DA 2OHXA 4MV8A 3MELA 4EY7A 1ECPA 1LF5A 3CUVA 3OECA 4MGZR 4J2HA 1Z8FA 4A1OA 4EZBA 1U6JA 4YIHA 16PKA 2G5PA 5IBPA 3AJAA 3H2JA 1BDBA 4EIWA 1AKUA 1UPXA 4G5SA 5IM4F 2QQFA 2WAAA 3FRIA 4II3A 3U3DA 4JH0A 4HNTA 1RJDA 1XJQA 2J3JA 2V9ZA 4EDFA 2R8PA 3L0ZA 4LQCA 4NFHA 5LR6A 2EZ8A 3GFGA 4ZOEA 1F12A 1SIOA 3E9MA 1DQYA 1M5UA 4JQSA 4ONEA 3ZWOA 2VJLA 5FIUA 2NOAA 3GELA 1JDUA 3OLYA 2W2KB 1PR9A 1SKYE 4KZKA 4W5NA 3MM4A 2PWZA 4FGLA 3DLPX 3PX2A 5D6NA 2OEPA 4GR9A 5IARA 1AOXA 4G5RA 4XGRA 3STWA 4D6YA 3CG4A 5CT6A 3I01M 5DNCA 1CUEA 5EIAA 3KQLA 3FLAA 3EZ6A 3H9EO 1KOFA 2IC5A 3MBOA 4IV0A 4OATA 4R7ZA 3W2GA 5EFOA 4F97A 1M6VB 1RTTA 3K94A 1M0SA 3IKLA 3C97A 4INOA 5DTQA 1XX6A 4GQAA 1XRRA 2WFLB 1N8SA 3EG9A 2FPPA 3QE2A 2GTPA 4NH0A 3OPYA 1R4AA 4RJKA 1E2BA 4W5QA 3KWJA 4JJ7A 4KKVA 1MAAA 1LFAA 1E7SA 2V55B 2V3VA 4HNHA 2HJSA 4IDBA 5LA6B 2IYUA 4JYMA 3BRWD 3C8MA 1NFQA 3MQ4A 3SBXA 4AP5A 2AOWA 2RKOA 4GYJA 4RA9A 2WA1A 1USKA 4WZAE 1VL0A 2R6GA 4KWCA 1D7OA 5EIOA 5IBCA 3ORSA 4GKJB 3HV2A 3OPVA 4CL8A 4V1CA 2VHTA 4CDGA 4P0PB 4F5DA 5DGDA 5MGBA 4OMCA 3A37A 3CLTC 3UVEA 1L4UA 2HF2A 2IQIA 1YRQA 3KUXA 4PLHA 1ZH2A 3RF6A 4OI1A 1LBSA 3UB3A 4B6OA 1GT91 2BGGA 4J90A 4BO7A 2FN4A 2H1CA 1IXZA 4WLOA 4EFLA 3BT7A 1RJ9B 7MHTA 1EHYA 2AFIA 4LIPD 1DINA 3KD3A 4WNCA 2LBPA 3G8AA 1CNFA 1NJ1A 4OH1A 1I1NA 4X0EA 4EB3A 2RI0A 4BNKA 4B48A 5SY9A 3DBVO 3M49A 3I37X 5A3SA 4LRWA 3DPUA 1TF7A 1FQWA 1CR6A 2C8LA 4G4IA 4NCKA 4Q9DA 1MX9A 3DEFA 4YP6A 4M9UA 1FRVA 3W8RA 1HL7A 1NU8A 1DJNA 1B0UA 3F3KA 2AG1A 1DG1G 1SUAA 1KL7A 2FWIA 3DLAA 4F4UA 1P0CA 1I2AA 2RGEA 4H7HA 4DTCA 5CPBA 2WLSA 2PRSA 2JAUA 2K6GA 3FCYA 3DZCA 4BNXA 5BMOA 1ZM3A 3C4JA 1OPRA 3GLGA 1BYIA 4J3NA 5F2EA 3EAFA 4Q00A 3IHLA 4Q3OA 1EM6A 4HEQA 4KLZA 4JLAA 2Q27A 5IJXA 4UZFA 3TRDA 4G07A 4WOJA 1DRWA 3I5MA 1CJMA 1Z0KA 4A26A 2ZITA 3A9SA 1SXJC 3HN2A 3M4ZA 2WU8A 2NUTA 4BVJA 4ZYWA 1G5QA 3ELWA 3FDFA 3KB1A 4PZPA 5G1OA 3F3YA 3HVUA 5KSOA 1QS0B 4C5CA 6REQA 1LQ2A 3FNQA 1CUJA 3UAOA 4RNDB 4B0OA 4P0QB 2R8ZA 1LK7A 3A4TA 3VU8A 3KQNA 4MA5A 1JB1A 1R37A 5JH7B 2RGGA 1Y4DE 2LRHA 2ZRNA 3TBFA 3ZJ5A 4OHOA 2CSUA 1KO4A 2GPNA 2VUUA 1DI0A 3W2IA 4CKCB 3P9NA 3T5GA 2I7CA 2IHTA 3E82A 2HIAA 1W73A 3GH3A 2CJFA 1TT7A 4IKPA 4UFOA 3RW9A 3LQ1A 3TE6A 4TYPA 4P98A 1FXWF 1T2FA 2ZCVA 3C7AA 5BT8A 2QQEA 3TNLA 1R16A 1QLHA 5AW9A 2VYVA 4JUDX 1C8VB 1IM5A 5FL7D 4DV5B 1U8FO 1WHTA 1CUUA 2GK4A 3HE3A 3HU3A 3N3BC 4PO8A 5BNZA 1T6XA 2GZAA 2JD0A 1ZBDA 4OJQA 2E87A 4ZAFA 3RNLA 1E2FA 5C46F 3TSCA 5KOIA 1FMJA 2I2CA 5DBEX 4W9NA 1NMYA 4KFUA 1DJOA 1G8YA 1O77A 5BV7A 5M34A 2W48A 4L5IA 3JQAD 5FV7A 1L5HB 1QTRA 2ZROA 3HPRA 4MYUA 2ATVA 4WZAA 4I4CA 3DL0A 3JZFA 3K53A 4FU0A 4KXQA 3WLOA 1REQA 5DU2A 4G97A 1O97D 1LX7A 1Q1QA 1T9KA 1UXOA 2QMOA 3DEIA 4Q3DA 4WVFA 4MS1B 2L82A 1P6UA 4LGCA 3VO8A 4P5PA 1ORDA 3L1IA 1IJFA 3ONDA 2FEKA 4JB0A 4XR9A 1KTIA 4U9HS 4Y9UA 3LWZA 5CD1A 3FSEA 1MIOB 3R6GA 5KOJB 2J0EA 3AR3A 2YV2A 4K3UA 4K9KA 5K4GA 1ZEMA 4JSTA 5A9SA 1AK2A 4H7FA 4HZUA 1EK1A 3FR7A 4PPNA 1XZAA 4XVHA 2RHLA 1GYRA 1DAIA 4NMLA 5HHTA 4JBYA 4QATA 3LBIA 4IFIA 3GNLA 2L69A 3PI6A 3KSRA 5AW2A 2V7WA 3ROKA 5IKEA 2XTNA 1Z82A 3INNA 3SLKA 2PH5A 3QP9A 3KXDA 3ZHOA 4AX4A 2UXBB 1E96A 1AS2A 3OZRA 4B8WA 4M9XA 4MYCA 4NICA 3E81A 5HIMA 1F38A 1X7DA 2ZQZA 1ADBA 1SHJA 1QCYA 1P1BA 5DMHA 1YIDA 3VU9B 4EG5A 5CXQA 5IF9A 1M2VA 1XTVA 2OQIA 4LDNA 3GEBA 1QZXA 3AR5A 2HEGA 3L4BA 1G6OA 2F90A 2XKAA 2JAXA 3N8IA 3WRXC 1GA1A 3H8WA 3ZEAA 1UZLA 5BN4B 3DE1X 5KMGB 2IBSA 3DTTA 2UYYA 3ECCA 3V34A 4TLDA 2AJ8A 3NM6B 4P4SB 1ZOLA 1F17A 4S12A 5FULA 1PJCA 3E2IA 1VBKA 1QAOA 3A6JA 3TLGB 1T2CA 3LC0A 4MVJP 2J33A 4GPD1 3MUOA 4Q01A 5K3SA 1EJ0A 2NV0A 1SO8A 3QEMA 4Z4HA 5L3QA 4LE1A 4M1WA 4MW4A 1IQ0A 4PZLA 3VQTA 4BL5A 5IDQA 5L40A 3ND8A 2IZ1A 3NWJA 4KE7A 2ZKLA 5D3ZA 5T3YA 2WY2D 3T9BA 5JBIA 5BT9A 1ZI8A 3TLYA 3ET5A 2YOGA 1XELA 5EQJB 2HHCA 3ILHA 1HKUA 1YNOA 1DGQA 5EJMA 2VDOB 3HYTA 1PL8A 1N9GB 2CLMB 3CKKA 4GX2A 5DW3A 4IM7A 5GV8A 4PSKA 5HQJA 2XIJA 5I47A 2IEDA 4Z5XA 4DB4A 4UBNA 3OLVA 4RD1A 3DD1A 4CQNA 4RL4A 3VR6H 1ZW1A 4RHFA 2XGOA 1KVQA 3CJQA 3KZXA 4S0ZA 1J5XA 3WZMA 4TMKA 4Q48A 2D2XA 3QY0A 1EXWA 3MJRA 3NRCA 2XITA 5J43A 2ZYTX 3VMFA 2CJXA 5B7PA 2EW1A 2GHIA 2WPDD 3AONB 3PEEA 1M6YA 1ZVQA 1Z73A 2YV1A 1JU9A 1CQIA 3FUXA 3IO3A 3SEZA 5JS8A 4NHEA 3FSRA 1T26A 1KYXA 1MVOA 1VXRA 4RACA 2A84A 5E95A 3T0GA 5GZ1A 1QSGA 4AMBA 4DM7A 3M1YA 1DHRA 3UC9A 3NWBA 4V3BA 2HWXA 3GJ0A 3I9V6 5BUQA 3O2SB 2ZWMA 4O1IA 3L41A 3VJMA 1MB0A 2QEQA 2O52A 3N2LA 1UL1X 3BWMA 3E7DA 5JLAA 1KFCB 2I87A 1UBHS 5EEGA 1QZTA 4BIIA 3R3WA 3SJAA 1WSAA 3GJ7A 1QG2A 2IXTA 4Z4FA 1U04A 2BGLA 3DFZA 2OGUA 3SKYA 1C7QA 2ZE6A 2GXAA 1RKQA 2IDMA 1KJ9A 2ATCA 3BEDA 3LHFA 2WFMA 4UTPA 4CKWA 1W0KA 1PUXA 3ZKAA 3C2QA 4R98A 1N0WA 3EXFB 3EZ9A 4GZ6A 1EVZA 1C1DB 3NV9A 2F3RA 3L3BA 4K9OA 4FZ3A 4RGYA 4CN8A 5CBPB 4ZI2A 1QU2A 1CKEA 4FFNA 2I91A 1V7ZA 3O82A 3RO7A 4DWJA 1V8DA 1UQUA 2EOAA 5HKLA 1OROA 3P9QA 1X8JA 3UJ6A 1J33A 3TECE 1FP4B 1W4BA 2MSNA 1JR3D 5CFQA 4OMUA 3ESZA 2Z09A 4XM2A 4AS1A 5DI3B 1QKKA 1P77A 1SBZA 2XA1A 3AO0B 3QYAA 2Z43A 4FYHA 4KBFA 4CCSA 4CG0A 1IMJA 2J5QA 3BH0A 1NTRA 3OE7A 4PZCA 4UQOA 4ZAXA 4OIMA 3ENVA 4KEAA 5F3DA 2W00A 5FHQA 3W77A 3WLRA 4FFOA 2ZYUX 4FUQA 4GLLA 1H6CA 5CB4A 4K9LA 1XF1A 3HZOA 1M2FA 4UPVA 1LKZA 3HCNA 4FQ7A 4R0VA 3MRXA 3OM8A 3H2ZA 1E1DA 5E2IA 2JH9A 5J2UF 2KM1A 3ORYA 2X42A 3SJUA 1MW8X 3JQGA 1L7OA 1E4YA 4F84A 2IOFK 5AKEA 1IPHA 1FRQA 1M2KA 1M2WA 1NI5A 1SBTA 2SKDA 4F4HA 2BEWB 5C31A 3L05A 3BJRA 3M9WA 3V8NA 3CSDA 2B94A 2UYGA 1XXLA 3CZMA 2GLUA 4QBKA 1QV6A 1CQJA 3HB4X 2HN9A 2MJLA 3MGGA 1KZ6A 2XD9A 1W46A 3N2NA 1KA9H 3E3AA 1I3MA 1IM8A 2X1VA 3QW4B 3TWOA 2BKXA 1PT8A 2QL7A 5CUQA 4RGVA 1R6TA 3PHGA 5L45A 1QIMA 5EQTA 3GP8A 4L0MA 4B7CA 3HP4A 3QBDA 4HDNA 2WUDA 3IBYA 4PLGA 4QPPA 2QUZA 4A73A 1E5VA 3ZDEA 2YCLA 1HV8A 3L01A 3MT9A 3MRVA 1OI2A 4QGGA 4OKNA 3HYLA 4GM4A 1HG1A 1AJEA 3EDMA 2LV8A 1XTKA 4MRNA 4KSYA 4DY6A 2XMGA 3G0CA 3OMWA 1KZ9A 2PYIA 5K51A 1F8YA 1PQYA 2YHSA 4MRPA 2W2VA 5HRAA 4HK4A 4ZI5A 1D4ZA 3F6EX 3GJYA 1GVNB 4OV6B 3RJMA 2IPOA 1KEWA 4MR9B 4YCLA 2X4GA 3RABA 4DNXA 4KIFA 4P4UA 4YRCA 2VCHA 2VSXA 4U6NA 2CFOA 2HWUA 4DQLA 1F8GA 2JEZA 3WYAA 3CQ9A 1HE5A 1SHLA 4JI4B 1NE7A 2OHIA 3JQ6A 4KV7A 4BO1A 1Y98A 2D0PB 5IVKA 2AUNA 2IEBA 4AZTA 1V3UA 3QIAA 2Q2NA 2GYYA 3OWXA 3CNOA 3UF0A 2DQKA 2O48X 3FJYA 5J4HA 3FUWA 2B7LA 3BXXA 4GL4A 4HVTA 4NHOA 5ARCA 2QTNA 2HF9A 1OREA 3H04A 4NAVA 5AKGA 1DWOA 4MULA 2GHRA 3B8EA 4F1WA 4RGQA 5C1BA 1X86B 4V02A 3PHHA 1RYFA 5TJ9A 3ZD7A 3PKIA 3ANXA 1M1XB 3EXHC 3VOSA 1YZFA 4MWEA 3VNBA 1YU6A 4X1YB 4UTVA 2J48A 1XYVA 2D1RA 4FE3A 1Y80A 3L8MA 1ZIOA 2PNJA 4WK6A 3W8NA 2NO7A 2HWYA 2Q6OA 3DO8A 1ZU5A 1BMDA 2HAEA 3X1XA 1NMQA 2XYHA 3HHEA 3KVOA 4RKFA 2ZR0A 3JVUA 3Q8MA 1JKIA 1JDTA 1Q95A 2O8VA 1YZQA 3PUJA 4NL4H 4DEXA 1F0PA 2J8ZA 2QD3A 2EFCB 2P5UA 4DG8A 2P62A 3AUKA 4GI7A 3NAMA 3GFVA 1OX5A 3LOPA 3HWRA 1WSWA 1W1WA 3QVLA 4QU9A 3TINA 4COOA 4D1YA 1EYZA 3LKZA 2X0NA 4UC0A 2AN4A 1ISRA 4G1UC 1SVNA 4M87A 5EHIA 3AOGA 3RBAA 1TAUA 4COKA 1OVGA 4EYSA 2OBYA 3II6X 4JVOA 3W6PA 5KTKA 2NYRA 4FSHA 1MOQA 2AKAB 1ZM4A 3E18A 2QI9C 3B82A 3K16A 4B79A 3DE2X 2OCKA 3QUSA 4FCWA 1FYFA 3QVOA 3REOA 3W9YA 2ZSHA 2VF5X 4Q39A 5KTMA 4KN8A 2GCOA 3F9CA 4AFNA 4GMXA 2LP4Y 5E6UB 5IKOA 2AFVA 3TAUA 1NOJA 4AUMA 2PVSA 2ZI3A 1YDEA 3GQVA 4US0R 4AUNA 4AAYA 1G66A 1T9CA 2VJDA 3CUEF 3PT5A 5JANA 5EUCA 1R2QA 5DTRA 3RRFA 1XP8A 4BV2A 4K6KA 1M10A 1KE2A 2H85A 3EC1A 2A0WA 3FDIA 1MLDA 1V11B 4IFTA 2J4CA 5G3YA 1AN0A 2VAVA 2C7PA 1SBQA 2N47A 2D2FA 2W7TA 3SG0A 4JT9A 5IYZA 2JHAA 5FBRB 1YIAA 2C7QA 1I5OA 2CMDA 3E15A 4L16A 4EW1A 1P4HA 1D2EA 1U0RA 2X41A 4OP2A 2CUZA 4R2LA 3HEAA 3IPXA 3SOZA 3WNZA 1Q1NA 3VBEA 3T9AA 2ODEA 3E1SA 3KOZA 4NBVA 4OFWA 3HBFA 1WJGA 4FFMA 4GEGA 1QRSA 2EWWA 1QZZA 4DM4A 1TTPB 2NXWA 3ZOKA 1Y6RA 4BO6A 2D7JA 1JS1X 1GEEA 1MPXA 3SQMA 1E59A 3MWFA 2CMHA 3HN7A 4IDNA 3FN4A 2XCRB 3M9XA 3SHFA 1SXGA 5K0CA 1EUZA 3OFNA 5CB6A 2WHPB 4C3UA 2QYOA 2CMKA 4JI6B 5KYTA 9GPBA 2DPXA 1DIAA 3MHTA 4MVJH 5AXBA 5EIBD 4D5EA 3ZE8A 4A1FA 3A10A 5JNUA 4Y0NA 2A9KA 2OBBA 3WIDA 3PXUA 1FJHA 1YZVA 3DWGA 4LV5B 3Q3GE 2WJ4A 5J5VA 4RD0A 2CSXA 4Y6GB 3TH5A 2VIIA 3H5TA 3R5XA 4II2A 4JI5B 1FVOA 1L4YA 5IJ0B 2ZWOA 3BULA 1VJRA 3AKDA 4JXXA 2IX9A 3VR5D 1A3CA 1MX3A 1NBME 4B17A 1X14A 3NGXA 1BD4A 3TW4A 3ZNPA 4YRNA 4FZJA 3WICA 2UUOA 1H2RS 5LFAA 1KO5A 4LMRA 5HG0A 2IOHA 1X7YA 3OJFA 3MRTA 5FLEX 1YB6A 3AY7A 5ITVA 1RCFA 4W99A 4Y9DA 2V8OA 3GRFA 5ERGB 1D2CA 3E5HA 5FPQA 4G5QA 2NV6A 3GV0A 4N12A 4GBED 1GRNA 4NNJA 1A9TA 2HU7A 3KX2A 4OX9Y 2Y4OA 4GQIA 1X3SA 4ZP1A 4ZICA 1O94D 2VJMA 3OE4A 1Y7LA 3OQVA 1NQOA 3QUBA 1JN0A 2I6TA 5EJAA 3AR2A 4KHZA 1M0EA 1JWAB 3W2TA 4IL5A 1DLIA 1SVMA 5T8KC 3SYMA 1JLKA 2VT3A 3LQFA 4KGZA 2WF7A 1BFDA 1JLMA 3FNIA 3PENA 1MDBA 4L3WA 2I71A 1U63A 2XZLA 4URUR 4XFJA 3RBXA 1TJNA 3HVKA 5CGQB 3LXUX 5TLSA 3C3MA 3CRMA 3B6JA 4I99A 1IZ0A 1HO3A 1TIPA 1YS9A 4FONA 3I23A 5JNVA 2X8WA 3D5EA 1G8SA 2IZ0A 5LUBA 3WHKA 1OF1A 3P2EA 1JJBA 2HRBA 1L5GB 3OX2A 3WMRA 5B57C 3NBYC 4QNNA 3HXKA 5CVVA 4YFVA 3WRYA 4FINA 4DA8A 3Q0IA 3BM5A 1Q21A 3QMPA 3B7WA 3CVOA 4IJ6A 4GOXA 1MRSA 3GJ4A 4UMFA 3E9NA 3NHLA 4MRAA 1XRQA 3B13B 3ZWVA 1B73A 1VL6A 2Y6UA 3GT3A 1GYPA 1K08A 3WGJA 1TVKA 3H99A 1E3EA 3R3ZA 5FAXA 4G4SP 1PWXA 3BVPA 4F6LA 1GG5A 2XX3A 4KE6A 1G1AA 3I0MA 3K72B 1XDUA 3HPQA 3SZMA 3LE8A 3A58B 1T0UA 2R60A 5JJBA 2EW8A 1YZ3A 2OXEA 3KNZA 1W581 4HCJA 3G9ZA 1XCMA 3I2KA 1RS0A 4KLCA 2P6UA 1E2MA 3GUUA 3HFRA 5THKA 1LWOA 4MW6A 2ZVDA 4RIHA 3K2QA 3JALB 1GSOA 1C7EA 4ZFNA 1NV9A 5CEJA 1JHRA 1JX6A 2XMRA 2JS7A 4C0KA 1NBIA 4FDMA 3SKXA 4MPRA 3UYLA 4QFDA 3UMJA 3RYHA 4GT1A 3V33A 4B7UA 1TKCA 1O5IA 1PKEA 1CWUA 2J4FA 2WE7A 3F9IA 2NQ2C 4LFBB 5NULA 1GAJA 4BVKA 2RJOA 1VKRA 4FYXA 4Z4GA 3BX1A 3EVEA 3ZY4A 2Y05A 3DMPA 1A8SA 2NXCA 3FSJX 2QTVA 4MJ7A 3VGJA 4C03A 5BMVF 4I66A 1TCVA 3QHQA 1R66A 3M82A 1MO2A 1E7YA 2IXFA 5JEEA 1Z12A 3PGVA 5LXTF 4LHSA 2R6R1 1I3KA 5TT1A 1IAVA 1K0UA 3P2OA 5ERYA 3LOUA 2ZI6A 1EGQA 3TL3A 3OFND 1E3SA 3WYEA 4F21A 2D4HA 3IUNA 3BWDD 4IMPA 1W87A 2FJUA 5FPHA 5BVGA 3LSYA 2ZBDA 3NALA 1C3OB 4R1TA 3TXYA 1SUWA 2NTNA 1OASA 2GOYA 2QHXA 4HX5A 1BVUA 3JZIA 2I7TA 2JVJA 4YH1A 1QIEA 3QLVA 3CE6A 3OCWA 1D1QA 3IP7A 1ES9A 2B8NA 4QGSA 3H9CA 3NC4A 3PF8A 1Y3DE 4G2NA 3LTEA 2CBGA 2QYSA 1UK9A 3AXTA 1PZHA 4KUGA 4CKBA 1D2RA 4OOFA 3U80A 1AHIA 3TOCA 3RYHB 1HQYE 2WVGA 3OCYA 5A3VA 1LI7A 1H23A 1AK9A 1HM5A 3UV7A 3OFJA 1QVRA 4BNMA 5LU9A 2O50A 4N8EA 1Q1ZA 4NS1A 2EQ5A 4QYXA 4A8JB 2OO5C 1PK8A 2J30A 3GFFA 3CPSA 1WV0A 3MTAA 3OUZA 4H17A 4DOMA 3PXXA 3R5SA 2ZJ2A 1ST2A 1MEOA 1ECCA 1MC4A 3RHZA 1TK9A 4KYUA 5JZBA 4DYHA 1AGYA 1KU6A 1YL5A 1GNLA 1L7PA 1A98A 4RH3A 2QL9A 3D31A 1WCV1 2X1MA 1GNTA 2H18A 3DTVA 4LOAA 4CF6A 4RVHA 3FCEA 3U7QA 3MYRA 1S2NA 2XCOA 5IT0A 4PRZA 1GQRA 4KH0A 2JGAA 2NUAB 4E0BA 5BVGB 3N2IA 5GVRA 1JXQA 4CMJA 1Q0HA 1SQFA 1XAGA 2G3YA 1JEDA 3RDPA 1HF3A 1HNWB 3G0HA 3IB6A 4H9GA 4AKSA 1YMUA 1QCCA 3EF1A 4Q9NA 2D06A 4UKDA 3DO5A 1PGJA 5H70A 1H3FA 1NW8A 3M3PA 4BYMA 4DCUA 4YUXA 1IONA 1F2UB 1I3LA 2XCUA 1ZWKA 5LQDA 3A70A 721PA 3G2HA 1YACA 1WXWA 1HDYA 1HNXB 2A5LA 3E3OA 4NEQA 2FZ5A 3Q41A 4D9GA 4IVRA 2FZCA 2D13A 5EQDA 3BSYA 4QOHA 1JKXA 1XXHE 1DELA 2DSTA 3ZHQA 5K0SA 2R86A 5FTWA 3UJ7A 3SQXA 3PLRA 3G85A 4JGIA 1OA0A 3TIIA 2OILA 4U6SA 5JSUA 1H0RA 2MHCA 1NMSA 3WY9A 2VI5A 2NNLD 4G5GA 5GQSA 2AWOA 2XI4A 4INPA 5AKZA 3SBEA 3UK2A 5A5DA 4PG7A 4Q4JB 2GXQA 3ET4A 3A7DA 2BMDA 1DBVO 1O9GA 4NU6A 2PEZA 1BROA 1KDTA 2IOQA 4HSEA 4M7PA 2RDMA 5CX1A 1JH9A 2GD2A 3UN1A 1I10A 1N57A 3I4FA 4HGNA 1FQKA 3WIUA 5BV0A 1H2BA 1KJYA 1MEEA 2I7VA 1NJ6A 3NVAA 3R3UA 4JJFA 4NJEB 4YBZA 1SELA 1QF7A 2GXSA 2A88A 3NTQA 3P2JA 2C4UA 3KE8A 3Q5GA 4Z8YA 2YFQA 4TLCA 5FI3A 2XSZD 2XUFA 4YN3A 3PIDA 4AL4A 5AFSA 5LD2B 3ZNOA 3K9GA 3CRZA 3QBTA 2LCIA 4TTPA 4LVUA 5GGXA 4BO9A 4HPJB 3IL2A 1J70A 4GSKA 1Z63A 1LC3A 2PIDA 1J39A 4PRYA 3LPDA 5F3WB 4O02B 2OC9A 5HFJA 3KU1A 1Y8AA 2Q5CA 3OZUA 4HEA1 5EMJA 4AKEA 1GFSA 3IKVA 1I24A 4FMCB 4MLCA 1RWVA 4BN0A 3RVSA 1NG9A 3PICA 4DBLE 3ERCA 2PGAA 4A0SA 1V1MB 1ZEJA 3DZIA 3PNYA 2B37A 3T5CA 4BOYA 3PNQA 3FIJA 4TLBA 3MILA 4ECEA 2OCDA 2BFBA 4O4HA 2RHMA 3S99A 4F60A 1ZDMA 3PRHA 3JPWA 1N1EA 1R6UA 1QAQA 1KPIA 2DY1A 2D1YA 3SCZA 3C3KA 1U7XA 2QTLA 1IY1A 2ZIGA 4PLYA 4QQKA 4XZ3A 3S8EA 3V9AA 2NYAA 4IZOA 5KC8A 3ITEA 2QAJA 1T24A 2RGXA 2WKPA 3OF5A 4K6OA 5EIHA 2JGJA 1ZNZA 3EYAA 4JOBA 4TV8A 2CVQA 3KO8A 2A9RA 5CB4F 4HDCA 1JQEA 3W2EA 2KJQA 4A8TA 3UW1A 2F8TA 2GK6A 4C1BA 1G20A 4FFPA 1ZOOA 1I0LA 2DFTA 4YWHA 2VYCA 2VH1A 1N2CE 3THXB 1XG5A 4J0CA 2BZ0A 4JSYA 1DC4A 4ZVQA 4CV0A 4TS9A 1P8JA 3K1AA 1B2LA 5DLPA 4O0LA 4RJIA 5JXJA 3AUFA 2ZJYA 3N1UA 2ZBFA 3B8HA 3QTTA 2SKCA 2G71A 4PGGA 4B45A 4HN2A 4K0RA 3RIXA 2Q0HA 4RK5A 4X60A 5B3LA 3ONFA 3UUWA 1KO8A 4GMDA 4CLRB 3G7SA 2WFAA 1ZS9A 5F7ZA 1QRTA 4P3OA 1O57A 1X8KA 1FTWA 1HQCA 3G59A 5CGZA 4N5NA 1RWXA 3GB9A 4MUNA 4FB5A 4MKHA 4FB4A 2PT9A 1JSZA 1TC2A 3JU3A 3WNCA 1JAZA 2FQXA 1FNMA 2IYLD 4YRMA 1Z7EA 2DKFA 4KSBA 2IBTA 4OP1A 4UEQA 2QVBA 3HDYA 3IJRA 2BE7A 4U7TB 1Z0FA 4U2EA 2F9FA 2B8WA 1DO2A 2VTKA 1U2PA 3EVCA 4Q66C 4S2UA 1I2CA 1A1VA 3TQQA 1VCNA 3BTSA 1SC4A 3OZFA 4EX6A 5GJBA 3DVAA 2I1WA 3QFRA 5FOVA 1QF9A 2NV2B 2FXIA 2VSQA 2R1TB 3LLCA 4ZV7A 2FWPA 5KHOC 3LJKA 2YHIB 2HJHA 1VCIA 3DBHA 1FLVA 4KPUB 4UBJA 4BNZA 4RC9A 3PJGA 1WP4A 2WD9A 3S1AA 1UJBA 4NFSA 2HTEA 1PFKA 4J75A 3PBKA 3HK2A 1YQEA 3OZBA 1P2BA 1W36D 5IKXA 3CXRA 5TE9A 2W2LD 2J6HA 1KO7A 2BEVB 3U31A 4ITVA 5IJ0A 1IJBA 3T9CA 1IWPB 3QXXA 2R8YA 3LRPA 4BNGA 3CW2A 1EEXB 1DJLA 1AS3A 1KO1A 1Y7PA 5KINB 3UKOA 1C3EA 1DFIA 4PGFA 3VNVA 4M9SA 3UG7A 1KTVA 1PYGA 4R8LA 3A0RB 4K9PA 4QOEA 1JGTA 2O4UX 4I9HA 3JRWA 4M46A 2IYNA 2R8XA 3MLEA 1HDGO 4L51A 3IQWA 1DLJA 1GLGA 3TEMA 1NVEA 2BLLA 4BIMA 4V1CB 1R8QA 1TDJA 3ZCSA 2DH5A 2OT3B 3DPIA 5DBGA 5IHXA 3HB9A 5JY6A 3IT0A 3MFQA 1UKAA 1ZY2A 1L5MA 2VO1A 3O95A 4L0CA 1PQPA 4ITUA 1YR1A 2O8DA 4RK6A 2VK8A 3A6DA 3SZUA 3DZDA 4UNQA 2OKCA 1HDRA 3ND6A 4C4XA 5LMUB 4YHBA 2YWJA 4U8HA 3KYBA 3PDCA 2QWXA 3RD5A 4ADSG 2OORA 3R41A 4RPIA 1OXTA 4KIWA 1U1FA 3KPUA 3MFYA 2RC5A 4CEHB 4ZT5A 3I2JA 4FMDF 4KR6A 1FE8A 3STVA 2VR1A 4UEWA 2XUQA 4N41A 5E38A 1RZUA 1PJ4A 1PSDA 4S1NA 4URZR 4UBLA 5CB4B 4XD7A 3PC7A 3RM3A 4BE7B 4CT4B 2AFIE 1XHFA 2MR5A 1KETA 1MG5A 5TMPA 3DZBA 2PU5A 4BO0A 1A2QA 4JZKA 5C18A 2EHDA 4XOIA 2J3KA 4UAJA 4EI8A 1IN6A 2JIZA 3SJCA 4JELA 4FC6A 3DHYA 3V8QA 3NNDA 5TPZD 3TCXB 3DMTC 3NH9A 3UT5B 1CJKC 2BPOA 3L06A 2P9YA 1K7YA 1EZ4A 4MVJI 2RAFA 5TDHA 3X1DA 3CF0A 1RPJA 3BGWA 2A30A 2X5KO 3REGA 4FQ8A 1Q2XA 3O9MA 1KYIA 1H8EA 2Z9BA 1L2TA 2IELA 3AFOA 4PG4A 5BURA 3SVLA 2JAWA 2ZUWA 4M1SA 5HKKD 3RU3A 3KZVA 2CB9A 3UKDA 3UV3A 4N6NA 4YV2A 2ECPA 4V0MA 5BW5A 2SCUA 2VOEA 2IYVA 1HTTA 1TYBE 4KRXA 4EM6A 1UPTA 3EZGA 1LS1A 1B8NA 2MINA 2BJWA 2J31A 3G0BA 3DQPA 2WT9A 5BMVA 2HV8A 3NMUF 2FE1A 1XQVA 3RYFA 3ZQKA 4TT3D 4CMAA 4PS0A 5JASA 1QHFA 4U7FA 1KEUA 3Q5DA 4X1IA 5IAGA 3N8HA 4LZLA 3BL5A 4UVGA 5GIPE 2WV7A 2WWIA 3DMNA 1KY4A 2BW0A 5E4TA 1PJZA 2PLAA 2AC4A 2YZKA 4D0GA 3C5EA 4KR9A 3MGAA 2HRRA 2AEEA 2VDPB 1BRMA 3I32A 4R9SA 3UMSA 4UHEA 4HH1A 3IEXA 4MVXA 4RY0A 2FUCA 1MAWA 3LDAA 5EE9A 1S0UA 5C8VA 3EQ8A 4TSFA 4ZJYA 3S6JA 4EZEA 4E4YA 2GYWA 3BIOA 4FFVA 1VFPA 4H16A 4L9SA 4Z0TA 4FHFA 1R0XA 3BXEA 3ZTTA 4DJTA 3LY8A 2GDZA 4Y6SA 1I80A 4TROA 2O5VA 3TRKA 2WTUA 4ARAA 4DIBA 3IR5A 5BQXA 1GCUA 2Y1LA 1BTOA 1X9IA 3I34X 4RTMA 2Q4DA 2SKEA 1EUCB 1K5GA 2DUJA 3N53A 4LHXA 1ORTA 5AW5A 4XPIA 5T4BA 2JLSA 3C16C 3DFFA 3S2UA 2V7GA 3KLOA 2FMTA 1BH6A 3CX8A 3L8CA 2EKQA 3FFAA 4UVEA 3N0XA 3RGWS 2CN1A 1QC5A 1KI1A 1LRJA 4OXQA 2JLVA 3Q2KA 4J9VA 3CO0S 1FMLA 4L57A 4X44A 2NWQA 2W2TA 2Y8EA 2ZEJA 4HLNA 4KQIA 4BLTA 4CKBB 5FLKA 1IXKA 1ML3A 4ZCIA 1XZFA 4B3DA 1WR8A 3M6AA 1J8DA 1IZZA 1JJFA 1SCUA 1KQOA 3KPYA 3KRTA 3M1LA 3OPNA 3P0IA 4G0QA 3ORRA 4IXDA 2EATA 1KIMA 2RJ3A 1VLJA 2C7BA 4LYGA 5A71A 3R7BA 3U1TA 5AJTA 1D2AA 5ILGA 1WULS 5JALA 3ADCA 4HWRA 3S5JA 1FXWA 1W4AA 2XB4A 4UM5A 2ZJ3A 1FL9A 3NT4A 2XQKA 3DMGA 4FC7A 3SR3A 2Z6VA 3AHIA 1D6MA 1KDOA 1RXEA 2WDPA 3I2GA 2PGXA 1I9CA 3Q3HA 4ISBA 5CLIA 1M2HA 1WMFA 3U48A 4ICIA 4RLHA 3UK0A 4CV3A 3QVMA 1RRKA 3MS4A 1FUEA 1B8VA 1STOA 5JC8A 3EF3A 3I6ZA 3QBJA 2ZSUA 4CKCA 3RODA 3V97A 1Y8RA 3HUFA 1BU8A 4A92A 5GINE 4FEAA 3QUQA 1UBMS 4O4LB 4MYDA 2VJQA 4MARA 2CXHA 2IP1A 2YNMD 2QZSA 3PDJA 4N49A 4RFSA 5HF8A 4AJHA 1IY2A 1W76A 3DNFA 3EGXA 3LSTA 4MTLA 4I14A 1Z74A 3RAEC 1Z0UA 4WUTA 1BWRA 3JARB 2ZUVA 2FMHA 3GJZA 2GB4A 4YAKA 2CDNA 1FDOA 2VHYA 3CUUA 2ZIUB 4XJXA 3UBTA 4Z86A 3D7NA 5E1BA 2EZTA 2POQX 3NCTA 4REOA 2IL1A 3HSSA 3NJ4A 5L3QB 1CK4A 2QAIA 5ALNA 3O5AA 1IYZA 1HOXA 5FBHA 4BBAA 3SF8A 5AJVB 3ZEIA 1A7KA 2A9VA 4GECA 2AYXA 3H9JA 3IOCA 3LA6A 3TO5A 1NXSA 1XOIA 4W5HA 2WB2A 2QMUA 2PKYX 4DLRA 4L8WB 4C14A 2P4EA 2I2FA 3OG9A 4M0CA 1PT9A 2DWQA 2QRLA 1E5LA 1EINA 3AUAA 3C5HA 1D2NA 3OD5A 4C4AA 3RU7A 2EFDB 4TLAA 4PNPA 4KPEC 3JSXA 2G0NA 4PRLA 2HMUA 3N7AA 3HSKA 4I2VA 1WBDA 1E4OA 2VQSA 4YK7A 5AI9A 4YJKA 5AKIA 5DYIA 1M1YB 5EXDA 3ZY6A 5B2ZA 4DDMA 5IH7A 3AF5A 4KNYA 3PXAA 1Y8ZA 1EWYA 2RCYA 4YP0A 3U40A 3L7LA 1TOAA 1HFEL 3R3XA 1KK2A 4YHHB 2FCAA 3VZPA 1MAUA 1YS1X 4R16A 4TV9B 5BUZA 5IABA 1N5DA 5E9QA 3DW1X 4TXMA 1XVUA 2WAMA 5DISB 1JG1A 2PKQO 3UTCA 1U8ZA 3FNGA 4Q1AA 2R5NA 5TT0A 3MOGA 3QKSB 3GWGA 3TFOA 4QEZA 4OKSA 3QLTA 1RKVA 3VU9A 3ZQJA 5G0SA 4BDTA 5CJPA 2QR3A 1N2XA 2DULA 2XY4A 3NH6A 3NHFA 3U17A 4L8FA 1ODCA 1GU1A 2FPGB 2JIRA 3V32A 4EA8A 4M0PA 1HFJA 5CNMA 4BV3A 1G5RA 3H9BA 2LUOA 2WJGA 1L7DA 3TSWA 1XPUA 2FG7C 2X8JB 5DE3A 3TUZC 3U4QB 2OCAA 4G1VA 3EZYA 4YP9A 1SG9A 1W94A 3HCWA 3IAHA 1Y1RA 3O2JA 5EINA 4ZU1X 2FMUA 1P2UA 1NJ8A 1CR2A 3C15C 3MF4A 1X1EA 1JUDA 3ED5A 1E3QA 4TLLB 4YCDA 3RRBA 4DYDA 4A2PA 2FEMA 3A1EA 2XZTA 4D96A 2AE1A 4PLPA 5DVZA 1BGXT 2Q2QA 3BJEA 4E5KA 3ORQA 4WBNA 1RZVA 3OF2A 1XHEA 4PHTA 4RNCA 1EFAA 4DV2B 2JLZA 2JG3A 1M1YA 3FOFC 1KGDA 2QD2A 3MTIA 1D09A 1V0JA 1JKMA 2REOA 4JLOA 2FZEA 5SZIA 1D3AA 1N0HA 1PGOA 3H8JA 4IDCA 4HS4A 4KTTE 3W6ZA 1NQTA 1HDOA 2QU7A 4KDCA 4B7AA 4A0FA 4LWZA 2OM6A 4HNGA 3K6JA 3G2IA 4L8VA 4WXRA 1CUGA 3H9QA 1QVWA 1NPTO 3LU1A 1YCGA 4IILA 4RIFA 2FPLA 3BIJA 1N2OA 3PRJA 5I7VA 3R9XA 2VNHA 2AG8A 2ZYSA 4LA4A 3AINA 1G5TA 1QX4A 2FV8A 4LRYA 4NYJR 4YJGB 4DMGA 2HZBA 1T91A 5GTDA 4HEJA 5DM1A 4AUEA 5KDLA 2CBZA 4ETWA 3FLMA 2XZOA 3C5CA 1ZCJA 4UDYX 1M76A 4XQCA 3QX3A 3ON5A 3ZTWA 5CLLA 4F56A 3DBOB 1YQGA 3ZBUA 3GT0A 1OFUX 2XMCA 2XXJA 3I4CA 4E5NA 1NC1A 1AV6A 2GBLA 3BH6A 3QVTA 5B1IA 1ISIA 4BAZA 4EF6A 4DTIA 2H1RA 4HH4A 5A9TA 5J9FA 5KYWB 5LP6A 1EGHA 3D6AA 4WKBA 1Z18A 4L3OA 2HA5A 3PA8A 3BK2A 4RPHA 3FGZA 1HZZA 1OI7A 1X0VA 4P92A 3RCBA 5GIOE 2WP0A 3MWDA 4CM8B 1P60A 1GR1A 5BYKA 1KKMA 4BMDA 1Y5LA 3W5UA 1JQBA 1J2JA 2C2WA 5DULA 3K8ZA 5FA6A 2X0IA 3OQ6A 2EQAA 4RD2A 4B31A 1C4XA 1GN9A 4NQRA 2OCXA 2FU5C 3TX2A 4EHFA 1KZ1A 3DUWA 4MV1A 1DV2A 4LI3X 2DFPA 3RYCA 1D5WA 3IT1A 1T8UA 2CNNA 4JVMA 1U90A 5EIXA 3ROZA 1XMPA 2RGWA 4N7RA 3V3TA 1AH2A 3LY9A 3FTPA 2WWHA 2IIVA 1SD2A 2V0GA 3PNPA 4LJSA 4DSUA 1KDRA 1TF2A 2ZQ5A 2VDLB 1A4UA 3ABIA 3DMDA 4PGAA 4Y2TA 4KRGA 4YJGA 3UAVA 4A8PA 4BB0A 4EBFA 1MW9X 1ZD5A 2QUKA 1JHVA 1NQXA 1M3SA 1EFRD 3KT0A 3KK0A 3RSFA 4AS3A 3IB3A 5B55A 3V4VB 1BQ4A 2QAGB 3BA6A 4HDAA 2OZLB 4YT8A 2IPAB 2YBDA 1MFPA 1FW6A 4RF2A 1K5HA 2UU9B 2FPMA 3T3MB 4LF7B 2QSJA 1WXHA 2QPLA 1DCKA 1IHUA 3I9LA 5A02A 3ILYA 2GN8A 1FTSA 1ZK0A 2PUJA 1KI6A 1BX0A 4R2IA 4NZ9A 5DNUA 4FJ0A 4ZOQI 1JNXX 1LLFA 3VNQA 4CR7A 3U4MA 3EH2A 5FDFA 1E2UA 1V37A 4KPFC 4QPDA 2NVBA 3T1TA 4EA6A 2WAYA 4OB8A 4K6CA 3H4TA 1U28C 2HR1A 2QTFA 1PTJC 1CQZA 1NN1A 2BMEA 2VK1A 4JKIA 1N5OX 2O7NA 3Q9SA 3VC7A 3HCFA 2IE0A 5CNKA 5TSDA 2F1IA 1FS4A 1YOVA 3BORA 4EPRA 3UJ8A 1GL7A 1DMRA 3WV5A 4QBHA 5KSPA 5M04A 3COJA 1P4AA 3U39A 1CE8A 1QHNA 4HS9A 4P3YA 3ZWMA 4XASA 1P4GA 5DTEA 4AJNA 3OLCX 3ZGZA 4JODA 3A05A 4IGAA 2R0QC 1CFZA 1J20A 4H15A 4AROA 2AR9A 4LX8A 2GESA 1OWPA 2XV1A 2VOJA 4L8LA 2C0PA 3Q88A 4I8XA 4MKFA 2JIBA 4NONA 3BWCA 4DIEA 4HUTA 1MC1A 5ICMA 2GAOA 1DXHA 5AVRA 3QW2A 3PC2A 1QQ5A 3KWLA 4QJ5A 5BSVA 4CL2A 2DE0X 3S2YA 4OXYA 4C3OB 4M0MA 3I5YA 5J1SB 1Z5OA 3DEJA 5CW2A 4NDAA 2Q4OA 4I9UA 4NCNA 4TYNA 3FNFA 2V1UA 3B1JA 1YDHA 2DTXA 2ES4A 3BSFA 1CRPA 2EP5A 1P0PA 1YQQA 1E9RA 1H2WA 2R84A 4H08A 4WNAB 4AWAA 4Q9AA 1Z6AA 3GGOA 3GDWA 1O96B 4FPXA 1PD0A 1JG7A 5C7IO 2E6KA 4DNOA 3K05A 1F3OA 2O1XA 4EFMA 3WKCA 3COYA 1Y7IA 3FHTA 2C82A 1FU8A 3HEBA 5P21A 3ULKA 3HUDA 3BZBA 4N7BA 3FUUA 1NSTA 3GLKA 5E2AA 2JFYA 5AW0A 2QP9X 2A6PA 3IAFA 1PGNA 1OV6A 1G17A 2GPSA 3LT4A 1RD4A 1V39A 3NBXX 4JQYA 5TEWA 2OORC 1CUXA 3NDPA 1F20A 3CG0A 4MUXA 4DV1B 2HGZA 2QJWA 1V8PA 3ITKA 3C0KA 4IS3A 1YE8A 1FEZA 1F5SA 1I30A 5B4VA 4DBZA 4G1FA 1RBMA 2GS9A 1J25A 1DCMA 4MVJG 1JJ7A 1UBRS 1MENA 1L3CA 2Z5GA 2ZR7A 4WESA 3WK4A 3LHIA 4AWBA 2M6RA 1Q11A 1H5QA 5AI6A 2ADOA 1P2DA 1TMGE 3WLMA 1KR5A 3O4GA 4CG3A 4OLFA 1WQ3A 1QTIA 4A91A 2QRVA 3VHQA 3ETCA 1KVRA 4DJAA 3TOZA 3WZLA 5LQJA 1F7VA 1SZCA 4GXRA 4D3XA 3ZIDA 3H3XA 2YZ7A 2QPAA 2EJUA 5BPHA 4XSVA 1GZ6A 5AHKA 1NP6A 4DRXA 1H1DA 2DQSA 1VFNA 1WXGA 5JZOA 3V80A 1AHNA 2D0IA 1V1RB 2G7ZA 1JSLA 4BX9A 2BN4A 4HHEA 2X5XA 2PAAA 5ARDA 2VAWA 2BCJQ 2E4AA 3CZCA 2ZUTA 3ILXA 1U3VA 2QJFA 3ZHVA 1Q84A 3ZLUA 2QUHA 2QGZA 3AV0B 1CEXA 2X86A 4X92A 2IBMA 5CU7A 3EY9A 5IAKA 3DZGA 3VDRA 5IANA 2EJWA 2QVCA 2AOTB 4F9FA 4UBMA 1YKGA 2TMYA 5BRJA 4RJJA 5LZ9A 3D64A 4KQFA 1Z4JA 2JFBA 3BE5A 3WBJA 2IUTA 2J9XB 2FPRA 4JAVC 1KNQA 1SXHA 2Q4BA 1HKHA 4PZAA 5A6VA 2NU6B 2RGDA 3IQXA 3MTQA 3E4DA 3OEHA 4FEYA 4KI7A 4F4JA 1DC7A 2PX4A 4ZXFA 2HLDA 2ZRAA 2IV7A 1OSNA 1DXOA 1NURA 2GXUA 2WKQA 4FOPA 4MR8A 2PNFA 3EGIA 1OBFO 1EKXA 3R4VA 4MUAA 4UXIA 2GPYA 3CLUD 5EKDA 8AT1A 2RKWA 4P36A 3GNSA 1T4CB 1VYVA 1Z28A 1YRLA 3BFPA 4CTNA 2GKSA 5AJUA 4AP9A 4E1AA 1XL1A 1K6MA 1GN8A 2B61A 2Q9UA 1TQDA 3SF0A 1AKEA 2PJUA 2Q3BA 3C8UA 3GK3A 2HW8A 2Z4TA 2UZ1A 4KX5A 3ZCTA 2L2QA 1WEKA 3PC8A 1V1MA 2X22A 1IXYA 4ZCRA 2PYDA 2W2NA 3FZYA 4PFSA 4HQOA 1Z5UA 2G83A 3KLNA 5D1NA 2Y0BA 3WXBA 5FEMA 4YAIA 1U3WA 2P11A 3QEBZ 4CWAA 1D1PA 2C78A 2R87A 2Y0CA 3D6NB 4MLPA 4Q03A 4CT5A 1KYQA 1ZBQA 2LGJA 3QF7A 4A6DA 4IEEA 1NU6A 1KAMA 4AUKA 2QRNA 2OXIA 4DR5B 3TZQA 1Y81A 5HX7A 4YRKA 1NR1A 3PU6A 1ZH4A 3HFSA 3WP0A 3W5CA 4DR4B 1F1BA 2B35A 2L0XA 3ISJA 4QU0A 1L7RA 2ZJ6A 1B15A 1O95C 2WZQA 3AFHA 3NR2A 3DYIA 3H5LA 3QVUA 1EUYA 4YB8A 4H1TA 3HXLA 2IGTA 2WF9A 3DR5A 3F6CA 1Z6TA 3GA5A 5ITWA 4E21A 4ZO8A 1M1NB 1W59A 1MTZA 2H11A 3CVYA 3UJDA 4IUCS 5TQ2B 1G20B 1TTHA 3SXJA 4Z6KA 1PP4A 4Y9TA 4NMMA 3W2FA 4B4VA 4NKRA 2V7XA 10MHA 3KXKA 3IE2A 5JCJD 1OX4B 3AT1A 1M2GA 1X0XA 221PA 2ACVA 2BOVA 1G6HA 2O2IA 1RKUA 3B3GA 3G2JA 1ZZGA 3KR9A 4MR8B 3I42A 4KV9A 2HMTA 4PXSA 4B8YA 1XZ8A 3WYNA 5ICFA 3IA7A 4MKXA 3DTYA 2I8AA 4LSGA 5KDDA 1V9LA 3FI9A 3EG9B 4BCCA 2HHLA 4K8OA 1OPXA 3PWKA 2ZTUA 2OLEA 3IT3A 2XWJI 1F5NA 4R7GA 3W8DA 1W85B 3OA0A 4DMLA 3DMYA 1ZXBA 3PEVA 2DRIA 4AXBA 2W8BA 5A4DA 3JW8A 3OESA 2X5NA 5SYAA 5TQVA 3SX2A 3D7MA 3HLKA 1ZIPA 2BHRA 3S8MA 3FJOA 1SD5A 3HFGA 2HADA 2HF7A 1X9HA 3LM8A 4F4IA 3R1IA 5IM4A 1JPUA 4QPNA 1DEAA 4RZIA 3X43A 3I6YA 5LQAA 3IH5A 2XUIA 1L8XA 2D5AA 2NSJA 3EDRA 4U3JB 3QBVA 4ED9A 1RQ7A 2Q49A 4BFWA 3NOXA 4UATA 4RXMA 1MV5A 4ODIA 1IBMB 3W78A 1E2KA 4Y98A 1GZ7A 1WUIS 2A9OA 5J3JA 2QUBA 1BOFA 1P7PA 1SB9A 2Q6IA 1NKSA 2XMBA 2OV6A 2ZWAA 4JR2A 4LK3A 2PT5A 5B36A 1U3CA 4JU9A 1QHXA 1T6YA 4FM9A 3W05A 3HJAA 4N5LA 2KHZA 2Y0EA 3E58A 3JVIA 2W5UA 2I7DA 3HDGA 4JL5A 4KE8A 1XQYA 4LTNA 5EIWA 2VYQA 1I36A 2XUPA 4J43A 3ZDXB 1CJVC 2I1QA 1IUOA 2VCYA 4GI5A 1FFCA 2VJCA 3ZIAD 5HUJA 1K66A 2A5GA 4C2UA 1NVVR 2OZKA 1ECBA 4NVRA 4U02A 2YXDA 5SZHB 3TK1A 3TOXA 5I7WA 5JRJA 1SVIA 7ABPA 5TF4A 2GUGA 4LGYA 1EVKA 5EJ2A 4POOA 3KZNA 3ZV3A 1FOEB 1W88B 2ID4A 4CODB 3H16A 4Q12A 5H02A 1J42A 3P9ZA 2ZDQA 3CKMA 3H8VA 5HR5A 4AP6A 3OI7A 4BAUA 2ZRFA 5HFAA 1E2HA 3EYWA 4E5YA 3LV8A 4E33A 3Q3CA 4WWHA 1JTEA 2NU8B 5CA1A 4BFCA 4M0KA 1NJFA 1DAOA 2XVYA 2R66A 3HC7A 3BBPA 1VLZA 1DKOA 3G8YA 4WLUA 5AXAA 4XLZA 3JZAA 1K1EA 3TB6A 2BMFA 3GMTA 1VL2A 4AJ1A 2OK7A 4PGHA 1JDSA 4QELA 4QREA 5JD4A 3P96A 2IZ6A 4XJTA 4GP6A 4UAVA 4DPKA 4QXRA 2W6ZA 1SBNE 3TZEA 2QW0X 1XPJA 1ZNWA 4F2HA 2CNWD 1JYFA 2BKLA 3A4YA 4A8JA 4CQMD 3WB9A 3NM4A 1Q6ZA 4FDVA 4F86A 3N6VA 3GRAA 3WGNA 2DETA 4I9NA 3UANA 1L1FA 2O3UA 5CURA 3IHWA 4FILA 2FGJA 1T5TA 2JLYA 3FUCA 5HIJA 1TQHA 1N8TA 2GETA 1ZOPA 4RESA 5CDTA 3ZW8A 4MDYA 4D3SA 1Y5RA 3KQYA 3O4VA 1XLVA 2P1RA 2BJVA 4MHOA 1I4LD 1Z16A 4URWR 1C1YA 3HA7A 4ZZ3A 3E27A 7YASA 2YZMA 1GKKA 2VZEA 4ZU6X 1RADA 1B41A 4IIJB 1XDBA 4R71A 1OAOA 1YCDA 2C97A 2X4IA 2Z2IA 1VYTA 1DFGA 1XEWY 2ACWA 1PJSA 3HO6A 2H0RA 1RC8A 3I04M 4LJRA 4V0QA 1BYUA 2YVAA 4HEHA 5JDCA 3MWEB 3DQZA 3LQYA 3T7IA 621PA 1JMVA 1EJ2A 1JVNA 4D8TA 1EP1B 1PL6A 4GDMA 1XD2B 2WF6A 1VHJA 1WBJB 2CDRA 3U16A 1RRMA 4HH3C 5CJJA 4PINA 5K3AA 5EJ8A 3O21A 4OGFA 1N5LA 1GUFA 2XT9A 4A2QA 1F2TB 2EKLA 5H5JA 1N9ZA 4I1IA 4YASA 4DVJA 1SXPA 2OOKA 2C0CA 3FI0A 4P81A 5AK6A 4B34A 2HJRA 3QPBA 3FPJA 1E0DA 1ICIA 3IEPA 4YJ3A 1S02A 3EDQA 3OJOA 1ZESA 3GRZA 3IT2A 4XTCS 1P31A 3BJMA 4FOTA 3Q6NA 3A4IA 4JGBA 1OFTA 4M37A 3WLQA 1M6EX 2WTBA 3D4IA 1P7CA 4XDZA 4DZZA 4ENUA 1Q16A 1WPRA 5BWNA 1OYOA 4E5UA 2A1TS 1KZHA 4EQZA 4MDFA 4DT1A 5H1YA 2QTMA 1JTVA 5FL3A 4RW0A 4M86A 1WZEA 1MVNA 2FK8A 3FXAA 3GEGA 1XTTA 5EKXA 1IBKB 2R25B 1WOYA 2F1RA 5F78A 2FX3A 3DXZA 4O5OA 3M1AA 1UT5A 4KXWA 3TDMA 5JTTA 3KKPA 2W6JA 4XFDA 3CPJB 1RHQA 5KDOA 3DE3X 1J8FA 1N2JA 3H5IA 3KJFA 2VJYA 5C3MA 4IO1A 1U9ZA 4ZQFA 2F67A 4J0DA 4F9EA 1THMA 1L4LA 3EQ2A 4H27A 4I08A 4ZVNA 5HZGA 1T2UA 3LZ6A 1BOOA 2EFHB 5MHTA 1K88A 3JWIA 1AS0A 8ATCA 4DA9A 1T3HA 5F2NA 3FYSA 2YXNA 2XVZA 3FUTA 3JQ7A 4LSWA 4PYMA 1D2GA 3FHOA 1CPYA 2CCJA 3LY7A 3QPVA 4I3FA 5EUBA 1A9SA 1D2MA 3T9DA 2REQA 2PK3A 5K0FA 4ZYXA 1CR1A 2ZUUA 3EW7A 3I76A 4QUAA 4AO7A 1DCTA 3QE9Y 1X7ZA 3F96A 3A4MA 4W5RA 2GZRA 5B7NA 3V4RA 2EKZA 3TW8B 2YL2A 4C0SA 3H0EA 2ODWA 5ECWA 2F3UA 2QP3A 4NNOA 4WBXC 1EEHA 3TTTA 5FUMA 2OP0A 4RHTA 1KI2A 3DNPA 4OI2A 2VPYA 2ZZMA 3MUEA 4BWVA 1FDRA 2P9CA 2BVNA 4B8ZA 3EUWA 1L4NA 1UBSB 2ZBUA 5CJ2A 1COWD 3JVVA 4PSCA 3RUAA 1JALA 4L15A 1JFTA 2PQMA 4EWLA 5KBYA 3THWB 2IPXA 1TU4A 3OT1B 5A5EA 3MINA 2ZXUA 1BWSA 1GT6A 1HG0A 1R0RE 1U7ZA 1P4RA 2C5SA 2FQ1A 1L6IA 3IP3A 3L77A 3NHJA 4QASA 1EESA 4RIGA 3UUFA 3W3AD 1MT0A 1VPEA 1X7WB 4QQ8A 5G2OA 2F1OA 2D5LA 4QXMA 3SICE 2ZRQA 1JKJB 4YDRA 4RFSB 4CTKA 2R44A 1G3IA 1ZUIA 3U3XA 2HA7A 1YVEI 3RBVA 5F51A 1G2QA 4DWOA 4QKQA 2VTBB 1GAXA 3JQ7B 4EI2A 1ORRA 2XW6A 4P4TA 2IYSA 2FFJA 4BO8A 4N7MA 4S1PA 1U2SA 2J3EA 3E4CA 4LI0A 1G8MA 1YJBA 1A04A 1AUQA 1HDZA 2F59A 3M6FA 4X8OA 4TM7A 3WB2A 3IDQA 4YYZA 4RMIA 4RD4A 3NC0C 4R83A 2BTEA 3E23A 1R3UA 3HRKA 3UV6A 2EFYA 4PFJA 4WESB 4CKWB 1DAHA 2O3QA 2R11A 4FS3A 4G63A 4NK5A 1KI3A 4DSAA 1FTNA 2WF5A 4K86A 1KKUA 2HMSA 2ONKA 3BDAA 4LGMA 1KNXA 3ZG6A 1BMFA 3Q6IA 3KP1A 4PZDA 3MK31 4PGMA 1YVDA 2JJ2A 4YI3A 3UMCA 3UT6A 1Z6GA 1M8FA 1G38A 3OT4A 3AETB 4WZ6A 3KQQA 5BYJA 2Z5FA 3O03A 2QL6A 1S3FA 4MO9A 3EY4A 5GWXA 5ALGA 4G0VA 4GOLD 4R31A 2IS2A 2VP0A 1VBFA 1G1MA 5B2EA 4LJ6A 1M6WA 2YWXA 3HQ4O 2QR2A 1G4HA 1DKLA 4ZDKA 1TFUA 4LYEA 3JQ8A 3MJTA 2QRMA 4B3SB 1X7WA 4BFYA 1FSPA 1RWMA 2FPUA 1OY1A 1VHLA 2A0UA 2IPMA 1SULA 3ESQA 1OBCA 3QVGA 3F67A 4KXVA 4R1LA 4PR3A 5HW0A 3B1KA 2WU4A 3UO8B 3ZI0A 2B4TO 3G13A 3R4CA 5KTYA 4HAIA 2QKYA 5E6RB 3T3NA 2YINC 5EWMB 3ZCRA 4Q24A 2IRWA 2BP7A 1L7NA 1ZOIA 4U5QA 4ESEA 4PY2A 3WK8A 3WTCA 4D42A 1BO6A 2DQ4A 5DCLA 5JW6A 1RYMA 2AT1A 4MWZA 4OP3A 2A9PA 1OLSA 4J1NA 4TL9A 4EMTA 2FPGA 4M1ZA 1DC8A 4UASA 2BEUB 2B1JA 3ITDA 2CFSA 2J3MA 2OZPA 3HNPA 1QB7A 5LLDA 4R2XA 5I9SA 2CC2A 4Q3EA 4ZCQA 1TU3A 3ESBA 5BR4A