2NZYA

Crystal structure of alpha1,3-fucosyltransferase with gdp-fucose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
343
Chain Sequence
b'MFQPLLDAYVESASIEKMASKSPPPLKIAVANWWGDEEIKEFKNSVLYFILSQRYTITLHQNPNEFSDLVFGNPYQNAKRVFYTGENESPNFNLFDYAIGFDELDFNDRYLRMPLYYDRLHHKAESVNDTTAPYKLKDNSLYALKKPSHCFKEKHPNLCAVVNDESDPLKRGFASFVASNPNAPIRNAFYDALNSIEPVTGGGSVRNTLGYNVKNKNEFLSQYKFNLCFENTQGYGYVTEKIIDAYFSHTIPIYWGSPSVAKDFNPKSFVNVHDFKNFDEAIDYIKYLHTHKNAYLDMLYENPLNTLDGKAYFYQNLSFKKILAFFKTILENDTIYHDNPFIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha1,3-Fucosyltransferase
publication title Structure and mechanism of Helicobacter pylori fucosyltransferase. A basis for lipopolysaccharide variation and inhibitor design.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 112
structure length 343
sequence length 352
chains with identical sequence B, C
ec nomenclature ec 2.4.1.152: 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase.
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00852 Glyco_transf_10 Glycosyltransferase family 10 (fucosyltransferase) C-term
A PF18025 FucT_N Alpha-(1,3)-fucosyltransferase FucT N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11650 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nzyA02
3.40.50.11660 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2nzyA01
2NZYA 2NZWA 2NZXA
chains in the Genus database with same CATH superfamily
4ZDWA 4MKRA 3KLMX 1FMTA 1U04A 4R0NA 3ZV6A 1DKPA 1U4OA 3PR1A 2M2IA 3LTNC 2F67A 2M6RA 4JB0A 3SC3A 3WGIA 1O4VA 3U17A 2C8KA 4HG2A 5DNUA 2FMXA 3CEAA 1KTIA 1BMFA 1WP4A 4G8CA 3JWHA 2OYSA 1V5FA 3KSDO 1C1YA 1P7ZA 1E2HA 2I1VB 2X9LA 3K9LA 3VSDA 4MO9A 1RM0A 4DADA 3RS7A 2OCPA 2R7MA 2A0YA 2ZZKA 1DXOA 2ZPUA 2ISCA 2KWIA 1J22A 4KLCA 4QATA 1A77A 3D6AA 3F9IA 1JLKA 3WGJA 2J32A 3IAM1 2JGMA 1N2CE 2XPCA 1O95D 3ZI0A 1ZAYA 1I7LA 4RTPA 2VQ6A 3E7XA 5J2UA 3H04A 3NHWA 4PZZA 4M83A 5DM2A 4RIHA 5A5FA 2O2HA 5I7EA 1K7EB 5KI6A 3DFFA 4DV2B 2VC2B 4Y9RA 4UREA 5EPUA 2DJ5A 4YONB 5JU6A 1IN8A 3B36A 1ZPDA 2GD6A 1T5BA 1EHCA 1MX3A 2XA1A 4QUEA 3WB9A 3EBOA 3U44A 3IQGX 3NM6B 4MMZB 1QDUA 2GZMA 2HA4A 2QQ0A 5IC6A 4DSAA 1ZM7A 4LHXA 4V0OA 4DN6A 3STXA 4WY8A 3SKXA 4A26A 2HCRA 4R69A 5C3MA 3EULA 1NAIA 2J7KA 1ESEA 3TKYA 2AG6A 2H4ZA 4YYZA 3L92A 1DBSA 2R1TA 2BBTA 2VDRB 2O3RA 1DI0A 3IDAA 5FWDA 1TAUA 4GX0A 4TRMA 1PZEA 3BXPA 3IDFA 3UAGA 3W8EA 3ZJ5A 1R27A 5HM8A 1W6UA 3S40A 2EQBA 1PLLA 3HO6A 1PT8A 3M6FA 1ABFA 3AHEA 1PJRA 4OL0A 5G0SA 4ZMBA 2BSQA 4QFCA 3X1YA 3ZV7A 5A1JA 3L7LA 2VZ8A 3HB5X 3ZBPA 3QJYA 4B6QA 1KSGA 3G79A 3IKJA 2GWRA 4US1R 1VIVA 2RGBA 1MDFA 4L8VA 4TRJA 4UU8A 3ZYCA 4CIWA 1JB9A 2ZRNA 2AWNA 3GMTA 3CG0A 1IN4A 4JUBA 3CG4A 4LGYA 1QCCA 3HZZA 3EFHA 3KKLA 3E9DA 3HU5A 3OY7A 4CR7A 1RD4A 4RD0A 1YRQA 4DR7B 4FFOA 4L9SA 4P83A 2DHCA 4EJSA 2JJYA 5EE9A 5HBRA 3C70A 4KPFC 1UT8A 3K5PA 3FPFA 3M6VA 2H3HA 3KS9A 4XM0A 4LX0A 1YS1X 4XOIA 4PTZA 1GPKA 3L6EA 5H83A 3V6MA 5LD2C 3BCUA 2PMBA 3FNEA 5BSTA 5ILGA 1ECBA 1M0SA 1QDLB 4JV5B 1QV6A 1DEKA 4MRMA 3QP9A 4ZT6A 5HK9A 3ERCA 4FINA 1N2JA 1AHNA 2VAWA 3L7JA 3I5AA 4HQ0A 3TQTA 2MYNA 3MXTA 1VSUA 2ORED 3S1AB 1VKHA 2EKZA 4E2XA 1ZXBA 5IYZA 3SNHA 3IJRA 2XCOA 5HKKD 3N2GA 3GVCA 3HDGA 4TTTS 4AULA 3B1VA 3MB8A 1YRWA 3WLTA 4LOJA 1KSJA 4MQEA 5B7NA 1I94B 1IU9A 2DFNA 3JX9A 4LE1A 5JXIA 5CA1A 1OLSA 5FFFA 2RC6A 3N8KA 3C3AA 1KJJA 2WTBA 2IZ1A 1WDKA 2C3MA 4JJFA 1LLCA 3VR3A 5FNVB 2B8TA 4KR7A 1CJVC 5KQRA 1QONA 1PEYA 2GZDA 2O0JA 4B2IA 2I9KA 3DFKA 4UZEA 1OFUA 1QQ5A 4OLFA 4PEVA 2GNOA 3QIAA 4J1QA 4ZN6A 3VU0A 1UJCA 2B61A 4BQQA 1V3QE 1MB3A 1IL0A 2VJYA 4MQEB 1NT4A 2TMDA 4X7RA 5ALDA 2PWYA 5CA1B 1DKLA 1NBMA 1OLSB 1BDMA 3KYIB 1MC4A 3EGCA 4Z9AA 2I6XA 2JRLA 1VG9B 1P4HA 1Y1TA 2HPAA 2WF9A 3AXSA 3NGLA 3M3DA 3RU3A 4BTLA 4ER3A 1P74A 2CBXA 4K03A 4YPOA 3FPJA 1KZ9A 3T54A 1UZLA 1W30A 2QN1A 3GUYA 5JSUA 2VP3A 2E82A 3CZAA 1ZR2A 3C7TA 4ZYXA 1HORA 2CUNA 2YJ6A 4E1VA 1Y8QA 3RRJA 5FUBA 3RBAA 1XVUA 1NW6A 2YY5A 3N0XA 4FI3C 1VFPA 5HJEA 3C7DB 2ZUWA 4KGVA 2QMZA 4LV6A 5AW7A 1PGOA 2AEEA 1ISGA 3FAZA 1NQUA 1WW3A 1E4VA 1Z37A 5BNFA 3R9WA 3FPHA 2P78A 2B5WA 5KQLA 4XVRA 3ET4A 5IF3A 2W8ZA 3NPAA 1FTNA 4HWSA 1DAKA 3EQ6A 4II3A 5C7YA 2VTBA 1G8KA 4HAIA 1P33A 1PU2A 4FGUA 3GH3A 2RHMA 3O9ZA 1XKTA 4X60A 1QS0A 1S2NA 3MTDA 4Q4DA 1M6VA 1Z33A 4BATA 3CLHA 3C5CA 1NPDA 1T9BA 3JR3A 3NONA 5ALEA 4DTCA 2REQA 2NZXA 1ZOSA 1T4CA 2H1HA 3G0OA 4RTMA 1P9LA 1YZVA 2JC3A 3KUXA 3KAKA 3OCXA 4WMLA 1WB5A 4PO9A 4WBSA 2F1KA 3D8NA 1GZUA 2ZRKA 1ZGAA 1RFLA 1L5HB 1GYQA 1XDGA 2B7LA 2H9AA 5BNWA 4B9AA 2ZM5A 2CDAA 3K6KA 4P2BA 3QMPA 2QN7A 5CB0A 1MOPA 2FPSA 2VTBB 4TYWA 5IZCA 3QKSA 3R23A 4HSEA 1DG1G 4QOFA 1H4VB 4YRCA 4AZ0B 1T3SA 3FWKA 2BY4A 5KAPA 3W9UA 2I0FA 3U4GA 3ZK8A 1ORIA 3L7AA 2OILA 1M6VB 1UBFA 2IXFA 1JX6A 4TOIA 3RSLA 4BWVA 4ZZ2A 1GZ7A 2REQB 3O2JA 4MIOA 4F3CA 5MFZA 1T4CB 3C3BA 3WRXA 2JLZA 3BDAA 4DR3B 1D7OA 1HI9A 1QGYA 1AS0A 1T15A 2HEGA 2JFYA 3AOEC 1OIWA 3OZXA 4IDFA 4ARIA 2ZWMA 3FTNA 3L7NA 4UQOA 3NXKA 3ZHVA 1RXYA 3SE7A 1JILA 3CH7A 5DHUA 1II0A 4PLCA 3GLGA 4F38A 1Z3IX 3PGXA 2SBTA 4UD6A 3QKSB 3LBIA 1T3GA 5CM8B 5AKXA 3LK7A 4CLHA 4F7DA 1LVGA 1SHUX 3BGVA 4FBLA 4URUR 4UUNA 3B1FA 3ZBQA 3INTA 4I66A 3VR2D 2ARKA 1NP3A 3MD0A 4FU0A 4KN6A 1JEOA 4Q1VA 3IMEA 4RM2A 3D64A 4QGFA 3UWSA 3D5TA 2LNDA 1E3WB 4I9UA 3GJYA 3WRVA 2P5UA 4YAEA 1P4JA 4AZ3B 1D1SA 5EXSA 5FAKA 2R5NA 3T12A 1P3Y1 1NNUA 3H16A 4Q1EA 1H5NA 1TFUA 1X14A 1WXEA 1Y7IA 2AQ8A 1PRYA 1Q95A 1NVXQ 1REQA 2C8VA 2XI4A 3AYZB 3EXHA 4HX2A 4NZNA 3RVNA 3GLGB 3ICQB 1QHFA 3IH5A 4JBWA 4Z8YA 3QBDA 4FILA 4LK3A 4MV5A 1P1IA 2EDCA 1J5PA 4DWVA 1L5FA 3RVBA 4Q1BA 4Y2TA 1GPJA 3OF2A 4AN1A 1IHXA 3IEVA 3PPYA 2J9YB 1OTYA 2A4MA 2NO1A 2J3DA 3EMDA 3UEOA 1MR3F 3KJNA 2QPOA 4TV9A 4FB4A 5KQSA 4I4TA 1K88A 2IVZA 1T0JB 5LDGA 3SEFA 3B1YA 4S0ZA 1QYWA 2AXEA 1CERA 1NVAA 4EFDA 4UVEA 1YRAA 4HOYA 2HF9A 3LMKA 4WVLA 1L6IA 2Q6TA 2HDHA 1REQB 2XZPA 1VI2A 2XWQA 2E18A 2YVQA 2X8JA 3KB8A 3LT1A 3O6VA 4R2KA 4UZSA 2A8YA 2JLQA 3QKRA 3RUDA 2VS1A 1U2DC 4C0AC 2BHRA 4U7HA 1ZG3A 2XNKA 2RFLA 1JJIA 1GUDA 2NV2B 3IB6A 1CZRA 1E92A 2FZ5A 4TV9B 2PRSA 2BZ1A 4I4TB 2VTVA 3SDZA 4E51A 1A9XA 2C7OA 3BAFA 1N7IA 1CB7A 3H75A 1VSVA 3GRVA 4X97A 3X44A 1XTSA 2HNAA 2B83A 3GDOA 3ZE8A 1Q83A 3G5UA 3W5IA 5F51A 1IEVA 1X38A 1KEKA 1AXEA 1Q57A 1XUOA 1ZUHA 3BH0A 3ZGZA 2BGRA 4FGKA 1TKBA 4J0FA 3A1FA 2RHWA 4C0BA 5F98A 4XYEA 2FZWA 1NBOA 1WQ3A 4KN8A 4OAPA 3AEKB 4TGLA 3I5MA 2PUTA 2O4UX 1QHNA 3H17A 4RHFA 3NH6A 3WLIA 4N4AA 2BF7A 2H2HA 2YV5A 1EXDA 4Q3AA 2RGEA 2BDEA 1KKUA 1XA3A 3D3JA 4FGWA 1L7QA 2VH5R 1TM5E 4OBWA 1UCFA 4YVFA 4H77A 1YKFA 2XZLA 4AKSA 3C6XA 3VPBA 2Q27A 4JUIA 2R6CA 1EWKA 2ZK7A 4P7JA 4QU0A 3OIDA 3BWMA 4D0NA 3ZXIA 5AUNB 5HF9A 2ZJ8A 2I78A 2P9CA 4P4NA 2DP4E 2ODQA 4HH0A 4BRZA 4CEIA 3HDHA 3PG5A 1VDZA 2HYIC 5JQWA 4NU8X 1C0KA 3MCWA 1OCEA 3IAAA 3OJCA 4L5YA 4P5EA 5A6VA 1ZK1A 3F0TA 1IRXA 4GSYA 1A04A 4K3VA 4MGYR 5DT9A 5HDBB 2JNWA 4N9QA 1DP4A 1T9KA 2Q0HA 3UB3A 3O73A 1EUDB 3BE4A 5ENVA 3OX1A 4PYJA 4FZJA 2E1PA 5KYTA 4KMMA 4DG8A 3IESA 4KUGA 2WAOA 4DRYA 1UDCA 1FU7A 4UTNA 4NOKA 4RA6B 1JHZA 4Y6SA 5HQ3B 2E85A 4AJ9A 4I08A 3QVGA 4CEIB 1JMYA 4BCDA 2G5TA 3HJBA 2ODTX 3E5RA 2PRIA 4BPBA 2LW7A 2P9EA 3ND6A 2FWAA 4LJ8A 1YZGA 2AW3A 3KUKA 4RADA 4G67A 3RRFA 3SF0A 3MCAA 1SVLA 2SKEA 1QHHA 2B3DA 3TM4A 1R16A 5E95A 4C6HA 2CUTA 3NHRA 4ITVA 5U4XA 3P9CA 4PC6A 4O6VA 2C1ZA 1XQWA 4XW2A 5TQJA 2AVNA 4G36A 3LSYA 4ISBA 4Y0AA 4UNRA 3OE4A 4X3CA 4AQDA 4Q7JB 1FFSA 3LUHA 1UJBA 1BMFD 2IKQA 3AEUA 1OIXA 2KX7A 3OKFA 3QVGB 5DP1A 4FHDA 2V55B 3VPAA 2ERXA 1E89A 2KYRA 4D41A 2YXDA 3W8FA 4R2IA 4ZQHA 3LHFA 5DNWA 2QN6A 5I9BA 1QHHB 1A3CA 3FOZA 5FOTA 1DFIA 3FSGA 3ENKA 1FQKA 2QD2A 2DTEA 3U13A 3A6LA 3CNBA 3HCFA 1RHUA 4H7HA 4XSGA 4LC1A 3I6YA 2NXEA 2K7ZA 2CF6A 5LLSA 1NKTA 4EPVA 4ZYTA 1HRDA 3EA0A 2Z6VA 5DBOA 1PK7A 2CWWA 5TVGA 3AEUB 2BHNA 3B1XA 2QMHA 3GFGA 3LX8A 1G6KA 1YE5A 1YJ5A 5GONA 3RWOA 5JECA 3LYLA 4MRVA 4FQ8A 1G21A 3IE0A 4QBGB 1DTWB 3IP3A 4I55A 1Y9EA 1P4SA 5IANA 3E7FA 2V54A 1DJPA 1BCSB 1TNDA 4G4SP 3BYZA 4KMSA 1EU1A 2KB0A 3N86A 5T4HA 3VR6H 1F2UB 2H5LA 1YASA 3I8OA 1H2FA 2PVPA 2IYVA 3DOCA 1WUJS 1QP0A 1AJEA 4DE5A 4BZQA 4IJKA 1TJ5A 3ISVA 1B74A 1UWKA 4H3KB 3ZGXA 2OXFA 4UHDA 3ZHRA 4F5DA 1MZPA 2JI7A 2QVGA 5GONB 3IAHA 4ZZ3A 4RO0A 1G21B 3ANSA 3JTEA 1PX2A 1RRVA 2OXEA 2QNBA 4XQ9A 1XMJA 3RSZA 4I55B 1BA3A 4NIMA 4EDFA 4MWOA 2HXYA 2JGEA 4J0DA 1VA5A 3WJ2A 1CUVA 2RI0A 5JC8A 1XZIA 3FSJX 1HEUA 3OPNA 1SK8A 4WNCA 4MULA 3TW0A 3SMQA 3TOXA 3VUFA 2C3PA 1PQ4A 2O3SA 1P5ZB 4Z2AA 5TT0A 1O9BA 2I7TA 3EZ9A 4P08A 4B8ZA 5B58C 1LC3A 4Y0NA 3OG9A 1K3TA 3SK0A 1J1IA 3QBTA 1QQ6A 4KI7A 1SVSA 3GFVA 3R3WA 2CLHB 2GPBA 3PKZA 4IVNA 3PBKA 3R3VA 2Q7DA 3KJGA 3G5AA 1QHYA 3EC1A 3CURA 2R84A 3G59A 4GZ3A 1Q0SA 3D6UA 1V8DA 5AP9A 3V3TA 3NTXA 4G1CA 4FNOA 4UBNA 5KINB 2F55A 3LUAA 1BIFA 3ADBA 1E7RA 3MSCA 4Y98A 1XR3A 3B5EA 3QVWA 4YP0A 4D9FA 4JX8A 3W2GA 4CLEA 3I3SR 4EEXA 2ZI6A 3V1YA 3IVRA 1DBRA 1JFFA 3MUNA 4BASA 5LZ9A 1DARA 2I3ZA 3A1NA 4DEXA 1ZGJA 1K7CA 3LCMA 4E4YA 4G84A 3QUQA 2WJWA 1UBRS 3EWAA 4PANA 3WRYC 2YOFA 3GRRA 2MU1A 2FZLA 4J07A 2Y1EA 3KCQA 3QI7A 4LWQA 4MEBA 1KDPA 2BFFB 1P4AA 2GM9A 3D7RA 3KV1A 3N2EA 4DUGA 1QXSA 1YIDA 2ATEA 3JAMA 5F12A 1H0HA 2ONJA 5AKYA 3GEDA 5DM60 1HDIA 4N8EA 2XYPA 4K05A 4RPCA 2UUPA 3KEOA 4OIFA 1O9GA 2A9FA 3LK6A 3ZW8A 4D4KA 4BNNA 2NG1A 4Y18A 1Y3BE 4URVR 2BFDA 2IELA 2J0EA 1T9CA 2OMKA 2AFIA 2RH8A 3D4PA 4MARA 4QXRA 4XFJA 3S29A 5I8PA 3STHA 3PUIA 3INYA 4KJZA 1JKJB 4TWBA 2D0OB 5T8KA 1L7XA 2JCSA 4C5CA 1RXWA 3TL2A 1I80A 1MTOA 2KMLA 4MW4A 5DM4A 2C98A 1H0RA 3CEMA 3UK0A 1L7VC 1DO0A 3BXFA 5ARCA 5C4MA 4CVNA 4FSDA 5JCJD 3GPDG 3JRWA 5CD1A 2QLFA 4G23A 5J5CA 1F7UA 4JHXA 3W1VA 2QQEA 2BFDB 2WFZA 2X41A 3MT0A 4ZAXA 4A82A 1SVNA 3ADCA 8MHTA 3H6GA 4EHKA 1XYGA 4CTJA 5K09A 1BW9A 2BFOA 2DY0A 4YJGA 4QHYA 1PFVA 3DBOB 5TF4A 1CQZA 2Z4TA 1MRSA 2B92A 1A50B 1IZ8A 2XNSA 4PNZA 5KYXA 1ZRSA 3BK7A 4LFAB 2PZAA 1TM4E 4TZTA 4UULA 3ONWA 3PFKA 1JLRA 1ETHA 3PC6A 3FI9A 4DIBA 4UFPA 4E03A 4DABA 3DDOA 2VDUE 3Q9NA 4TRRA 1YOVA 2CDRA 2F1OA 2HF2A 3P0HA 3HTXA 1JIVA 3FRHA 1JNXX 1WSDA 4AROA 4G0XA 3RIXA 1I4EB 2GHIA 1LB1B 3AUYA 4HB4A 4I4NA 1BW9B 4U2EA 2QQFA 3DTTA 5ERGB 1YR1A 4HR7A 3HSYA 1NMYA 1RCUA 2E37A 5F1YA 4BEVA 4GLFA 1K5PA 4MUMA 5KYXB 3G8BA 1N6IA 2YKGA 4DSUA 4J0KA 1A9YA 4BC1A 4I5IA 4BQNA 2IX9A 2VPTA 4QELA 1Q84A 4EGQA 5CFOA 1UP6A 1E3QA 2PQMA 3STTA 4YT5A 3WWYA 1VJTA 4NDAA 2N47A 3RRMA 1JKMA 2OCKA 2MSNA 2VDLB 2GO7A 2ZEJA 3CE6A 2A5FA 3NNNA 2X19A 5B3JA 3S1LA 2AXNA 3IVMA 1XI2A 1IY2A 1HDCA 1E7MA 1M8JA 1QLWA 2IQIA 4ZCIA 3GMIA 3AMVA 4PBSA 4L78A 5CT9A 2N0SA 3H7AA 2UYQA 4G9EA 1KVQA 2F3SA 4DDMA 5BNZA 5CGQB 2GBPA 3ZE0B 2IDJA 1JJ7A 1YDHA 2P62A 2V3VA 3HO8A 3PTZA 4JCCA 1AU9A 4WVFA 4AWAA 4B33A 5BSUA 5KJFA 5CBKA 4BP9A 2QN9A 3TOSA 2Z8YM 3DVRX 4N3AA 4OJKA 2ZIEA 4S0XA 3KOUA 4L16A 1EUQA 2WP0A 3A6HA 1CR2A 2ZKIA 3K15A 3CNHA 3OQBA 4L22A 1ESCA 4F71A 5BXYA 4UVIA 4OKIA 1Z0DA 421PA 2XB8A 1GL9B 1RR6A 1DELA 2ZWOA 3EW7A 3ABRB 4LZPA 4KV7A 5LZ5A 3RK4A 3SEAA 3QEBZ 4DB4A 5CDUA 1G7TA 3ENWA 4OATA 1WETA 5IYZB 4UMFA 4YY3B 2BMEA 1N5LA 1EEXB 2QMQA 3TZLA 4K86A 2Y76A 3MPUA 4LBZA 3DE4X 1LK7A 4NNJA 4BGUA 4RMJA 3LL7A 2ZXUA 1HO3A 1CT9A 2RJOA 4O08A 1XDWA 4NNPA 3RHTA 4BO6A 3I30X 4PAGA 4JHLA 4J0JA 5GY7A 2BH9A 5EGSA 1MAVA 4P34A 4I4CA 2QAIA 2EOAA 4Y9UA 1AV7A 3J7AC 1YR6A 2RHTA 1RYYA 2R5FA 4JBHA 1U7TA 2E48A 2GZ3A 5CNIA 3EHEA 3GLTA 5B3KA 1F5NA 2PZLA 1XHEA 1SUCA 1Z83A 2IOFK 2UKDA 3BD6A 3FCSB 4I36A 5IU6A 3ZOKA 3MCVA 4EYSA 2LUOA 4E5MA 3P5SA 3WL7A 4JAVC 3EYWA 3U0VA 3F73A 1T3TA 1QIDA 2GLTA 1IE3A 4LWOA 1LV8A 2R6GA 5CD9A 3EASA 3RRNA 3PFGA 1JIQA 1O57A 1JU4A 3X43A 2QX9A 2IH4A 2D62A 4MOWA 2WB2A 4RK4A 3SHWA 1T9DA 2W2KB 1NUSA 3THRA 3JARA 2HK6A 2AXPA 1GL3A 4OIMA 3I6QA 3L0YA 3A10A 2V6BA 4G0ZA 3L01A 5CH5A 2PZJA 4B47A 3HBAA 3W9BA 4TZKA 3MRTA 3KZCA 4L9AA 2AN3A 3RJ5A 3WE7A 3UHOA 4Z3OA 4IQ0A 2GDJA 1C81A 3W9YA 2Y2UA 4DJ5X 2BI8A 1DCMA 1ESDA 1NBAA 1NXVA 4RFLA 5ELLA 4ALNA 5KTRA 2R6HA 4JP2A 2JA2A 2XSZA 2HPZA 3QUTA 4NFLA 4YCSA 1J7JA 1X87A 2DCMA 3KJQA 1SVUA 3ND9A 4FMCB 4KXMA 5EIBC 5I7HA 4R1PA 3ZEAA 2CB0A 2R1VB 4PHCA 3IGFA 1O8CA 1OBVA 4N5MA 1XEXA 4OH7A 4XQCA 5EC8A 4QARA 3U4HA 3OJ0A 1P6UA 1BKSB 3Q5GA 3Q8WA 1QIJA 2WNIA 3PI6A 5GIOE 3OFJA 4GMGA 2DFTA 3NIGB 3V1KA 4EW6A 5CB8A 1U8XX 3QE9Y 3SE0A 4R7GA 1AKVA 1NIJA 1M0WA 2C2WA 2H1RA 1KFKB 2WUVA 2ZCUA 1AC5A 3DDNA 4LC9A 5CNMA 3BGSA 2C1EA 2FPMA 3DVSX 4YRQA 4WA8A 3WBFA 4L02A 3EXG1 1OOEA 3DMRA 1K8QA 2PCLA 1J42A 1MU0A 2A9QA 3AV3A 1HE5A 3OFVA 4YC7A 1DQPA 3RKRA 4A36A 3TIVA 1FUIA 2XNJA 3L04A 4IZOA 8OHMA 1NBHA 3IHWA 1PL6A 1FLNA 1U80A 1PUJA 2IFTA 3GCXA 2I03A 2XDYA 4HX5A 2GKOA 1FUKA 1K66A 2EZUA 5B4VA 1O96A 2JAPA 3DOFA 1RU3A 1R7RA 4NAHA 1KXZA 1DG9A 1PLJA 1TJNA 3W6ZA 4DV6B 3T3NA 4Z7OB 1Y5MA 3QLUA 5BVGA 3FKQA 2JI8A 4BNXA 1DAOA 4FFMA 1CY4A 3SJAA 1SH7A 1QH8A 1RPAA 2WD9A 4BE4A 1UUFA 4UDXX 1L1FA 2V7BA 2XTMA 1L7AA 1X1RA 1AK1A 3K5IA 3AW9A 3E3LA 3IV6A 4PZDA 1T0IA 4E1AA 4EY3A 3UWMA 2PQ2A 3OAAA 3UWKA 1N1GA 5KC8A 5JTUA 1Y7PA 2QORA 3NW9A 3RV3A 1VPWA 5JS1A 3TQIA 3N8GA 3GJ7A 1R0ZA 1HQYE 1PJZA 1T3ZA 1V5GA 3GEIA 4UXHA 4BQOA 2I1LA 1XRJA 1MHPA 3OE5A 5HF8A 4O4JF 4E11A 2QR3A 4LF6B 2QUAA 3ORRA 4QYXA 5DZSA 3RGWS 3VTZA 5EJAA 4BLQA 5BVGB 4G41A 2O2GA 1DZ3A 3KVVA 2R79A 5LB2A 1QYVA 5JRDS 5JBQA 5LMUB 1N0VC 3R3UA 1QC5A 3CGWA 4EA6A 4DR2B 2F1JA 3FNBA 3H5IA 1H5QA 3FZEA 1FTSA 1HDXA 4C21A 2Q3LA 2FPIA 4FCVA 3RT1A 5BV7A 1J1UA 2GCOB 3M8KA 2FU5C 3FPLA 3D8BA 3D7NA 3IUEA 4NJEA 3AB3A 3CLRD 3F7MA 1WIWA 2FRDC 2P2GA 3FUWA 4FE7A 2WY2D 3SLGA 3LVBA 2JD2A 4CLXA 3OC6A 2CFSA 3KXLA 1SB9A 1BXRA 3D4OA 3R2JA 3FETA 4G8JA 1YQGA 3ZCQA 2E1RA 2Z5GA 5D3QA 3VVMA 3P9NA 3ZXXA 3ZVMA 5IVDA 5DI3A 3FZGA 2HA5A 2YICA 4PXYA 4QOJA 1O6CA 1QC5B 2JFQA 3GFBA 1FTWA 3ZS9A 4V3CA 3RFVA 3UV7A 3CT6A 4XVCA 2GD2A 2IH2A 2Y0EA 2HJGA 4J6FA 1L5RA 4FQ5A 4NJEB 4S24A 5CRIA 3SEQA 1TX4B 3R41A 3RU9A 3AF5A 2J9ZB 4NRDA 1VJ5A 1U1IA 1Z0FA 3KZKA 5ERYA 1J49A 2ETVA 3RCBA 3UXHA 4EJ2A 2D1TA 1BXRB 3LECA 3OF3A 4QXQA 3WGUA 1G16A 2A9PA 1THGA 3JQBC 1EA7A 5DI3B 4ZCRA 1Z7EA 3I58A 4QAQA 2QUBA 4Z4QA 2IHNA 4DHEA 3RTEA 4EFNA 3QLVA 4RTOA 1OD6A 3AF1A 1ZH8A 2YVUA 3K6JA 3U7HB 4FI3F 2D2EA 3ORHA 5IDWA 5LVAA 4P86A 4LZJA 1B16A 3DTYA 3EQ2A 1GU1A 3KU1A 3GARA 2YFYA 4RZSA 5G1PA 1M72A 3RASA 2BHLA 3A6ZA 4M87A 4L4SA 4U0JA 1OY1A 4BNLA 1AXRA 1NY6A 4FFNA 3PQ7A 1IG0A 2GCGA 1DJQA 2O3UA 3LQ1A 4EUNA 1NX6A 1ZD8A 3LW7A 3RANA 1NUTA 5AW6A 1PYOA 2PUWA 3DMTA 3TECE 5ENDA 2J9RA 4NL4H 4YJ2A 3TYXA 4ENVA 2V7VA 3DE5X 2JJ1D 2FEKA 4UBLA 1Q7BA 4WXPA 1VKZA 5JYBA 3SP1A 3S44A 2GF9A 1Q7RA 1JJAA 2N3ZA 3G9UA 3DAGA 1LFAA 2VRWA 3CCCA 5IBRA 3EG9A 4K8OA 5EWJA 5THQA 1DBPA 3TD6A 3B1WA 3UPTA 5J3JA 3EF1A 3RYCA 1PFQA 1RJ9A 4BU1A 1ZMTA 3JWIA 1FP7A 2XH8A 4XRGA 3I23A 3G0GA 3OEYA 4M1SA 3CN9A 3KZXA 4NX2A 1ORWA 2VZEA 4Q05A 4WH0A 4WY5A 5IAOA 1MPTA 4YJ2B 1OA1A 1AXGA 4L2IA 1UJMA 3CN7A 4KQHA 1G9XA 4FT4A 4MJLA 5B12A 4DUGD 5AQ1A 4EARA 1GITA 2FEMA 2YHUA 5CFQA 2IWHA 1I6MA 2E4AA 3E7DA 4QODA 3QVVA 2I4LA 4D4JA 4V0ME 4HXYA 3TN7A 1RJ9B 2H85A 1FB5A 1E9SA 1PZNA 2Q5FA 3N1UA 4QUGA 4EHBA 5I4IA 1RRMA 1KZ6A 2W8BA 3EQ9A 1A71A 3WKAA 5EIEA 2FG7C 3R09A 4DTIA 1ZXLA 2I9PA 4D43A 2GD0A 2F1HA 3HCEA 3M33A 3K53A 3VHQA 5FLEX 3K8YA 4G0UA 1U31A 5AW9A 2FWJA 3EXFA 4L2IB 1UMDA 1Z17A 2XQFA 3D1JA 3KSZO 1BS2A 1EBFA 4FYHA 3T5CA 3WFZA 5ICMA 2PX2A 3FCXA 1HQKA 3OPYI 3T5TA 2PV7A 3GJ4A 1RWOA 1L6RA 2HCBA 3PITA 4IOKA 1DRJA 3HB7A 2WHQA 3W2HA 1DWUA 2W4IA 3QPAA 1U9YA 2XDQB 1WF3A 4HDNB 1U3VA 4FFDA 3GL9A 2BRUA 2W8BB 3GPIA 4L57A 1OTHA 2Q1WA 5EHZA 4NE2A 1EX6A 3JQ9C 4ZYYA 1DIGA 2VQ3A 4Z0HO 2WMDA 4MQLA 2IU4A 4F5WA 4JROA 3VNAA 2YZMA 1ZW1A 2ZIXB 4EA9A 1A95A 1I10A 2UZAA 4JEIA 2GT1A 2WJAA 4W5JA 3URKA 3IA2A 3H11B 4LQDA 1L7RA 1E62A 5LP1A 3P4XA 1AO3A 1NUPA 1S9HA 2FWPA 4QYTA 5IS2A 4MV6A 4MVWA 4FD3A 3COVA 1TU3A 1CU1A 2HU5A 5K3SA 4W5HA 1Y3DE 5K3EA 2IKSA 3GGPA 2QRGA 1ZL2A 2PMEA 4WJLA 2C4WA 1JRLA 1P0CA 1PR0A 4GZ5A 4H1HA 1T6BY 2XMRA 2PSHA 3P2JA 3TTTA 2DR0A 3E58A 1EZ1A 3MTIA 3ZI4A 2PANA 2ZJ5A 4WXEA 4II7A 4AS3A 2HSDA 3L5KA 4HQOA 4Z4GA 2I3GA 4N0EA 1PS0A 4MB0A 1L8QA 1USGA 1G8MA 4I1IA 2BH2A 4RHCA 4V2UA 4P33A 5BPFA 1S7GA 1XBTA 4LI3X 3GK3A 2LCIA 4REOA 3QPVA 1PFYA 1N2EA 2GI4A 3C1TA 4L74A 3L8CA 3V2HA 4TN1A 2CJWA 2CXOA 3P9QA 4M0PA 1CNEA 5FAXA 4PGFA 1C2TA 3FLAA 4IEEA 5FIUA 4C0XA 3CVVA 2FE1A 2C2HA 1DRUA 4HFMA 4QKQA 5TRTA 1L3IA 4YX9A 5C1PA 3TZBA 1PF7E 1KNQA 1CIJA 1OU0A 3M89A 3QXGA 5LZ8A 5SY6A 2H7YA 2YWHA 1LZLA 2VXBA 3BWBA 3FYUA 4DAOA 2AJCA 3KB1A 3ZY3A 1OXBB 1RAIA 3KYDA 3NIWA 3GRAA 1T1JA 4KH0A 4MYHA 4RVNA 5D8DA 3SKYA 3UJHA 4EY4A 3AR8A 1GPDG 1ZRMA 2C3OA 2QHXA 1AHHA 1SBNE 4KQFA 5JSHA 2WHPA 5ALKA 5FLYA 3MYRA 4YQZA 1WBBA 1ESMA 1DWQA 4M9SA 4RWEA 1MT0A 1T36A 3PFCA 4E70A 4QU5A 1K8RA 4OK5A 4ZO4A 1ZQ9A 1W7AA 2X4DA 1ZM4A 1S3SA 2Y6VA 4KWTA 2OWDA 2M6LA 1NUAA 3VH4A 2AB0A 4EGJA 3FYUB 1KC3A 1HTTA 1DIAA 1R0RE 4ZVMA 3FFAA 4PSAA 1J7KA 1MVOA 2OXTA 3SR0A 4K3UA 3KTAA 3L7YA 4AY4A 4D8VA 1L7NA 5K4AA 2R4UA 3R6DA 4UD2A 1VKRA 2Q1SA 1OFUX 2WHPB 2X76A 3HDJA 1U1FA 3O94A 3REOA 4CF4A 4CIAA 1VHQA 1TPYA 3ILXA 3L4BA 3ZNNA 2P4SA 1YVEI 4TWRA 3MFQA 2ST1A 3QTBA 3TE6A 1K3UB 4CXMA 5JCOA 1PT9A 3D0QA 4A2QA 2IYFA 3HYSA 2XRYA 2ZB4A 2FSGA 3CYFA 4FYWA 5AHRA 2P4UA 2HRDA 1WSAA 1PZGA 3BIOA 2IF2A 2ZRPA 3IDSA 3IKVA 3IKLA 5TPZA 4DWWA 1EAYA 1XKXA 4F1WA 3KSBC 3JQ8B 2I34A 2F4VB 3PFIA 1M2EA 3B5JA 4M8LA 5BN4A 3KR9A 3LUDA 2H4YA 4QOIA 4M1KA 1J0CA 4FE4A 4FGZA 1W2HA 2UYYA 4R1MA 2DC1A 1RIFA 1SY7A 3UQZA 5A02A 3K9FC 1OWOA 1F06A 1FRNA 3OQIA 1Z82A 2FN9A 4XE5A 3Q8XB 4ZI7F 5FA8A 1E7QA 1KSFX 1SKQA 3JQGB 4JLUA 4NABA 2FLKA 3WKEA 2VKTA 3TFOA 2YR0A 5I47A 1QYRA 1UIMA 2P9FA 3FF4A 3JD1A 1XSEA 2JJ2A 4TSRA 4V02A 4BFCA 2V58A 3P2OA 4K9NA 1VGQA 2V59A 4EY8A 4NATA 2I2CA 5EWLA 1SBCA 2Z56A 3FRIA 3WL4A 4ZI2A 2WJ4A 1KJIA 1V7PC 1GNRA 4FR5A 1MFZA 2Z2YA 5BN4B 3LDFA 1NU8A 4W8GA 5A06A 2WE7A 1G5IA 4UEOA 3GG2A 5GM2A 2WM9B 3VUEA 1QZTA 3H0EA 2PM8A 4R5HA 4Z1MA 2WJZB 3OQIB 4M1OA 5T6MA 3TLGA 5J9FA 3ODGA 4L4YA 4LRSB 4G25A 1NXTA 2HDNB 2ZSUA 4RXMA 4GP6A 1YMVA 4K6CA 3FDIA 3TSOA 4AJ2A 4MWEA 5K8TA 5EWLB 2FHSA 1PNQA 1NR1A 1XN4A 2A78A 3TKLA 5BMVF 4A6DA 2RH9B 3KQOA 4YWHA 5K3CA 1ECGA 3HU1A 2QVCA 4N5HX 3QEAZ 2CNLA 3B6JA 3HJTA 3B82A 1JPVA 1FLVA 4OAOA 2XGGA 2OT3B 3EWSA 2F1RA 1GKYA 3U19A 2H1LA 2J7PD 2ZUTA 4P8RA 3PHLA 4TMWA 2HBRA 2Z2XA 4X8OA 3OJXA 3TLGB 5IRCD 2W71A 4NBUA 3T52A 2ZR7A 1QLJA 3O90A 3OZTA 1WSBA 1WVMA 3LRTA 2C9CA 4ZT2A 1IJBA 3T3IA 1ZA1A 3LCJA 3WMEA 1PJLA 1KEZA 3HFGA 1OFGA 1IZ0A 1POWA 2FFRA 4NG4A 1RI5A 5CGZA 4K28A 3UUGA 2O05A 2XUOA 1UAGA 2NQ2C 1QAOA 4DZTA 1UBNA 5AVVA 2BM8A 5JS8A 2DUWA 2Q9UA 3PQDA 5ICGA 1Y5RA 3VDNB 1CRWG 2DEUA 4DIFA 2FPXA 4N39A 1JF8A 3FF1A 1N2CA 3AR2A 2NZJA 5HPYB 2OLEA 5DLPA 5COQA 2ZSHA 4JVNA 3M4JA 4HSGA 1Y1LA 2H92A 1FYFA 1KK1A 3H2HA 3NV9A 4YUAA 5B57C 1DKUA 3KALA 2ZU0C 1GGHA 2XY4A 3SNKA 4O4HF 1G8SA 4OK3A 3UAZA 5BVHB 3IEIA 2OQIA 2XF8A 5FTWA 4L7VA 5EPOA 2WSSA 2ZULA 4N7JA 2HF8A 3W5HA 2W4QA 4R8LA 3S81A 3UJAA 3QYFA 3BULA 4WTOA 2A94A 3D02A 1VECA 2YWJA 4DEVA 4QG3A 1O94D 4JI3B 3FOEC 3I5YA 4FYKA 3TLAA 4OLBA 3SZGA 1XP5A 1A5SB 1DHRA 4CL0A 1T5TA 1C1XB 3DZIA 1N2CB 4BX8A 2EJCA 3P9XA 4ARCA 1H94A 3TDKA 4B09A 5AXAA 1RS0A 2AR9A 2GPTA 3KKMA 3TIXB 4AAYA 5JQGB 2BR3A 4DMFA 5C2JB 2NZWA 3JYNA 1CIPA 4NBSA 5F73A 3IP6A 5B5SA 3BJZA 3BUSA 4YMLA 4IMRA 1OFIA 3FA2A 2A1IA 4Z54A 4RDXA 1Q15A 3V7YA 2WTAA 1SWWA 3SXUA 4C0WA 2O23A 5K2OA 3NLLA 2FTKE 2ZTMA 3U56A 2G25A 2P6PA 3HKDA 5CURA 1F2VA 5DM1A 1LBHA 3MA0A 3VDXA 4AG3A 1E0KA 2Q99A 1Z2DA 3KSRA 2G4VA 2GZ2A 2YY6A 3EBLA 2Y1KA 3IS3A 5FWAA 2VJAA 3P97A 1A9PA 1MAWA 1VSTA 4IXDA 4UVHA 13PKA 4RFSA 4L85A 1DDIA 2JFFA 3MGAA 3J81A 3IUMA 1K8YB 1A0OA 3O38A 1NTOA 1QOPB 1VB5A 4KLNA 5I5GA 4W99A 5AVRA 2VR1A 1ECJA 3LPDA 3JWJA 2GAFA 3HKDB 4Q9DA 3A1TA 3V46A 2N1BA 3EDCA 3ZGLA 2H31A 4MI3A 1NV8A 4LQCA 4O4JA 4EW3A 3AC0A 2FI1A 1RKBA 1FC0A 3GO4A 3OEED 3V4RA 3ANYB 3U5ZB 5DYIA 4JJEA 4M86A 1CZUA 5FUVA 1VIYA 3EZ6A 1U7HA 3VOBA 4EA8A 3W2FA 1QCDA 3L49A 4FYMA 4CEHA 1U0SY 3RG8A 1JHXA 3BMQA 3H7IA 4NS4A 3GHHA 1TMOA 5IM4A 3LGXA 4O4LF 4ZCTA 4HYQA 4UDYX 5L3ZA 4H6PA 3QSYA 2ENWA 2GPJA 1P60A 4AMZA 4E09A 3HU2A 3WDLA 3AUUA 2DH6A 1RI3A 4BKPA 2PYIA 3F3YA 4MHOA 1RWKA 2SHKA 3IXQA 3LY7A 3NBYC 4MUJA 4ZAWA 1GUZA 5BQXA 3CEPB 1T9GR 5B1HA 1G7SA 2XUAA 2CZGA 2SECE 2GN2A 2JVJA 1V5WA 1AT1A 1JG6A 1R0BA 3FIJA 2WOJA 3BCHA 4DJJA 5JANA 4NEGA 3PQCA 4OJTA 3BSFA 1ZUD1 2O8FA 4XXHA 1PR9A 3AFMA 5JXHA 4DMHA 1GOTA 1OFTA 3OO0A 4FXOA 4HNHA 4CEHB 3KYCB 2QJTA 1OUMA 1OROA 2GPWA 1PT6A 4ZWNA 4LJKA 4GI7A 3SHOA 2J3EA 2VP5A 3KQUA 2CMGA 4GKKB 2FRXA 2VPIA 4W5OA 2BI7A 1JAHA 3FCCA 4IIUA 4Y2QA 2QTLA 2HO5A 3U61B 2BEVA 4QU8A 4HEJA 1Q0RA 4RDIA 5A9SB 1UWVA 1KMIY 2X4IA 4BP1A 3PHGA 1NQVA 2IEGA 3LQYA 2W4MA 3HZRA 4KL8S 3ILVA 2O8FB 3DVQX 1UINA 3JVUA 5CX4A 1EWYA 4BMCA 4B75A 3DOHA 2J5KA 1RC1A 4UM8B 5CLHA 3VDMA 4GEKA 1U8FO 2GILA 1XCMA 2ADFA 2ZTUA 4BLPA 1G5PA 1SZCA 3TNDA 4F9TA 3Q0EA 5I48A 1U2TA 4D4IA 4URFA 2FX3A 1ZJ6A 3QFCA 2HK7A 3V8BA 2G28A 2WD7B 5JE8A 4RH0A 3ZX4A 2ZYAA 4YV2A 3Q10A 1G5HA 4C22A 1MOZA 1U9JA 3DBVO 4INZA 1A5BB 3D0RA 2XQVA 3JATA 4JGBA 2W2NA 4A0SA 4IDQA 1ZD1A 3VOTA 2BGUA 4BNDB 4RTLA 1IATA 3UYKA 1W1WA 1XAIA 3R0IA 3TDMA 3HWWA 4UHFA 4C4AA 1ISPA 1G64A 5E7JA 3O2NA 1KO8A 1F8UA 3A36A 2QY9A 4G86A 4Q03A 1QFZA 1U5BA 1HE2A 1XWIA 4GX2A 3U6KA 3ZHSA 3KT8A 2F3RA 1XU4A 1JYFA 4G9BA 3HGMA 4DR1B 4WW0A 3B5IA 1P18A 3OFND 1DQZA 2HMVA 2WHRA 4GD3Q 2C7RA 3FJOA 7AT1A 3INGA 4TT3A 4BMYA 1M7GA 5JJIA 3DTVD 3QW2A 2JAQA 3THSA 1GQSA 3ZWOA 4TYYA 1Z4IA 1ZD2P 4MDEA 2I7VA 4EPXA 2YMLA 1N9KA 3JSXA 1T8YA 3MJSA 1CYEA 5FORA 3DWIA 1CX9B 3UUFA 1JT9A 2OCBA 3DO6A 1Y63A 1U5BB 2Q0QA 3F4KA 3GAZA 5L3SA 5TSDA 2DPHA 3AOEA 2V74B 1ZCAA 2PD3A 1VP9A 2OQVA 3OZFA 2EQ5A 2V7PA 3EE6A 3O84A 1X9HA 3PRHA 4FSXA 3PX2A 4RAOA 4BQSA 3DAOA 5G02A 3OEHA 1D1QA 3IBGA 4MGKR 4OKNA 4YREA 1E4EA 1UFQA 3Q2KA 1VMEA 5DNYB 1I14A 1NQTA 3IJPA 2DHEA 1KPGA 2I87A 3ZIDA 4EITA 4HNVA 4HNTA 5LA6B 4GW3A 3OZVA 5JAQA 1DJNA 4OQNA 4YPFA 5GV8A 1DJLA 3CR7A 1A4RA 1K6EA 8ATCA 5L3SB 4CIBA 5AW1A 4WXMA 3M2PA 3C8DA 1WPQA 1LVHA 2VK1A 1C41A 1JA1A 2UVDA 3K0HA 4I8IA 4L76A 4ZICA 3V9AA 2PL1A 2FA9A 2KE5A 4LHEA 4KQIA 3G5TA 1EFRD 2A59A 1JHUA 2YN2A 3IIEA 1U7PA 1DC7A 3QXJA 4AJPA 4TWIA 4QQFA 5FV7A 4MV3A 3D0OA 5ALOA 2J0SA 1R9GA 3QIVA 1LDBA 4IGKA 2CK3A 4ZPJA 4BFVA 2HSZA 3I2FA 2FK7A 1DOHA 4UARA 4R40A 1XZJA 3DFMA 3EA5A 3H9UA 4RMGA 3ZDFA 2ECFA 5HNKA 4ZVVA 1X77A 2PZEA 2O7QA 3TRDA 5A4IS 2H7CA 1I7QB 3B7PA 2BEJA 3GEBA 4P0TA 5JALA 2J07A 5IJAA 1Z29A 3N8HA 1N3LA 1ODSA 3UG7A 4X66B 1XAGA 4BQEA 2TMYA 3OSUA 4R31A 1JHRA 1BFUA 1BYUA 2OHFA 3CH6A 3PC8C 4QXMA 2XEXA 4TMYA 5AUPB 1VSQA 2GMWA 3DL7A 4PIPA 3S55A 4I6JA 4DZRA 1XCGB 5K45A 5TVKA 1XALA 1X3LA 3FUTA 3KXKA 3OE1A 1T29A 3M34A 1MNAA 1FRFS 1U2RA 2Z57A 2ZVDA 1Z4MA 4IILA 1GNTA 3QENA 2ZE5A 1FFGA 3OU6A 3ETEA 4XJXA 4YA6A 5LQRA 4QTZA 2BGMA 1EIZA 4NJMA 3IE2A 1E9EA 3CVXA 2DPGA 3R8CA 4BFYA 3N70A 2IXBA 2V7QD 5JPDA 4XPIA 3AJDA 2DQZA 3FR7A 1TIPA 3HC7A 3GNSA 2A7QA 4LPSA 1XZNA 2B4KA 2VHTA 3ZE6A 1G8YA 4OI2A 4WK6A 3AGPA 4KNWA 3OTWA 5TT1A 2H2FA 3TAHA 4BAUA 4TPKA 2XX3A 4A0FA 1SIOA 1C9DB 3IOEA 4RXTA 2YJ3A 3G5MA 4IX9A 4QJ5A 4TKUB 1MTZA 1XF1A 2Z8ZA 4IOLA 1KI4A 1EE2A 1N6RA 4EDHA 3PV0A 5JC1A 1AHPA 4FJ0A 4YMTA 5AW0A 1A97A 2F3QA 3CW8X 2K87A 4I14A 2XUFA 3V1UA 1BFKA 3LC0A 4KDEA 1W581 3QF7A 2ZBUA 3C5VA 2CNWD 3R3XA 3RSGA 4F5YA 2JLRA 3BL5A 3K9QO 4BJHB 4DCMA 1APBA 1OX6A 1NE7A 1FFHA 2W6PA 5E9JA 4GI5A 5KNCA 2H3EA 5P8WA 3NDRA 2C42A 3A26A 4U8GA 1TW2A 2V9PA 3R7LA 4QYSA 2QZZA 1CFJA 4UBOA 4JFRA 3UAWA 3OHSX 1UBTS 3MWKA 3W5UA 3ED1A 1KI3A 3VQTA 4Z1MD 5C1DA 1XOIA 1XCBA 2BEUB 1MN6A 2WPNA 3TJRA 3U2QA 1TDJA 2ACVA 2VZ0A 4EZBA 1GRCA 5FUMA 3PDIA 1NL3A 3O31A 3LF2A 4HAUA 4RCZA 2RHCA 1NVWQ 2QUHA 3FZNA 3ZV4A 2ZSFA 3TGPA 1YI1A 3T0IA 4OGKA 4XJTA 1QKJA 2VBFA 4KN9S 2BE7A 2YV4A 4WBNB 2VAVA 3AR9A 3EGXB 3STUA 1EGMB 3CJQA 1HL7A 3LU1A 3NNDA 3WLMA 2WJHA 3H1PA 1LJUA 2Y9MB 1XN1A 5FPSA 3VKFA 1RWXA 4Y2HA 1TCBA 3LL4A 3PWZA 3HZOA 3CF4G 2E2WA 4MICA 3RLIA 1J33A 1BQ4A 1G8HA 1IM8A 1O54A 2PFGA 2WDPA 3EC7A 1XWWA 3DM5A 4J90A 3AR7A 4ZREA 2O3TA 4W7SA 3RKUA 1EVQA 4FCCA 3ILSA 3OEWA 4M0LA 4FT2A 2W6ID 2OFOA 1ADBA 2VSOA 4JP3A 2HMWA 1D2GA 3C8UA 2JK0A 4NMMA 4DLNA 4F4IA 1HEYA 4FMBB 1Z45A 5DSXA 3SYTA 5E4FA 1G42A 4CM7A 2IYOA 3WHPA 1RZRD 4BEBA 4LQLA 2CHQA 4JB3A 5DLDA 5C7IO 3KLNA 1E6EA 1NVKA 3F6CA 5BT9A 2ZIAA 3GWZA 5JPCA 3MJFA 3RFTA 1TU4A 2ENUA 1YB4A 1QAQA 3JPWA 3OUUA 4JLBA 4ZO7A 2XBMA 2H7VA 2ZBGA 4I9HA 2C57A 3DBRA 2JVKA 2BP7A 2HQ1A 3BA1A 5JHGB 5F23A 5HR5A 1AMUA 4BNZA 4EB6A 3AV0B 1R12A 3SMVA 4HWTA 1UBUS 4D9HA 5FR1A 4D92A 4UM9B 1YJAA 4IEIA 5J4KA 5AJTA 1KFCB 4L8WB 1CR1A 1CW2B 2FR1A 4LXXA 1R5JA 3RJTA 7ADHA 1Y6RA 4DLYA 5G3ZA 2UUBB 5BMVA 3CF4A 3DQPA 3O5AA 2OD2A 4CT0A 4YP9A 1INLA 3S27A 3D2CA 1WDMA 1Z6YA 4BP8A 1SXHA 3R7WA 3DBRB 1TVMA 1Z6GA 1BMTA 1JFRA 2BP7B 4WESB 1G5FA 1A2BA 1AZTA 4ZHQA 3AXTA 4I2VA 5DKFA 1L5MA 1VJRA 1J2RA 1D2RA 2Q0XA 1XFDA 4HHEA 1WDWB 5HRUA 4URHA 5E6SA 5AVSA 5LFAA 3KQPA 2P67A 4UBKA 4RBNA 2PGAA 3H0KA 3WNDA 2C0CA 2WSBA 3PUWA 1S5PA 2AK2A 4LEIA 1E98A 1H5UA 3R7WB 1X1BA 4US2R 2IL1A 1CF4A 1SD5A 4FHZA 4O3MA 4ZHQB 2IW1A 4LOAA 4ONEA 3P9PA 2FWRA 3NAQA 5E6SB 1W59A 2ZE7A 3WKBA 4PHTA 1DPGA 2TYSB 2BKAA 2XLBA 1BS9A 1G2IA 3K92A 4LDQA 1YRBA 1CTQA 1UXGA 4EMBA 3RVMA 4X6UA 2XCIA 1EFUA 2ZAYA 5E7QA 5PNTA 4BYGA 2LXNA 1JLLA 3FXAA 1I3OA 3R40A 4PG6A 3TUIC 3UHAA 2RGWA 3NUZA 3HA2A 1RLIA 5AKZA 1GPUA 5AI4A 1P7WA 1TCAA 3UKJA 2H1FA 2JIZA 2HBQA 3H9EO 3FCAA 4KO3S 3WGMA 2UZ4A 3KE8A 5K05A 2LPMA 3HKCA 2PT9A 1WW2A 3D8HA 3G9TA 2WWTA 2D59A 3WRYA 3L6CA 4FMPA 4QUBA 3KKPA 4DCPA 1D04A 1KNXA 2I5PO 2QPTA 2XUDA 4BJ3A 5CNJA 4ESVA 2YCBA 3OQMA 2X1LA 3GGOA 4A5SA 4QD3A 3A3YA 4OAQA 1RRPA 3BWEA 1JLLB 5IC4A 2JIBA 1DOZA 1AN9A 3H8WA 1F6DA 3SOZA 1FW8A 4CWAA 6Q21A 2HSGA 4GWGA 3C8MA 1QG4A 1ZITA 4TLCA 1JA0A 1BE1A 4FJ1A 3P4UA 5DK4A 1AQ6A 2E0IA 1ECPA 4KAAA 4LKOA 5IUKC 3F8WA 4QEZA 1M1ZA 4WFQA 1USUA 1ZKDA 4TN5A 1UJNA 1T13A 3X2EA 4F5EA 1KA9H 3NT4A 1LTQA 1UDRA 2IYYA 4RHUA 4MQ5A 2EBWA 4UVGA 5GJCA 2AYXA 1PGJA 1VCMA 1PJ4A 2H2IA 4HWOA 5A0FA 2JLSA 3BXEA 4OGFA 2BHSA 2B1RA 2IYQA 2M98A 4NCKA 3DKKA 3NOVA 3LOPA 5AO9A 3WNZA 1I3NA 5CFLA 2PRYA 5AIAA 1U11A 4S1VA 3NBUA 2Q2OA 2PRKA 1P9WA 2BHTA 4D3DA 2YS7A 2GFIA 4NULA 4OHPA 1RLTA 2IBSA 1T9GS 1B41A 2QRMA 4ZU3A 3TTXA 1Z73A 5DEIA 3LQRA 1T8PA 1V1RB 2A92A 2W6QA 2XRFA 2VN8A 3B6KA 3NATA 4LJ4A 5EIFA 3R7DA 3HLYA 3HWX1 1EG7A 2DPMA 2JARA 2WUFA 1CSEE 1J8VA 2PT6A 1KOFA 2FB9A 1I4DD 3L93A 4IF6A 5EP3A 2BFAA 4BWFB 5DM70 5DHQA 2ZKLA 2HLDA 2C54A 4WQMA 3UFXA 3WV5A 3ZE1B 1EGAA 1JPJA 2JS7A 4O4LA 1N32B 4B74A 1SCUA 3VR5D 1HYHA 3DFIA 2A7XA 3ZXSA 2IHZA 1DQSA 1BVHA 1JEQB 1R8SA 2IGTA 3MLAA 1IYZA 3ELYA 3R5HA 2QJWA 3U81A 721PA 2EJWA 3EXIA 3TG8A 3VR0A 1K27A 3R9XA 2IUYA 2XUJA 1AURA 4OU5A 1H9CA 1QG2A 4DDHA 1JU9A 4PX2A 2BELA 1B3BA 5EL0A 4PGMA 2MR5A 1J9ZA 2OMEA 4IKEA 4OSPA 1D03A 3DHYA 2JDIA 4HFRA 4A9AA 4C3UA 4O02B 4RX1A 4B0OA 1LPSA 2H08A 1FS6A 3EXEA 5EKTA 3N0RA 5GQSA 3ZLUA 2NUBA 2WU0A 3D2LA 5DH9A 1YVUA 1TUIA 3RAJA 4JUCA 4UAVA 4N48A 3MWGA 1AGYA 4WASA 4EI2A 4GHWA 1GKLA 1EK0A 1FP6A 1VG8A 2PSDA 4P93A 4D4HA 1O97C 2CJFA 4JBGA 5G1OA 3STYA 1R64A 3L2OB 3QFSA 1QYXA 3TIIA 4YMHA 2YRFA 3ABZA 1NFRA 1QGED 4NOJA 4XUGB 2FF7A 2G9UA 3X1WA 4E5VA 5L95A 1DNPA 3A9CA 2UZ1B 2QD5A 1H4TA 3EXEB 3PR3A 4HQFA 5EKDA 7REQB 4HAOA 3DHWC 2C2KA 1GA1A 1TKAA 2PYDA 1T5DX 2XYHA 2B69A 3CPEA 3DZFA 3L8FA 4PC7A 3PFWO 2CEAA 4ZVOA 4ZQEA 3FTFA 4NARA 4JMLA 1XTIA 2EIHA 2GQ0A 2WMYA 1MAUA 1TT5B 1U0OC 3F7TA 4LJAA 4HS9A 1CDEA 4B81A 4EGFA 1FJXA 4Y9TA 1CEEA 3QHQA 1UDBA 3T7CA 5IARA 2YYAA 1KIAA 3HA3A 1TLTA 2HGZA 4L75A 4GLLA 3OKCA 3LYHA 1C7IA 3OE7A 2ZAMA 3QYPA 1Z5WA 4RLSA 5DTRA 3U4IA 2MSWA 3CVOA 1UXKA 3TBFA 4M1EA 1LSSA 2PZKA 3J81k 4BY9E 2R68A 4M8NE 2QUJA 2RGAA 4B34A 4IRUB 2HAEA 1JHPA 4QREA 2ZRFA 4EFLA 1NRXA 2J4FA 5E8RA 2VQSA 1I0IA 2BKLA 1W4BA 4MUXA 1DE0A 3DBHA 4TUYB 1FU8A 2QQGA 4ZK2A 2AMVA 1GNSA 1MEEA 2GEDA 2PKQP 2QE6A 2Y1FA 3GG9A 4UHJA 2QTGA 5IH3A 4TM8A 1VTKA 2JF0A 2VJPA 4C6TA 1Y8CA 5JH7A 4RVCA 2QB5A 4JJ6A 3NHSA 1Y98A 2B5OA 4YB8A 4D9NA 1TU0A 2Q4BA 1O87A 3VM6A 3K6SA 3KIPA 1E1DA 1N25A 1LGYA 1ZKMA 2R85A 3LGAA 3TGLA 3L4KA 2QL7A 3MHPA 4P4SA 4PX5A 2GERA 5J58A 1P2GA 1V25A 2HDWA 4LJ6A 4KIFA 4IBOA 3DJFA 1TQ2A 1NSFA 4JI7B 4W1QA 4GOND 4IV5A 1AQLA 2P2YA 3DBHB 3QEMA 1IXZA 4ARUA 4LGMA 1E20A 1Z36A 2V8BA 1OC4A 4MP8A 1PYGA 3KJIA 4UQPA 3WBKA 4DFDA 1U99A 4KCGA 4RQBA 2V7EA 5JH7B 1GTJ1 1JQBA 1XRMA 2CD9A 1FEZA 4LZLA 5AKGA 1R15A 4EYOA 3UK7A 4IHKA 1V0JA 4G4SO 4Z4IA 2W2OA 4LJ7A 2VK2A 4KGDA 3WMGA 1IBCA 4ASUD 4OLAA 1CJSA 2TMKA 4P4SB 4Z6KA 2C8LA 1Y5NA 3LXRA 1X0XA 2FPGA 4N03A 3C3PA 3ILHA 4QBTA 5DEOA 5ALNA 2IS1A 2AMJA 1TQ8A 2GSDA 5DYYA 1W5TA 3QEMB 1OHHD 3T4XA 4AP6A 3U7GA 4B4VA 1JALA 3EODA 4OHRA 4CFYA 2QYSA 3CF0A 2YUTA 2ZXFA 3UYLA 1KMMA 4F7WA 4WCVA 3A14A 3TZHA 1PNRA 3ORFA 2W6JA 4NICA 3S28A 1C8BA 3NUGA 3QA9A 1I1QB 1GPNA 1SKYE 1T2DA 4FPXA 1GN9A 1UBGA 3PNOA 1M6NA 2QRJA 4L4RA 5BR8B 1N4DA 1S96A 2WFMA 1XCJA 3L1VA 3QFHA 4K6HA 1VYHA 2IU6A 1DZIA 2PK3A 1ZD4A 4PS0A 3ZWVA 2AZTA 1BWSA 1SZJG 2OAEA 2XNDA 1YS6A 4LZOA 3AW8A 3PNKA 4TTPA 1WA5A 3PDUA 2OHGA 3ITDA 4I7EA 2ZRGA 3MWEA 4RSGA 2OBYA 3LLMA 4ARVA 1OREA 4IXWA 2JHGA 2CMKA 2OSVA 1MB9A 1PR2A 3DMDA 3TQSA 4ATNA 5F9FA 4TROA 4NY1A 2OK8A 4Y7CA 4CUJA 2O2JA 3KKNA 3BE5A 1K7FB 1YS9A 2BFBB 2Y05A 3CT4A 2AN1A 2CLFB 3N75A 1I8TA 1I3KA 1Q50A 2JFWA 4NH0A 2H1VA 4W8OA 4RL4A 3BRQA 4RTNA 2W37A 1KY4A 3C14C 3SFZA 4ZOAA 1J06A 2F59A 2WLSA 4J1SA 4G1MB 2KLBA 2H1SA 2OOSA 1JZTA 4OL9A 4MWTA 5K6AA 3MWEB 3PA8A 3U9LA 4FHCA 1X8XA 3FLBA 1II9A 3E8SA 2OGSA 1VQ1A 4O4IF 1X1AA 4JXZA 1IONA 2P1ZA 1PO7A 2EVWX 3BIJA 2C82A 3C8HA 2Q6KA 3ND8A 4NCHA 2RONA 4XYMA 3ROQA 1BDHA 2XTZA 3EIHA 4W5WA 3IEXA 4X45A 5CW1A 4BQIA 4CG1A 5MN5A 3EEYA 3V33A 2HSJA 3SICE 3IMFA 4N3CA 5LB4A 4J1TC 1YE8A 3ZWQA 1HK7A 4B6PA 3B38A 3MILA 2Q2VA 4CEJB 1ZI6A 2PEYA 2A35A 2ZJ3A 3KEFA 4G8BA 4ND8A 1TGYA 2DHDA 4UE3S 1VMIA 3OZGA 3AVYA 4AQYB 2X42A 2P8JA 2C4UA 2YWEA 1LKZA 1TVCA 4LMPA 4Q3DA 1QYIA 1QVRA 1Y48E 4C05A 1NX9A 2FFHA 5DIFA 3GJZA 2BJVA 3P8ZA 2Q6LA 2RDMA 3Q6NA 3F74A 1IY8A 1HFEL 1EFHA 1G3RA 3KRTA 5HXAA 1I6LA 5K0CA 3B89A 1MX9A 4XM2A 2IC5A 2DOKA 3N5KA 1NY5A 4EG5A 7GPBA 3D7KA 3JQBA 4C88A 3DGEC 4ND8B 1YUNA 2O14A 3HUFA 1IJKA 2RBGA 5AK4A 2RGCA 3H42B 1JTFA 3M0EA 3BMNA 4S12A 1W5FA 5HWSA 2HRRA 4RD4A 5A03A 2DBVO 4AJOA 1JSCA 1OLXB 1J0BA 2HHLA 2Q3HA 1W75A 1TEVA 1XCPA 4CQMA 1IHUA 1Z4PX 3QNUA 2FUEA 2PGOA 3ER6A 4NBWA 4PZ0A 4A8HA 1M8GA 2PKWA 4EG0A 5I5EA 3EVEA 1Z5ZA 4GBED 2V97A 3PGVA 1F1BA 4QSMA 4R2HA 5BN1A 4ARAA 2HZ7A 3TCNA 1HMYA 4ITRC 4NZOA 1QX4A 2WIFA 4HS4A 4A6PA 1GLNA 2GXUA 3E0XA 1Y7TA 3NEPX 5ENZA 4JC5A 3BMNB 3L7CA 3KAPA 4QTXA 3WYNA 1CP2A 3LI2A 5LQAA 4Y6OA 5JJKA 3W2TA 5KVCA 3QVKA 2JA1A 1JR6A 3RT7A 3MELA 2QV7A 4TMKA 3F3MA 4M9CA 3RK0A 4CQMB 3RREA 3E9ZA 3L8HA 2XW6A 3G7NA 1R4NA 4OM7A 5IJWA 3IR6A 1I24A 1OGJA 2VSFA 3CO5A 3PNSA 2ZIVB 3ZWKA 4CKWA 2CJPA 1A9QA 1RDFA 1XMXA 3MMSA 4MW7A 3JYPA 1C8VB 1N0HA 2YIDA 3LDAA 2RBKA 4M46A 3LKZA 2J9GA 4LX8A 2G4LA 3F2VA 5ECGC 1KO4A 4XDZA 1LLQA 1JN0A 4WE3A 2L82A 4F6LA 1C0IA 2XIQA 4H0FA 5AKJA 5HFNA 2VDKB 1HV8A 3K2EA 2FSIA 3OM8A 1T9HA 2B6HA 1Z2AA 1GEGA 2K2QB 1XJ5A 3KJEA 3L1IA 4OK6A 5EIXA 4C7OA 3ROTA 2OAP1 4X90A 1WB9A 1B0PA 1F9EA 1R4NB 4CKCA 4V0MA 1FBNA 1KP9A 3IB3A 4H3VA 4JC4A 3ZCRA 3H5VA 2OHIA 3VNRA 1NZJA 3A9RA 3OQPA 4U8HA 4Z4EA 2XUGA 4KK4A 3BHJA 4FZVA 2UUOA 4D8WA 1PG5A 1BCRA 2BM9A 1O95C 1SU7A 1XTRA 5AM3A 3RUAA 1R00A 2X9NA 3WP0A 3FG9A 4Y6QA 3S2YA 4BIMA 3DNPA 4XIYA 2C7BA 3INNA 1V9LA 2O52A 4Y67A 4C7OB 4V38A 1GV1A 1SGWA 1BXZA 4HEA6 3CUUA 3LGSA 2AJDA 4GNRA 1MH9A 4TXJA 2YYZA 4JI5B 3QU9A 3RSHA 4CKCB 1DTEA 3UMFA 1V5EA 1SU4A 1Z75A 1F4VA 2JGDA 1Y37A 3JYHA 4IV8A 1XKLA 3IXLA 4X7MA 4J4TA 3MQ2A 1PL7A 4IDOA 2ZJ4A 4I1UA 2X14A 1BCRB 4NYIR 3AJEA 2OB2A 2WNSA 4OBXA 3RTBA 1KI6A 1SFRA 3UJ3X 1XDDA 1US8B 2VCEA 1SIWA 2NT3A 2OLKA 2XUPA 2R86A 3D5EA 3R4VA 4KQMA 2P77A 1UK8A 1QHIA 2ZUCA 4H3HB 2PV0A 3JQ9A 4F9EA 1RYZA 3IEKA 2EXXA 1W0CA 3AIMA 4ZK6A 1RCFA 1A8IA 1CVLA 1QZ3A 4UHKA 5E9QA 3I1JA 3P2MA 1VLLA 1D8AA 2JGDB 4UAUA 3LFTA 4TM7A 4KIGA 1LS1A 4YRKA 3OESA 5A3RA 5EJEA 4RPHA 1A8SA 3ZQ6A 1IUNA 4RCYA 4AO8A 1A5ZA 1SU8A 3IUSA 5AKLA 5FUWA 1KI6B 2JIOA 5G41A 4DMCA 1U3WA 1E60A 1QTQA 2WUGA 1FMLA 5AHWA 5DYNA 1EKXA 4L15A 3SXPA 4A2WA 4OPMA 4JBIA 3VKHA 4HB3A 5E2IA 2EWVA 1SD2A 1HKHA 1UEIA 1Y81A 2FZCA 4G5QA 4ZV9A 5HE8A 1JI3A 5KVVA 3L07A 3B6MA 1T25A 4HBGA 4TRNA 2EL7A 2X5JO 2ZVQX 2PZGA 4DLWA 3ZCUA 1H85A 4EL0A 4GXRA 1NI4B 2HU8A 4RNCA 4XUEA 1XQYA 3U3XA 1XQ6A 2NSLA 3OLXA 3EVBA 1XTKA 2IY7A 4R8MA 3IVXA 2QRUA 1RI1A 1UBHS 3D8UA 1NVDA 4KFTA 1N1DA 2RIRA 2V3WA 3DO8A 3A4IA 3RI3A 1R8YA 5BWLA 1JEAA 1RXIA 3FYCA 4P3OA 4UBMA 4N41A 4FQ7A 3I2YX 1L1RA 1VLZA 3IXMA 1BX3A 5COAA 3PGKA 5FI0B 1QR6A 2Q41A 4QPNA 4X3OA 4XWKA 4DQLA 1JHQA 1Z8DA 2ILTA 1GRQA 1S3GA 2QTTA 1N9GB 2PZ8A 4JYZA 3QUCA 5KSPA 2R1ZA 2VPZA 5THXA 1U9ZA 3KU4A 1T43A 1JMKC 2R62A 1N2OA 2XYRA 4QO7A 5C53B 5H4HA 4YT2A 4NPCA 3AETA 4IGAA 3MB5A 3PQ2A 3Q6MA 1SUSA 4CGZA 1HLPA 4IRXA 1FLDA 1PJ3A 1C3XA 1PZMA 2R8RA 3RHSA 2QK4A 1TD1A 1K6MA 2FMFA 4Q3CA 3R9KA 3SD7A 2H51A 1DEHA 1F8XA 1ICEA 2HBZA 2W6OA 3MQFA 1Q0UA 1UR5A 3MJCA 1DBQA 3C85A 3FJYA 3LCRA 4QGHA 3TNFA 4F9FA 5AJWA 3TB6A 4DB2A 4LHWA 1WMEA 1Z2OX 4BRWA 1PVDA 2D1QA 4QNRA 4C0JA 5H02A 1ZW6A 4P3XA 4ENSA 1NI3A 3M5DA 1XU9A 1D2EA 3C7KA 1S2OA 3PJRA 3LC2O 1KEUA 4N3GA 2DKNA 1DEOA 2JIPA 2C3YA 4O2BA 1IVSA 4R84A 4WKPA 9MHTA 4JGGA 3I2GA 5JMPA 3GLRA 4RULA 3MCZA 5JI2E 2HJ9A 3VMFA 3RYFA 4EI9A 5FBKA 1QTIA 4WPGA 1TPZA 4XD7A 1YT5A 2HFJA 3SVZA 5AESA 3R3YA 3ZD7A 5K0LA 1DMRA 2ZS7A 2NV6A 3MUEA 3V4FA 4G0NA 1N5IA 3ELWA 1VGRA 1E94E 1EA5A 3BX1A 3KFXA 1F2TA 2BTQB 2REBA 3PCXA 4PO3X 4R9RA 5DN9A 3KAJA 3PD0A 3RS5A 3EK2A 2CV0A 3LC7O 3K0BA 2PVCA 1Y89A 3GRYA 4O2BB 3KVOA 1FFBA 2RG1A 3KR0A 4U7WA 4X6XA 3USZA 3CXUA 1VZ2A 3BH7A 3FPCA 3WADA 4DCVA 2PKRA 2X7JA 3DUWA 3EWNA 4EHDA 3PF9A 5B4UA 1CDOA 3WYEA 3LW8A 4DARA 3TG2A 3HJAA 1SU6A 4DMRA 4F45A 3WL5A 4RETA 2BFEA 3EIEA 4N12A 3DUFA 1CUGA 4ZVPA 2WIGA 1JHMA 1KFJB 1ZBDA 2RAVA 4HV4A 1PDWA 4UCXA 1BX1A 1F2TB 1G9TA 3AERA 5F1KA 5MGNA 1A5AB 2ZWIA 3D6TB 1C4WA 3GRPA 1FXWF 4J4HA 2GHTA 1FSFA 1PQUA 3LX4A 1Q0TA 3ZE9A 1KRWA 4HNAA 5KTYA 2VYFA 4F1KA 5LMZA 2HRBA 2HYDA 1ZDMA 3PF8A 1AZLA 3C5HA 2IEDA 1YZUA 4FGJA 4UM9D 4WKBA 4BAZA 3P2IA 4I0WB 2NXJA 5YASA 4BNGA 1AA9A 1G2QA 3C98A 1UPXA 2G9RA 1HRKA 3OLYA 3EUFA 3OPMA 5IVHA 3D4BA 1AY0A 4YALA 4QJIA 2BAGA 2QS9A 3ICOA 4DF3A 3ZY5A 1X70A 3RUPA 1KKLA 3QH4A 2XCSB 2K2WA 1BAPA 2RHJA 4WZAE 1I30A 1JWLA 1K5HA 2Z4SA 3AERB 1T3HA 1AD2A 1Q7GA 3QY9A 2JGFA 2Z5LA 4IG9A 4JLPA 4BU0A 5E3HA 4HNAB 3MERA 3AKCA 1UXOA 3P52A 3BSWA 1T5OA 2P9TA 3DFUA 4J03A 4KDRA 2I4OA 2NSJA 2O8VA 4J75A 2BM1A 1SKMA 2OPHA 5DPMA 1GAEO 1OXTA 5TPWB 3WY9A 2AYZA 4OGGA 1EK2A 5BY2A 1JHAA 3NVMB 4IJ6A 4QPCA 4J16C 1QSGA 5LBTA 3KAQA 4WBXC 2PCJA 3OUZA 1J20A 5F4BA 1EVIA 4RKEA 4WN9A 2IBTA 2FQWA 1ORDA 4Z7QB 5LLTA 2G0NA 2VHEA 3WLSA 4QHTA 5MN4A 4ME6A 3HCCA 4UPDA 3QUSA 1PQPA 2IP4A 4B84A 3PEEA 2OWEA 1CUZA 4HXEB 1JEDA 1XK6A 4M21A 1NM5A 3PGLA 2OVFA 1CUJA 4EY5A 1Z4QA 3E7PA 5WRFA 2CXTA 3VNVA 1XRNA 3M6MD 2CLLB 4FOPA 4PNEA 5JJLA 4KPUB 4TS9A 4WN9B 5EVJA 5LYJF 2XB2A 2A58A 3PS9A 4EHIA 4EX7A 3I28A 3UAYA 4LRQA 1FMJA 4Z51A 1ZN7A 3V97A 4N3NA 3LOQA 1ODJA 2RIPA 3PWSA 1N36B 1SXJC 1P5JA 3JRNA 4WXYB 3TRHA 2FWNA 5JNSA 4YO7A 1BDIA 3HYNA 5DGXA 4B6SA 3DL0A 2O8DA 5FYDA 3SQMA 1A82A 4JEUA 1R6VA 4BN5A 4DMGA 1TCCA 2IZZA 1UJ4A 1OX4B 1Z7GA 3A4LA 3MGBA 1JE0A 2OYRA 4B3JA 1FX0B 4AZTA 4YCNA 1NJ6A 5K6RA 4GICA 4UTXA 1NKVA 4CTMA 2C4NA 2OAQ1 4AJJA 2PZMA 2HWKA 1THZA 2EARA 2IPXA 2PZFA 3FGPA 3QFRA 2X1MA 4Q9JA 4DYVA 2WUDA 1FNSA 1IIBA 1QIEA 1Z25A 3FJ1A 4KR0A 1UAAA 3TGWA 5JW6A 2AEJA 3GU3A 3ZHUA 5LN1A 2CMHA 1SVOA 4LFBB 2NZUG 3GFFA 4MVJP 2OENG 4X92A 2M1XA 1RADA 2VRCA 5ALUA 1I5RA 3LQFA 3T9EA 1IZZA 1OT5A 2EC5A 2TSYB 3R75A 5IVPA 5JATA 5JRZA 1BNCA 3M49A 2BONA 4C6SA 2IU0A 5HCIA 3A9WA 5FTNA 4D3YA 3K32A 4AJ1A 2NTNA 1O6FA 621PA 5L8VA 2DERA 1NLZA 1Z34A 3KJZA 4JGIA 2E5WA 4NV1A 1HTWA 2C0PA 3NANA 4FN5A 4P82A 4RJTA 4QOSA 3U4QB 4AJEA 1OXXK 1XLTC 3BGDA 4ZZ0A 1S2GA 4F86A 4CBVA 4CR8A 4DC0A 4B48A 1M2KA 2DY1A 1SELA 4INPA 1E5VA 2GD1O 1H2AS 1CY7A 2O1XA 4PYIA 2B37A 3D43A 1UOEA 2WIAA 3QVJA 4HVTA 4LOHA 3KC2A 2VUSA 4NONA 2J0UB 4RGVA 4TL9A 3PA6A 4WGFA 5JO9A 3ZK7A 2RAUA 5EOVA 1UMCA 4RQTA 4WDQA 1ADYA 3P96A 1DAGA 4OHBA 4Y1GA 5JJCA 4O4IA 2OQ2A 4PHFA 4A0HA 3KCNA 1JG1A 4MP3A 1A1SA 2G07A 1XPRA 4HJRA 2IEBA 4RY0A 2GEKA 2RI1A 5IBQA 1O08A 5C8XA 2A9KA 1FJHA 1MO3A 5HTOA 2PKYX 3SZ3A 1W5AA 2X9GA 1YFKA 1THTA 2H8GA 4P54A 5KSYA 1QFJA 2WBLC 3HACA 3RWBA 4KX5A 4O2AB 4RANA 1SHLA 1UKYA 1AKQA 2AC4A 4RESA 2VSXA 4FUQA 2GWHA 2LCFA 4IW3B 5EQFA 4EIWA 3AF3A 1HFWA 1UMCB 4E15A 1N6KA 1UBLS 4D79A 3PJDA 3AF0A 1VJ0A 2EP5A 4G0WA 2WV9A 4RVDA 1G8FA 1JA9A 2Q3CA 4MQMA 4JXKA 4MGHA 5IUJC 2OXCA 1SWVA 1JXOA 3O8NA 5EZYA 1I1NA 2GB4A 3SQNA 3HSSA 2NVBA 3VPDA 3EIXA 4BUJA 4EG8A 2IV2X 4YRFA 3BF8A 2CC2A 3AZOA 2FAXA 3CUWA 1HPLA 3MSXA 4UE2A 1U0FA 1QHXA 3IVGA 3GT3A 1JJVA 4EF5A 2ZDGA 4YMVA 1G6Q1 1YO6A 3Q9UA 4PWYA 5FNZA 5LC1A 2WU1A 5HYVA 2O2DA 5FJIA 4Z4HA 3AO0B 3FTQA 5IWAB 1LSOA 1JH9A 4PG7A 1NXWA 4GRIA 4R2JA 4N82A 1DX9A 2IHJA 4KYUA 4JQCA 4CN8A 4CM3A 3F98A 1Y9JA 5EZYB 1RE1A 3I39X 1G5QA 3SM9A 4RY2A 4B3DA 3DLIA 4DGQA 1ZU4A 2RC5A 4Y1RA 2VJOA 3CISA 4GC5A 4AN4A 3G0IA 5ICSA 4DSNA 1AK2A 4MVJF 5EE3A 2J30A 1K92A 1OXMA 2DVMA 1V96A 3AUKA 3QSGA 5AXDA 2AJBA 3C4QA 3NTRA 4PG5A 4H7IA 3C1AA 4H27A 1VFNA 4HNSA 5HUJA 1E2LA 2W2LA 1M6WA 4GI3A 1Q91A 2NXWA 1YH3A 4RPJA 4BGIA 3OTHA 1TB4A 1G1MA 3M82A 4TTQA 4EF6A 1ORVA 1N2BA 3N6XA 4QRIA 1X9IA 3DDHA 2XNHA 2PWZA 1ZK0A 3BKXA 3BE8A 4Y1RB 1TJPB 2HQOA 2RH5A 1UBJS 1FDIA 3JQFC 4LISA 4KWHA 1JDTA 4TYMA 4GLBA 1R9JA 1UWLA 2WU4A 2OXRA 3BZUA 4EHJA 3KSAC 1YB5A 2BGWA 3EPKA 2GKSA 3HWSA 3DDCA 3IT1A 2RGYA 3MMZA 3PE6A 2YQZA 4MLPA 4QHSA 4X7PA 4F91B 3A7DA 2W43A 3DE1X 1DXQA 1RWQA 4FYYA 1W85B 4JUAA 2AUNA 4R1QA 3LTEA 3LFHA 1EGHA 5BUSA 4CCAA 4IAOA 1PLKA 1YJ8A 3P0JA 1G18A 3OWHA 3RIHA 1RKVA 1YHYA 2X2OA 4JB2A 1PK9A 4LG1A 3C6MA 2X1VA 2OM2A 1DUVG 2XB9A 3IMKA 2LP4Y 2WICA 1GNPA 2WKWA 2G71A 3FWYA 2ACKA 2VH2A 3E2PA 1PZFA 4NR0A 4X20B 4EKEA 5I9IA 3UJ8A 3KP1A 3WSVA 1Y8RA 1WXFA 2BUCA 3G2QA 4PFKA 5JNWA 1BJRE 3VR6D 5H4GA 2F43A 1PNOA 3DLHA 3E1SA 2L19A 3H1EA 3IEUA 3UJDA 1XD9A 3WA7A 4C7JA 4CUZA 3C41J 3GFOA 1P31A 1WM1A 3NU1A 4LS3A 1O6GA 2YL2A 4ZD6A 2N42A 4Y6RA 4JSRA 4EPTA 1O5OA 5KCZA 1WHTB 4N54A 2R6JA 3QE4A 1WUYA 4RWZA 1G4HA 2MHCA 3KHUA 2QP4A 3GEPA 3ASUA 3Q2OA 1K7SN 4JR0A 2PQ0A 4PSKA 1BJKA 5K8LA 2GJ9A 1QH1A 2H18A 1TM1E 3KQTA 3N2ZB 4Q3LA 4DNXA 4N6OA 3MNFA 1MNQA 2AL7A 1KK0A 2XADA 3K9WA 4U4AA 5EE0A 4OU4A 1S2LA 4A1OA 4KX3A 3HR8A 4FGSA 3NWBA 1DEAA 4Q6BA 2YHSA 2F43B 1VIAA 2GN8A 3KPUA 4H17A 3CVWA 2QLBA 4ZC1A 3LVFO 3U7JA 5MN6A 3IAM6 1N3YA 2PGXA 4RGQA 1W4LA 2B94A 3GP5A 3HVHA 3RVSA 1QH1B 4IXNA 4XAQA 3FOWA 3PDHA 4N0QA 3E35A 3PR2B 4F04A 1THMA 3PC8A 4JNCA 3D8TA 3H2YA 1X39A 4RTKA 1G19A 4HRAA 1YACA 1VL0A 4IY1A 4YJFA 5HJ2A 3THXA 2OHHA 2HSEA 3CSSA 4FDTA 4FVTA 4L5JA 5JSYA 1C4OA 4HK4A 4WNIA 3DHNA 3CRW1 4YMGA 3G02A 2WQZA 2QLNA 4GO1A 3NX4A 1JAYA 5LQSA 1PN3A 2LTAA 1H0KA 2W6CX 4OA8A 1FRQA 5AK5A 4ICIA 1A72A 3ESRA 4NU5A 1GXSB 4IMJB 1EVEA 1EQ2A 3RQSA 4XD7D 1L5VA 3UMCA 4ZKEA 3C3MA 2H65A 4G56A 4PZCA 4RVGA 1S0UA 4WK2B 2F90A 4ESEA 5KTOA 3PCRB 2Z6QA 1JEEA 1DUIA 1Z15A 3DWFA 4N18A 5KYUB 1CK4A 2P3SA 1V7ZA 4YJFB 3THXB 2PO7A 2VJDA 3MK31 4H4EA 5DB4A 4QYIA 4DT1A 4P92A 2TS1A 4Q9AA 1MJGM 1JXQA 4U1RA 4WLUA 4NQRA 1NNEA 4D9CA 3WK7A 3X2SA 1EJ0A 5BN3A 4PZAA 1LFDB 1NVVQ 3EVGA 2AVDA 3A1UA 3T9AA 4ZZ1A 2V5VA 5FOUA 2A9RA 5HX7A 3R5TA 2ZUBA 4RHEA 2QP3A 3RFCA 5K3DA 2P5TB 3GY0A 3IAEA 4BO7A 4XB2A 4QDXA 3LYAA 5FL7A 4X84A 3FM9A 4WNAA 2Q8NA 4N8DA 3MINA 1TI7A 2DUMA 1KI9A 3Q3EA 3IQDB 3Q0IA 4MVJH 4B6EA 5CDSA 3P9IA 5IZCC 3FDZA 1ZJ5A 4Q47A 2ES4A 4QYIB 2CNDA 1NTRA 4DT1B 1O4WA 4MPTA 4MYCA 4QYMA 5IUNC 1ZOLA 3F8TA 5IVIA 2ODNA 4COOA 1IN1A 4XCXA 4A73A 1ST2A 2HM7A 3COPA 4Q3NA 1KKMA 4KBGA 4M1ZA 1XPOA 2ZSEA 1NF3A 3BWYA 1NZDA 3UT5A 4MO2A 1Z4OA 2QD3A 2Y92A 3QXCA 4NDNE 4AVYA 1GZ3A 1Z5UA 4CG0A 5LP6B 3FBWA 4F4FA 5LPNA 3MINB 5FWNA 4L8YA 1XMOB 1CS0A 3ZWMA 1KYZA 3GROA 3I12A 4LPKA 4XUCA 3SC4A 1TVKA 2NU8B 1IHYA 3A3KA 1KPIA 2ZE8A 1NBWB 1EUCA 3NWEA 4HQNA 3CU5A 1JQ5A 3RK1A 2HMYB 3E03A 3QKWA 1H8HA 3GHYA 5AOVA 3RFXA 2CUKA 1Z5VA 2CVOA 2I4TA 2M9MA 3A6DA 1ZXXA 4JVSB 4OBBA 1O7JA 4UMVA 3UT5B 4C2UA 2IOFA 4B6JA 1TA4A 1W9HA 1U6KA 2GJAA 2GZAA 2GLXA 3OOEA 2FGKA 1Y6FA 4CLOA 2NOAA 1C0PA 1HF3A 1STOA 2E3JA 4JR2A 2DWOA 2PO5A 1H9BA 2XUIA 2A3NA 2C2MA 1SCBA 4U2GA 4BN4A 1KP3A 3AVQA 2D5LA 3EEIA 4YAGA 4ZFNA 2WK1A 3O8BA 3NRBA 2XITA 1EUCB 4OFWA 1AO0A 3COYA 2Z6AA 1OILA 2ZJFA 4PSCA 1L0BA 2IRWA 4ENPA 3I6MA 1W1UA 2ONCA 2W2PA 5KHAA 3W77A 1ZX1A 2G0TA 2WKRA 1GYPA 2ZRIA 1RMQA 1LDEA 3M2TA 5DBHX 4QBHA 5CCDA 3P9YA 1P9RA 2PKCA 4UHEA 2P6MA 3TSWA 4CLOB 3NTLA 1PHRA 3LIPA 1HURA 4LXTA 4C3OB 4J9VA 4ZVQA 2D7JA 2MT9A 4IDPA 2Y6UA 4BC0A 4HCJA 1NYTA 3L02A 5KIAA 3BOSA 3BBLA 4BLRA 3MHTA 5C8ZA 2E9SA 3IAUA 4NV0A 1TZMA 1TMKA 3F6BX 4IDCA 4GPBA 2PKXA 1U0GA 5CM2Z 3NB0A 1JBKA 3NTQA 3OZRA 3IC5A 5C8DA 3DNMA 4GMHA 1Q5PA 3KL4A 4BMDA 5KJEA 1Z2CA 4WZBA 3ZOZA 1DU4A 1PWYE 4XGQA 4PO1A 1UKVY 2FMIA 1DG3A 4BPRA 4CI9A 4GVPA 1RZRA 2XXAA 5HJ7A 4GXQA 2J87A 4B40A 1GR0A 3VHXA 3PHCA 4ILKA 2ZDQA 2LE0A 4J0CA 1D7AA 1P2SA 4G5YA 5T4FA 2BGNA 5ADWA 1AX9A 1F1JA 4KDFA 3P9KA 4KRXA 1WY5A 2O8NA 4TWAA 4IDEA 1HMPA 2QRVB 1EVZA 4OGWA 1E9RA 1NRWA 9LDBA 3L41A 1CQWA 1J8YF 4BNUA 3PLAE 4ENTA 3CB2A 3PNBA 1OASA 2QSZA 4XSVA 2G9NA 4TKVA 1ACJA 1PKXA 3P9SA 4JEMA 3WFIA 4U6NA 4G5HA 3WP1B 2VI5A 4QGGA 1UXJA 1B93A 3SBDA 4BGEA 3AG6A 3UWDA 2IYRA 2ECPA 4UHBA 1P7YA 3QI2A 1GAJA 4IHJA 1LVUA 3L46A 1QG6A 1U1GA 3WLEA 4R0VA 3JCZA 1G3MA 1V7QA 4OA5A 4KP7A 4NMHA 1N0IA 3ULKA 1P0MA 1VBMA 1DAFA 3TDNA 3AKYA 5JS7A 3W5BA 4HWKA 4PPFA 4AG6A 3AZQA 1VE6A 3GUHA 3NHBA 1DBWA 2WINI 4TKVB 4EPYA 2ZAGA 2VSNA