2O01F

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 17
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2o01F00
2WSFF 3LW5F 2O01F 4XK8F 2WSCF 4KT0F 5L8RF 1JB0F 4L6V6 4Y28F 2WSEF 4RKUF
chains in the Genus database with same CATH superfamily
3QYEA 2DZOB 2L2DA 2LWXA 2UUCM 1EIJA 2CHVA 2JY8A 2LTUA 3GRRA 3TE6A 2HAKA 4GC9A 4OVZB 3T15A 5KQDA 2CV0A 4QHTA 4B7GA 3HZJA 3KOZE 1X37A 3DA1A 1N78A 1IN6A 4IJEA 3HU1A 4L15A 3PVSA 2QBYA 1D0MA 1N33M 1NY6A 2MJ5B 3SATA 4LZJA 2FOIC 1DGGA 3BOSA 3GQ4A 5FTLA 3E9SA 1IN5A 4M9SA 4LF9M 1R2YA 3HHWA 1QUTA 1XHBA 4QNMA 3C58A 3SAVA 2R0IA 1EFUB 3WHLA 2F5NA 4CHTB 3L27A 1J5EM 3U60A 4PDGA 1VQ1A 2LVOC 1PJSA 2F4VM 1KYIA 2L7HA 3KXEC 4LGYA 4NXNM 3SFZA 5BPVA 2R18A 4PDIA 5EP1A 2H1RA 3KSXA 1J09A 4PT5A 1OAOC 2E5LM 2R6FA 2EJSA 3K8ZA 4IIWA 2FE8A 2CP8A 3GLHE 3LVWA 3HU3A 1NV9A 4LGMA 2DAKA 4GKJM 4GRIA 3K9PA 3LCVB 2R62A 3C3DA 4WURA 4G4OA 3LCUA 5DNYA 3A46A 2CHQA 4IBKA 1NNJA 2CUZA 2KNAA 4D81A 2EUCA 2DVWB 1NHWC 1IM2A 3EIHA 4KT0F 1KSFX 1ZAEA 2XFTA 3AOEC 5JI2E 4OW0A 1QDTA 3UMMA 3CTWB 3HU2A 1VG5A 3A42A 3K1JA 1HR0M 3GP1A 2Z3XA 2K47A 3GLGA 1MJGM 5C18A 1F4IA 3GPXA 2UUBM 1RU3A 1DGBA 2WSFF 1L2BA 2LVQD 2XLJA 1TR8A 5EP2A 3I51A 2KHHA 2QCUA 3J27B 1MU5A 2X49A 2ZAMA 4YHHM 1PRBA 1GKIA 2CFOA 2D7EA 1PGYA 4XBOA 4AG5A 1G59A 1I4WA 4G3OA 1IXSA 2GNOA 2V6ZM 1MX0A 1WIVA 1IXSB 3NBIA 1AIPC 2XZUA 3SYLA 4LY6A 3PNVA 4LRTA 3IG8A 3MJ5A 2DWMA 3ZH9B 3SAUA 3J7BA 4MGKE 2APLA 1S3SA 4MGYE 5EJCA 4JI3M 4DR2M 4GIPA 3KDSE 5JI3E 1IN7A 4GEWA 3I4YA 2KZSA 2MROB 4R7GA 3THGA 3B74A 3GRVA 4L8RC 4L4UA 2JY7A 1TDZA 1NY5A 2R45A 3HJSA 2L4EA 1UM8A 2L4FA 4MGIE 3T1YM 4GHLA 1ZMUA 4FWGA 2CV2A 4RF0A 1LTMA 4DV7M 4DV3M 1N32M 4LRSA 3W0FA 5FTKA 3AV0A 4IBCA 2UUAM 1UFZA 3AOEA 2DHRA 2F5OA 3C9PA 3MMPA 4CGYB 3TPZA 5LMUM 2FFJA 3SMPA 3R8FA 4K0KM 1OIZA 1HT2E 3GQ5A 1JQJC 2JY6B 1ZMVA 2XSZA 2L6OA 3J80S 5ITXA 3ZQJA 3B89A 2W82A 3LQRA 3HHYA 1N77A 3E21A 1Q02A 2M5ZA 2V1CA 3Q8GA 1QAOA 1Q3BA 1R6BX 2LVAA 3VLFB 2FS1A 4LZZA 2A5YB 2JNHA 3FUUA 2C98A 3SYKA 3HHZA 4BBAA 2N35A 1VEKA 2DZNB 2DAIA 2DKLA 3QWLA 2HKJA 2C9CA 2CWBA 3TWKA 3JAMS 4DUZM 1XMQM 3FTFA 2Z8YM 1TTEA 3KW6A 3GLIA 1SXJC 2EO2A 1HNXM 3FTEA 3CF0A 2Y21A 3UZUA 3EIEA 4NOOB 3GLIE 1GABA 4IBJA 2BJVA 3LQQA 1VDDA 3L2AA 4IBEA 4JYAM 1YLAA 3MHVC 2O5RA 2I7NA 2JA2A 4M0WA 2KA6B 4R71A 2UXBM 3B7QA 4L6V6 4WP2A 3RFWA 4M0DA 3GRUA 3TWLA 3B7NA 4LG2A 1IY2A 4FW9A 5H37D 1R7RA 2KNZA 3CF2A 1Z6TA 5E26A 3GLGE 4KODA 1WHCA 4B08A 1ZV1A 2KZUA 2XZFA 4JI1M 2JUJA 5FSWA 1YSYA 4A3VB 1OQYA 1QYRA 1V33A 1WJ7A 3FYCA 2Y0TA 2CV1A 4F2LA 4IBDA 4FD2A 4IBBA 1GJSA 5A2QS 4QOSA 1J7KA 1XNQM 5FTNA 1R4GA 3FRIA 3A98B 1R5LA 1OKSA 1T3TA 1GLNA 3Q8XA 3ILKA 2ZAOA 3L29A 2K9DA 5EXPA 1IN8A 1K3WA 4TUWA 3U5ZA 3ZCBB 1P3QQ 3FUWA 4LF8M 2YFQA 1XMOM 3AFHA 2QBYB 1ORYB 2HWJA 1PJQA 1K82A 2LXEA 3HHXA 3E46A 4GC5A 3VK7A 4W5WA 3WHKA 1XC8A 2DAMA 1QUSA 4OX9M 1IQPA 2LHCA 1KFVA 4LJ6A 1QDRA 2G3QA 2ZBKB 3RE8A 1K3XA 4IBFA 4Q7JA 5IZ7D 1JB0F 3NBXX 4HEOA 3C3EA 4AG6A 1LV7A 1IY0A 1TF0B 1QQWA 4KLNA 1T6OA 4LF5M 2DI0A 4GKKM 3FUTA 3H4MA 2Y20A 1IFYA 1FJGM 2QZ4A 2KW0A 3I04M 2R4JA 4I5SA 2XGNA 3D8BA 1TGUA 2MR9A 2VF7A 4AQYM 4DR1M 3GLHB 1OIPA 1Z59A 4Z8XA 2L7IA 2XF3A 2D7HA 3FE3A 2G5GX 1PJTA 1DGHB 1QAQA 3J2PB 1WGNA 4NSRA 2DXIA 3M0EA 5DYGA 1IN4A 4PD2A 4II7A 4DV4M 5DFLA 4AZFA 1L1TA 4P16A 3KS4A 4AKHA 2D7GA 3AKZA 4B3MM 3CF6E 2XH9A 3M7GA 4UN2B 4LCBA 3KOWE 1C1KA 4JN6A 3VDPA 2LVPC 1N34M 5KO3A 1GL7A 3KFUG 4GHAA 5LMNM 1FNNA 4LJ5A 2XFSA 1G71A 2FH0A 3J7AS 1CUKA 5ITUA 1G8PA 4LJAA 4DR4M 2LBCA 2R4EA 1D2NA 3VFDA 2K6BA 1NJFA 3U6PA 3A45A 3HWSA 5IREB 3GPYA 1N36M 1OFHA 2Y0QA 4DV0M 2Z7JA 2V1UA 4NRVA 2QENA 4IBGA 2ZANA 3TL4X 2JZ0A 4REZA 5C1BA 3U6OA 2XSZD 4GMQA 3HJ8A 2BNKA 3UGJA 4NRWA 4XGIA 1HJPA 2UU9M 4AKIA 2DWNA 2RGHA 1DGFA 4M9XA 4MM3B 4LFBM 4JI2M 2KRUA 4B3RM 1IY1A 5KPRA 1E9RA 4I4LA 2BWBA 2M60A 4B7HA 2R44A 3M6AA 2C96A 3FTDA 3UK6A 1Q39A 3QAUA 2GQFA 2QP9X 4CIZA 1HT1E 3SMSA 3OTOM 3FD9A 4FWDA 1OTRA 4HLQA 4RKUF 5ITRA 2ZM6M 1AUAA 4X65M 3HGIA 1V92A 3I4VA 4MGZE 3L28A 2KDLA 3PFIA 4I8OA 3SBJA 1PM5A 2F5QA 2QHOB 1GJTA 2Z4RA 3DZDA 3VDUA 3GLFA 4IBIA 3U6LA 4Z6YA 2VQFM 2CE7A 3FTCA 4CISA 3LVVA 1A5TA 2YQZA 3JR5A 1VDLA 2DWLA 1Q3CA 3KOXE 3LW5F 2VQEM 3GRYA 1G4AE 4B3SM 4EIWA 2DAEA 4S12A 2RKOA 3AJIB 4BB9A 2K0BX 5ITTA 3FUVA 4X64M 1L2DA 3HJQA 4RF1A 4D82A 1D0KA 2WSCF 1GL6A 4HL4A 4DV2M 1IXZA 1OJLA 7CATA 2F5SA 1HNZM 1QZMA 3SC3A 3GQ3A 4L78A 4G4QA 5L8RF 3F92A 4MB7A 2JWSA 2ZTCA 5ITYA 1L1ZA 2HHHM 3R9XB 1GVNA 2LH0A 3K9OA 3PNYA 3IG5A 3GLIB 3KOYE 3KP1E 4NXMM 1JR3D 1SXJB 1Z5AA 1HNWM 4LJ9A 2EA0A 4L16A 4KHPM 1QAMA 1XXHA 2DZLA 2MGWA 4FCTA 1XB2B 3T38A 4DR5M 4DR6M 1ZQ9A 4XK8F 3TQSA 4JI6M 1GO5A 1XXHE 2VF8A 2WZJA 4JXJA 1JR3E 3W68A 3HX3A 4DUYM 2HL7A 5ITXE 3H4JA 3KVWA 1C7YA 4LF6M 1G3IA 2UXCM 4JI4M 2C99A 4GH9A 3VKGA 1HQYE 2EKFA 2KRKA 2LHGA 3KSJA 4DBGB 4FCVA 5EXSA 2KEBA 3IECA 4LJ7A 1IBLM 3U60B 1TH2A 3RGSA 3AL0C 1E32A 5EQTA 1NV8A 1QANA 3L26A 1W5SA 4FCWA 2DWZB 1R2ZA 1IBMM 1G41A 4I81A 1L8QA 4G4NA 2H5XA 1SXJE 3U6QA 4DV5M 1TH4A 2FNAA 4LFCM 2OPFA 4GITA 3FYDA 5FTJA 1XNRM 1PJJA 1NNUC 1D0LA 1XXHB 2JP7A 3T6PA 1I94M 2DENA 3VKHA 4DV1M 1MN3A 2WSEF 1PJIA 1XWIA 1Y8GA 4OU7A 2RRUA 2J7NA 3AOGA 5GKNA 5EP3A 2O25A 3U6DA 2DHYA 3I01M 5DYIA 5FTMA 3FUXA 3SARA 2EKKA 3GLGB 3DOAA 1Z5BA 3IHPA 4NL4H 5ITQA 5F3WA 4CJ6A 3BBZA 4KO8A 1NJGA 2C9OA 2J7OA 2L09A 1TH3A 3RGPA 4DR3M 3SASA 1WGLA 3B7ZA 1VEJA 1DO2A 4G6ZA 2F5PA 2UXDM 4AKGA 1SXJD 1V34A 2OO9A 2Q2EB 3HKPA 4MH0E 3U6EA 2QPAA 4Y28F 4ITQA 2JXNA 3SHGB 3GO8A 1SXJA 1VEGA 5EP4A 4DV6M 4LF7M 2ERCA 3D8LA 4F1IA 4YY3M 1T43A 3V76A 2QQ8A 3UJNA 2OOAA 1NSFA 4BLCA 2JZ1A 3CGWA 2YR0A 1SG9A 4IJFA 4LJ8A 4JI5M 1YUBA 5KQ8A 1L2CA 1ZMWA 4JI0M 1W5TA 1N75A 2KXEA 4NSOB 3LMMA 2CEAA 1DO0A 4FWHA 4QNRA 1IXRC 2BJWA 2YNMD 1WXQA 4QOZC 3JR4A 3VK8A 2C5RA 3GLHA 2VIIA 8CATA 1JR3A 1NVMA 4B7FA 1TDHA 4JI8M 3SAWA 2R46A 3U61B 3PXGA 3U6SA 5IT9S 3L25A 3W0LB 3ZC7B 2R65A 2J5YA 2DAGA 2HCBA 2ZTDA 5KPZA 3GLFB 2P5TA 4MGHA 3K92A 1BVSA 2X4AA 1DV0A 2XEPA 4JV5M 1IBKM 3BXWA 4ANRA 2CHGA 5BR8M 4G4RA 2LVNC 3U61A 1E9SA 3HY5A 5E6JA 1WR1B 2BWEA 4RNAA 1NO1A 1Z5CA 4D80A 3FKEA 3E4RA 3QYBA 4LF4M 3T1HM 1HQCA 2JY5A 4X66M 2I7PA 3DFZA 2X8AA 3GPPA 2DNAA 3TWMA 4P17A 2G8LA 4DR7M 1QZEA 3J81S 1YE9A 4JI7M 2MH8A 2CRUA 1OFIA 4NC6A 4OVZA 2QSFX 5KPTA 3NWLA 3U5ZB 4LFAM 1H6UA 2RGOA 4B3TM 2B3TA 2O01F 2KNVA 3FRHA 2Z4SA 3K2LA 4LJ4A 4AI6A 4QHSA 2QNJA 4M9ZA 3GLFE 3B9PA 2LNHC 2OOBA 1OAIA 4ZPXA 4R3DA 2NQ8C 1QVRA 5EXTA 3U6MA 3KS8A 2AHMA 3U6CA 4FVMA 4PCZA 1DGHA 2OQ4A 1E94E 1NHGC 3SHFA 4X62M 5EXXA 3GPUA 2VDBB 3KP0E 3MK6A 4WW0A 3W67A 4AW4A 1EE8A 5IWAM 5FLXS
chains in the Genus database with same CATH topology
2WSFF 3LW5F 2O01F 4XK8F 2WSCF 4KT0F 5L8RF 1JB0F 4L6V6 4Y28F 2WSEF 4RKUF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF F;  3LW5 F;  2O01 F;  4XK8 F;  2WSC F;  4KT0 F;  5L8R F;  1JB0 F;  4L6V 6;  4Y28 F;  2WSE F;  4RKU F; 
#chains in the Genus database with same CATH topology
 3QYE A;  2DZO B;  2L2D A;  2LWX A;  2UUC M;  1EIJ A;  2CHV A;  2JY8 A;  2LTU A;  3GRR A;  3TE6 A;  2HAK A;  4GC9 A;  4OVZ B;  3T15 A;  5KQD A;  2CV0 A;  4QHT A;  4B7G A;  3HZJ A;  3KOZ E;  1X37 A;  3DA1 A;  1N78 A;  1IN6 A;  4IJE A;  3HU1 A;  4L15 A;  3PVS A;  2QBY A;  1D0M A;  1N33 M;  1NY6 A;  2MJ5 B;  3SAT A;  4LZJ A;  2FOI C;  1DGG A;  3BOS A;  3GQ4 A;  5FTL A;  3E9S A;  1IN5 A;  4M9S A;  4LF9 M;  1R2Y A;  3HHW A;  1QUT A;  1XHB A;  4QNM A;  3C58 A;  3SAV A;  2R0I A;  1EFU B;  3WHL A;  2F5N A;  4CHT B;  3L27 A;  1J5E M;  3U60 A;  4PDG A;  1VQ1 A;  2LVO C;  1PJS A;  2F4V M;  1KYI A;  2L7H A;  3KXE C;  4LGY A;  4NXN M;  3SFZ A;  5BPV A;  2R18 A;  4PDI A;  5EP1 A;  2H1R A;  3KSX A;  1J09 A;  4PT5 A;  1OAO C;  2E5L M;  2R6F A;  2EJS A;  3K8Z A;  4IIW A;  2FE8 A;  2CP8 A;  3GLH E;  3LVW A;  3HU3 A;  1NV9 A;  4LGM A;  2DAK A;  4GKJ M;  4GRI A;  3K9P A;  3LCV B;  2R62 A;  3C3D A;  4WUR A;  4G4O A;  3LCU A;  5DNY A;  3A46 A;  2CHQ A;  4IBK A;  1NNJ A;  2CUZ A;  2KNA A;  4D81 A;  2EUC A;  2DVW B;  1NHW C;  1IM2 A;  3EIH A;  4KT0 F;  1KSF X;  1ZAE A;  2XFT A;  3AOE C;  5JI2 E;  4OW0 A;  1QDT A;  3UMM A;  3CTW B;  3HU2 A;  1VG5 A;  3A42 A;  3K1J A;  1HR0 M;  3GP1 A;  2Z3X A;  2K47 A;  3GLG A;  1MJG M;  5C18 A;  1F4I A;  3GPX A;  2UUB M;  1RU3 A;  1DGB A;  2WSF F;  1L2B A;  2LVQ D;  2XLJ A;  1TR8 A;  5EP2 A;  3I51 A;  2KHH A;  2QCU A;  3J27 B;  1MU5 A;  2X49 A;  2ZAM A;  4YHH M;  1PRB A;  1GKI A;  2CFO A;  2D7E A;  1PGY A;  4XBO A;  4AG5 A;  1G59 A;  1I4W A;  4G3O A;  1IXS A;  2GNO A;  2V6Z M;  1MX0 A;  1WIV A;  1IXS B;  3NBI A;  1AIP C;  2XZU A;  3SYL A;  4LY6 A;  3PNV A;  4LRT A;  3IG8 A;  3MJ5 A;  2DWM A;  3ZH9 B;  3SAU A;  3J7B A;  4MGK E;  2APL A;  1S3S A;  4MGY E;  5EJC A;  4JI3 M;  4DR2 M;  4GIP A;  3KDS E;  5JI3 E;  1IN7 A;  4GEW A;  3I4Y A;  2KZS A;  2MRO B;  4R7G A;  3THG A;  3B74 A;  3GRV A;  4L8R C;  4L4U A;  2JY7 A;  1TDZ A;  1NY5 A;  2R45 A;  3HJS A;  2L4E A;  1UM8 A;  2L4F A;  4MGI E;  3T1Y M;  4GHL A;  1ZMU A;  4FWG A;  2CV2 A;  4RF0 A;  1LTM A;  4DV7 M;  4DV3 M;  1N32 M;  4LRS A;  3W0F A;  5FTK A;  3AV0 A;  4IBC A;  2UUA M;  1UFZ A;  3AOE A;  2DHR A;  2F5O A;  3C9P A;  3MMP A;  4CGY B;  3TPZ A;  5LMU M;  2FFJ A;  3SMP A;  3R8F A;  4K0K M;  1OIZ A;  1HT2 E;  3GQ5 A;  1JQJ C;  2JY6 B;  1ZMV A;  2XSZ A;  2L6O A;  3J80 S;  5ITX A;  3ZQJ A;  3B89 A;  2W82 A;  3LQR A;  3HHY A;  1N77 A;  3E21 A;  1Q02 A;  2M5Z A;  2V1C A;  3Q8G A;  1QAO A;  1Q3B A;  1R6B X;  2LVA A;  3VLF B;  2FS1 A;  4LZZ A;  2A5Y B;  2JNH A;  3FUU A;  2C98 A;  3SYK A;  3HHZ A;  4BBA A;  2N35 A;  1VEK A;  2DZN B;  2DAI A;  2DKL A;  3QWL A;  2HKJ A;  2C9C A;  2CWB A;  3TWK A;  3JAM S;  4DUZ M;  1XMQ M;  3FTF A;  2Z8Y M;  1TTE A;  3KW6 A;  3GLI A;  1SXJ C;  2EO2 A;  1HNX M;  3FTE A;  3CF0 A;  2Y21 A;  3UZU A;  3EIE A;  4NOO B;  3GLI E;  1GAB A;  4IBJ A;  2BJV A;  3LQQ A;  1VDD A;  3L2A A;  4IBE A;  4JYA M;  1YLA A;  3MHV C;  2O5R A;  2I7N A;  2JA2 A;  4M0W A;  2KA6 B;  4R71 A;  2UXB M;  3B7Q A;  4L6V 6;  4WP2 A;  3RFW A;  4M0D A;  3GRU A;  3TWL A;  3B7N A;  4LG2 A;  1IY2 A;  4FW9 A;  5H37 D;  1R7R A;  2KNZ A;  3CF2 A;  1Z6T A;  5E26 A;  3GLG E;  4KOD A;  1WHC A;  4B08 A;  1ZV1 A;  2KZU A;  2XZF A;  4JI1 M;  2JUJ A;  5FSW A;  1YSY A;  4A3V B;  1OQY A;  1QYR A;  1V33 A;  1WJ7 A;  3FYC A;  2Y0T A;  2CV1 A;  4F2L A;  4IBD A;  4FD2 A;  4IBB A;  1GJS A;  5A2Q S;  4QOS A;  1J7K A;  1XNQ M;  5FTN A;  1R4G A;  3FRI A;  3A98 B;  1R5L A;  1OKS A;  1T3T A;  1GLN A;  3Q8X A;  3ILK A;  2ZAO A;  3L29 A;  2K9D A;  5EXP A;  1IN8 A;  1K3W A;  4TUW A;  3U5Z A;  3ZCB B;  1P3Q Q;  3FUW A;  4LF8 M;  2YFQ A;  1XMO M;  3AFH A;  2QBY B;  1ORY B;  2HWJ A;  1PJQ A;  1K82 A;  2LXE A;  3HHX A;  3E46 A;  4GC5 A;  3VK7 A;  4W5W A;  3WHK A;  1XC8 A;  2DAM A;  1QUS A;  4OX9 M;  1IQP A;  2LHC A;  1KFV A;  4LJ6 A;  1QDR A;  2G3Q A;  2ZBK B;  3RE8 A;  1K3X A;  4IBF A;  4Q7J A;  5IZ7 D;  1JB0 F;  3NBX X;  4HEO A;  3C3E A;  4AG6 A;  1LV7 A;  1IY0 A;  1TF0 B;  1QQW A;  4KLN A;  1T6O A;  4LF5 M;  2DI0 A;  4GKK M;  3FUT A;  3H4M A;  2Y20 A;  1IFY A;  1FJG M;  2QZ4 A;  2KW0 A;  3I04 M;  2R4J A;  4I5S A;  2XGN A;  3D8B A;  1TGU A;  2MR9 A;  2VF7 A;  4AQY M;  4DR1 M;  3GLH B;  1OIP A;  1Z59 A;  4Z8X A;  2L7I A;  2XF3 A;  2D7H A;  3FE3 A;  2G5G X;  1PJT A;  1DGH B;  1QAQ A;  3J2P B;  1WGN A;  4NSR A;  2DXI A;  3M0E A;  5DYG A;  1IN4 A;  4PD2 A;  4II7 A;  4DV4 M;  5DFL A;  4AZF A;  1L1T A;  4P16 A;  3KS4 A;  4AKH A;  2D7G A;  3AKZ A;  4B3M M;  3CF6 E;  2XH9 A;  3M7G A;  4UN2 B;  4LCB A;  3KOW E;  1C1K A;  4JN6 A;  3VDP A;  2LVP C;  1N34 M;  5KO3 A;  1GL7 A;  3KFU G;  4GHA A;  5LMN M;  1FNN A;  4LJ5 A;  2XFS A;  1G71 A;  2FH0 A;  3J7A S;  1CUK A;  5ITU A;  1G8P A;  4LJA A;  4DR4 M;  2LBC A;  2R4E A;  1D2N A;  3VFD A;  2K6B A;  1NJF A;  3U6P A;  3A45 A;  3HWS A;  5IRE B;  3GPY A;  1N36 M;  1OFH A;  2Y0Q A;  4DV0 M;  2Z7J A;  2V1U A;  4NRV A;  2QEN A;  4IBG A;  2ZAN A;  3TL4 X;  2JZ0 A;  4REZ A;  5C1B A;  3U6O A;  2XSZ D;  4GMQ A;  3HJ8 A;  2BNK A;  3UGJ A;  4NRW A;  4XGI A;  1HJP A;  2UU9 M;  4AKI A;  2DWN A;  2RGH A;  1DGF A;  4M9X A;  4MM3 B;  4LFB M;  4JI2 M;  2KRU A;  4B3R M;  1IY1 A;  5KPR A;  1E9R A;  4I4L A;  2BWB A;  2M60 A;  4B7H A;  2R44 A;  3M6A A;  2C96 A;  3FTD A;  3UK6 A;  1Q39 A;  3QAU A;  2GQF A;  2QP9 X;  4CIZ A;  1HT1 E;  3SMS A;  3OTO M;  3FD9 A;  4FWD A;  1OTR A;  4HLQ A;  4RKU F;  5ITR A;  2ZM6 M;  1AUA A;  4X65 M;  3HGI A;  1V92 A;  3I4V A;  4MGZ E;  3L28 A;  2KDL A;  3PFI A;  4I8O A;  3SBJ A;  1PM5 A;  2F5Q A;  2QHO B;  1GJT A;  2Z4R A;  3DZD A;  3VDU A;  3GLF A;  4IBI A;  3U6L A;  4Z6Y A;  2VQF M;  2CE7 A;  3FTC A;  4CIS A;  3LVV A;  1A5T A;  2YQZ A;  3JR5 A;  1VDL A;  2DWL A;  1Q3C A;  3KOX E;  3LW5 F;  2VQE M;  3GRY A;  1G4A E;  4B3S M;  4EIW A;  2DAE A;  4S12 A;  2RKO A;  3AJI B;  4BB9 A;  2K0B X;  5ITT A;  3FUV A;  4X64 M;  1L2D A;  3HJQ A;  4RF1 A;  4D82 A;  1D0K A;  2WSC F;  1GL6 A;  4HL4 A;  4DV2 M;  1IXZ A;  1OJL A;  7CAT A;  2F5S A;  1HNZ M;  1QZM A;  3SC3 A;  3GQ3 A;  4L78 A;  4G4Q A;  5L8R F;  3F92 A;  4MB7 A;  2JWS A;  2ZTC A;  5ITY A;  1L1Z A;  2HHH M;  3R9X B;  1GVN A;  2LH0 A;  3K9O A;  3PNY A;  3IG5 A;  3GLI B;  3KOY E;  3KP1 E;  4NXM M;  1JR3 D;  1SXJ B;  1Z5A A;  1HNW M;  4LJ9 A;  2EA0 A;  4L16 A;  4KHP M;  1QAM A;  1XXH A;  2DZL A;  2MGW A;  4FCT A;  1XB2 B;  3T38 A;  4DR5 M;  4DR6 M;  1ZQ9 A;  4XK8 F;  3TQS A;  4JI6 M;  1GO5 A;  1XXH E;  2VF8 A;  2WZJ A;  4JXJ A;  1JR3 E;  3W68 A;  3HX3 A;  4DUY M;  2HL7 A;  5ITX E;  3H4J A;  3KVW A;  1C7Y A;  4LF6 M;  1G3I A;  2UXC M;  4JI4 M;  2C99 A;  4GH9 A;  3VKG A;  1HQY E;  2EKF A;  2KRK A;  2LHG A;  3KSJ A;  4DBG B;  4FCV A;  5EXS A;  2KEB A;  3IEC A;  4LJ7 A;  1IBL M;  3U60 B;  1TH2 A;  3RGS A;  3AL0 C;  1E32 A;  5EQT A;  1NV8 A;  1QAN A;  3L26 A;  1W5S A;  4FCW A;  2DWZ B;  1R2Z A;  1IBM M;  1G41 A;  4I81 A;  1L8Q A;  4G4N A;  2H5X A;  1SXJ E;  3U6Q A;  4DV5 M;  1TH4 A;  2FNA A;  4LFC M;  2OPF A;  4GIT A;  3FYD A;  5FTJ A;  1XNR M;  1PJJ A;  1NNU C;  1D0L A;  1XXH B;  2JP7 A;  3T6P A;  1I94 M;  2DEN A;  3VKH A;  4DV1 M;  1MN3 A;  2WSE F;  1PJI A;  1XWI A;  1Y8G A;  4OU7 A;  2RRU A;  2J7N A;  3AOG A;  5GKN A;  5EP3 A;  2O25 A;  3U6D A;  2DHY A;  3I01 M;  5DYI A;  5FTM A;  3FUX A;  3SAR A;  2EKK A;  3GLG B;  3DOA A;  1Z5B A;  3IHP A;  4NL4 H;  5ITQ A;  5F3W A;  4CJ6 A;  3BBZ A;  4KO8 A;  1NJG A;  2C9O A;  2J7O A;  2L09 A;  1TH3 A;  3RGP A;  4DR3 M;  3SAS A;  1WGL A;  3B7Z A;  1VEJ A;  1DO2 A;  4G6Z A;  2F5P A;  2UXD M;  4AKG A;  1SXJ D;  1V34 A;  2OO9 A;  2Q2E B;  3HKP A;  4MH0 E;  3U6E A;  2QPA A;  4Y28 F;  4ITQ A;  2JXN A;  3SHG B;  3GO8 A;  1SXJ A;  1VEG A;  5EP4 A;  4DV6 M;  4LF7 M;  2ERC A;  3D8L A;  4F1I A;  4YY3 M;  1T43 A;  3V76 A;  2QQ8 A;  3UJN A;  2OOA A;  1NSF A;  4BLC A;  2JZ1 A;  3CGW A;  2YR0 A;  1SG9 A;  4IJF A;  4LJ8 A;  4JI5 M;  1YUB A;  5KQ8 A;  1L2C A;  1ZMW A;  4JI0 M;  1W5T A;  1N75 A;  2KXE A;  4NSO B;  3LMM A;  2CEA A;  1DO0 A;  4FWH A;  4QNR A;  1IXR C;  2BJW A;  2YNM D;  1WXQ A;  4QOZ C;  3JR4 A;  3VK8 A;  2C5R A;  3GLH A;  2VII A;  8CAT A;  1JR3 A;  1NVM A;  4B7F A;  1TDH A;  4JI8 M;  3SAW A;  2R46 A;  3U61 B;  3PXG A;  3U6S A;  5IT9 S;  3L25 A;  3W0L B;  3ZC7 B;  2R65 A;  2J5Y A;  2DAG A;  2HCB A;  2ZTD A;  5KPZ A;  3GLF B;  2P5T A;  4MGH A;  3K92 A;  1BVS A;  2X4A A;  1DV0 A;  2XEP A;  4JV5 M;  1IBK M;  3BXW A;  4ANR A;  2CHG A;  5BR8 M;  4G4R A;  2LVN C;  3U61 A;  1E9S A;  3HY5 A;  5E6J A;  1WR1 B;  2BWE A;  4RNA A;  1NO1 A;  1Z5C A;  4D80 A;  3FKE A;  3E4R A;  3QYB A;  4LF4 M;  3T1H M;  1HQC A;  2JY5 A;  4X66 M;  2I7P A;  3DFZ A;  2X8A A;  3GPP A;  2DNA A;  3TWM A;  4P17 A;  2G8L A;  4DR7 M;  1QZE A;  3J81 S;  1YE9 A;  4JI7 M;  2MH8 A;  2CRU A;  1OFI A;  4NC6 A;  4OVZ A;  2QSF X;  5KPT A;  3NWL A;  3U5Z B;  4LFA M;  1H6U A;  2RGO A;  4B3T M;  2B3T A;  2O01 F;  2KNV A;  3FRH A;  2Z4S A;  3K2L A;  4LJ4 A;  4AI6 A;  4QHS A;  2QNJ A;  4M9Z A;  3GLF E;  3B9P A;  2LNH C;  2OOB A;  1OAI A;  4ZPX A;  4R3D A;  2NQ8 C;  1QVR A;  5EXT A;  3U6M A;  3KS8 A;  2AHM A;  3U6C A;  4FVM A;  4PCZ A;  1DGH A;  2OQ4 A;  1E94 E;  1NHG C;  3SHF A;  4X62 M;  5EXX A;  3GPU A;  2VDB B;  3KP0 E;  3MK6 A;  4WW0 A;  3W67 A;  4AW4 A;  1EE8 A;  5IWA M;  5FLX S; 
#chains in the Genus database with same CATH homology
 2WSF F;  3LW5 F;  2O01 F;  4XK8 F;  2WSC F;  4KT0 F;  5L8R F;  1JB0 F;  4L6V 6;  4Y28 F;  2WSE F;  4RKU F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...