2O01F

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 17
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2o01F00
5L8RF 4RKUF 4KT0F 2WSFF 1JB0F 4L6V6 4Y28F 4XK8F 2WSEF 3LW5F 2O01F 2WSCF
chains in the Genus database with same CATH superfamily
2BNKA 3ZQJA 4LGYA 4BB9A 2L6OA 1VQ1A 4M0WA 4MH0E 2AHMA 2JY8A 3K2LA 3UGJA 2CV0A 2F5SA 1N32M 2KA6B 1HT2E 4AZFA 4OU7A 2N35A 1MU5A 1XMOM 4K0KM 4IBFA 3AOEA 3SAWA 2KXEA 2EKKA 2O5RA 3BBZA 1E9SA 1OIPA 2C9OA 2C9CA 2LVPC 1T3TA 2KRKA 2V6ZM 4EIWA 1DGFA 2QPAA 2YFQA 5KQ8A 1PJQA 3U60A 5FTMA 2R6FA 3KDSE 1GJTA 5IWAM 4LFCM 4GRIA 4B7GA 2DAIA 1ZV1A 3KOXE 3L29A 4FCWA 3GPPA 2F5NA 1HR0M 3T38A 3AL0C 2G3QA 3FUXA 2MJ5B 3J7BA 3L2AA 3AKZA 3SAVA 5F3WA 4AI6A 2XFSA 4D81A 3MHVC 5LMUM 1QZEA 2UXBM 3HZJA 2I7PA 4FWGA 1IY1A 4IBDA 4LJ5A 5FSWA 3SASA 2BJVA 4CGYB 2DWLA 3H4JA 3GPUA 2OPFA 4JI3M 2YR0A 1DO0A 3LVWA 2FFJA 2EA0A 1IFYA 2Y20A 2JZ1A 1D0MA 4F2LA 1KYIA 4WP2A 4GC9A 4CHTB 3M0EA 3RE8A 2HKJA 3EIHA 3L28A 4NRVA 1JR3A 3U5ZB 1WXQA 1SXJB 3AJIB 4GMQA 4W5WA 5ITQA 3LVVA 1E94E 3EIEA 4Z6YA 1G8PA 1OIZA 2DKLA 2HWJA 4KT0F 2F5QA 3DA1A 4MGZE 3VFDA 1K3WA 4KHPM 4DV7M 4WW0A 3GRVA 3J80S 2JP7A 1Q3BA 4RNAA 1DO2A 2BWEA 1HQYE 2DENA 2M5ZA 2X4AA 4NXNM 3TPZA 3GQ4A 4G4RA 4PCZA 3VKGA 2CEAA 2LBCA 3L26A 3KVWA 3QWLA 2GQFA 1OFIA 2KW0A 4L4UA 3HHZA 4DV0M 1XC8A 3RGSA 2KRUA 4DV2M 7CATA 1NHWC 4GC5A 1D0KA 2LHGA 4L78A 3R9XB 3LCUA 3DZDA 3OTOM 1EE8A 4DUYM 2DHYA 4LJ8A 2D7HA 1OQYA 4AG5A 2LHCA 1Z5BA 2FOIC 3T15A 1GKIA 1NO1A 2E5LM 3GPYA 2QBYB 2CWBA 1PGYA 1T43A 3B89A 4DV5M 3HX3A 1Z5AA 2QSFX 4QNRA 1JR3E 5GKNA 4L8RC 3A45A 3E4RA 4L15A 4M9ZA 2CV2A 2BJWA 4X65M 1TGUA 2C5RA 1ZMVA 4MB7A 1L2DA 2DHRA 3VLFB 1HJPA 4M9XA 3ILKA 5KPTA 2Y0QA 3I01M 3V76A 2MH8A 4JI4M 4XBOA 5KQDA 4LJ6A 3GLIA 3TWKA 1N33M 2QQ8A 2K0BX 2UU9M 3AV0A 4CISA 1SXJC 2QENA 1P3QQ 4F1IA 1A5TA 1MN3A 4DBGB 4QOSA 3R8FA 1RU3A 1NV9A 2EO2A 3B7NA 3FD9A 4PT5A 3UK6A 4AKGA 3SFZA 2C96A 2EKFA 2H1RA 2VQEM 2BWBA 3NBIA 4YY3M 1MX0A 1QAMA 2DAGA 4RF0A 3SYLA 3SARA 4GKKM 4GITA 1TH4A 5KPRA 3FTDA 3C3EA 3HU3A 1N75A 4DR5M 3TWMA 4LF9M 3GRYA 3BOSA 3SYKA 2ERCA 4FVMA 1J09A 2DZLA 1OKSA 3E46A 4DR4M 4DR7M 1WIVA 2KDLA 1D2NA 1QVRA 3HY5A 3LW5F 3Q8XA 4REZA 3U61B 3RGPA 4MGKE 4S12A 5EJCA 2HHHM 4GHAA 1DV0A 1C7YA 3D8LA 2CRUA 2R18A 4LJAA 4LF8M 3IG8A 4B08A 3HHWA 3DOAA 3A98B 2Z8YM 2X49A 4QOZC 4LFBM 2Z4RA 4ANRA 3GLHA 3GRUA 3MMPA 5FTNA 1ZAEA 4JXJA 1QAOA 3W67A 3FTEA 1G3IA 3SAUA 1HT1E 3C3DA 4MGHA 1GO5A 2C99A 4NRWA 2QBYA 4RKUF 5C18A 1DGHB 2ZM6M 3UMMA 3M6AA 4XGIA 1HNWM 3J2PB 1TH2A 3SHGB 1PJSA 2OOAA 1QZMA 2ZBKB 1XXHB 2HCBA 4DV1M 3C58A 1OJLA 4OVZB 1PRBA 4BLCA 4JYAM 2LVAA 3BXWA 3B7ZA 1PM5A 1SXJD 3GLFA 4JI5M 2LVQD 2MR9A 2Z7JA 1NY5A 1Q3CA 3GPXA 3U6CA 2CV1A 3VDPA 2VIIA 3FKEA 1VDLA 3IECA 1N77A 3T1YM 3U6PA 2V1CA 3GO8A 4LJ7A 3PNYA 3W68A 3ZC7B 5H37D 1HNZM 3KP0E 5ITRA 3ZCBB 1I4WA 1Q02A 3KP1E 5DYGA 2DVWB 5L8RF 1S3SA 3W0FA 2B3TA 2D7GA 5JI3E 2ZAMA 3I51A 3LCVB 2LTUA 4GH9A 2XSZD 4X62M 1WJ7A 1GLNA 2I7NA 3GRRA 2XEPA 4L6V6 3UJNA 3VKHA 1JQJC 2CE7A 1K3XA 2DXIA 4I81A 4NXMM 1R6BX 1ZMWA 1IN4A 1XNQM 3CGWA 1MJGM 4G4NA 1UFZA 2J5YA 1G59A 1GJSA 3RFWA 2WZJA 4AW4A 1NY6A 4LF5M 2QP9X 2DAKA 3VK7A 3I4YA 2H5XA 1HNXM 4LJ9A 5EQTA 5BPVA 3J7AS 4ZPXA 3KOYE 3HHXA 3SMPA 5EP4A 1GL6A 5E6JA 3ZH9B 4LRTA 4IBJA 4TUWA 4MGIE 2W82A 1D0LA 3GLFB 1XWIA 2JY6B 3NWLA 3GLIE 5KPZA 1G4AE 4IBKA 5IREB 1XNRM 2XH9A 1R5LA 3QYBA 1OAOC 1TDZA 2UUAM 4CIZA 4LY6A 1JB0F 4DV3M 2XZFA 2L7HA 5EP1A 5IT9S 3CTWB 2KHHA 4AKIA 3L27A 1GL7A 1PJJA 1UM8A 3CF0A 4RF1A 2XSZA 3JAMS 3K8ZA 4LF6M 2ZAOA 2LVOC 2QNJA 4MGYE 4R7GA 1AUAA 2UXCM 4NL4H 4LG2A 2FE8A 3GQ3A 2FS1A 2JNHA 2CP8A 3HJSA 3THGA 2CHQA 4IJEA 4JV5M 5EP2A 4OX9M 5DYIA 1YUBA 2DZNB 3TL4X 1T6OA 1VG5A 1YLAA 1IBLM 1K82A 3U6LA 4GHLA 3U60B 1F4IA 3HKPA 4DR3M 1X37A 1ZMUA 3J81S 5EXSA 1OFHA 3VDUA 3HHYA 1L1TA 1QUSA 1EIJA 2DWNA 2DWZB 5DFLA 4IBCA 5ITXA 3M7GA 4LCBA 4Q7JA 4BBAA 5JI2E 4WURA 4D80A 2EUCA 4FD2A 1PJIA 1TH3A 5IZ7D 1WGNA 4B7FA 3H4MA 1L8QA 4IBBA 3FTFA 4B3MM 1IXSA 3TWLA 1L2CA 1XHBA 4PDGA 4G4OA 3T1HM 1IXRC 1YSYA 3HWSA 3IG5A 3TQSA 1R4GA 3FUTA 1IM2A 2XF3A 3FUUA 4GIPA 4QNMA 2EJSA 4LF4M 1WR1B 2R46A 2R45A 3JR5A 3GLGA 4FW9A 2JA2A 1OAIA 4PDIA 4DR6M 2C98A 4KLNA 3U6OA 1OTRA 3DFZA 4HLQA 5A2QS 2FH0A 4JN6A 2F4VM 3QAUA 4LFAM 3CF6E 2P5TA 2APLA 2O25A 1NHGC 4JI6M 1GABA 4KO8A 3GLGE 1PJTA 1Z6TA 2XZUA 4QHTA 1Y8GA 3HU1A 5FTJA 3U6MA 1N36M 5E26A 4JI8M 1KSFX 2K47A 1IN7A 2CFOA 2J7NA 2Z3XA 4B3TM 3GLHE 1SXJE 4Z8XA 1NV8A 1V33A 3LQQA 2CHGA 2K6BA 4GEWA 2OO9A 4PD2A 5ITXE 4IJFA 4YHHM 4DUZM 3SATA 4AQYM 1IXZA 1EFUB 3GQ5A 2JWSA 2R0IA 4I5SA 4LRSA 3U6SA 1W5SA 2KZUA 4X66M 4DR1M 1L1ZA 1NJFA 1NSFA 3U5ZA 4I4LA 4IBGA 1DGGA 2NQ8C 1N34M 1R2YA 3GLFE 1J5EM 3HJQA 1IBMM 8CATA 4AKHA 4M9SA 1XXHA 1N78A 1J7KA 2LWXA 1LTMA 3SBJA 5ITTA 2QZ4A 2KEBA 1WGLA 2JXNA 1IBKM 1YE9A 4B3RM 1G71A 2KNVA 3E21A 3FUVA 1NVMA 3I04M 3WHKA 3SC3A 3Q8GA 5ITUA 2R65A 3GLGB 1HQCA 3KFUG 3I4VA 1IY2A 2QHOB 4ITQA 1V92A 2F5OA 4JI7M 4FCVA 3MJ5A 4JI2M 3AFHA 1IXSB 4LGMA 2OQ4A 4OW0A 1Z59A 4LZZA 4GKJM 4D82A 4DV4M 2D7EA 1LV7A 2HL7A 2MROB 5C1BA 3JR4A 2L2DA 5EXTA 4HEOA 4G3OA 2VF7A 4CJ6A 2Z4SA 2DNAA 5DNYA 2ZTCA 1BVSA 3UZUA 4FCTA 4DV6M 2ZTDA 5EXXA 3L25A 3KSJA 4FWHA 3FTCA 1QYRA 3KOWE 1C1KA 3PVSA 2DAEA 2MGWA 4G4QA 2DI0A 3W0LB 2RRUA 4XK8F 3U61A 2R44A 4NSRA 1VEJA 4QHSA 2L09A 3GLIB 2G5GX 1G41A 1TDHA 4L16A 1R2ZA 1NNUC 1FNNA 3B9PA 2JUJA 1QDRA 1DGBA 1ORYB 2Q2EB 2JZ0A 4MM3B 4R71A 1L2BA 2LVNC 1VEGA 4LF7M 2V1UA 2ZANA 4UN2B 3QYEA 2FNAA 2KZSA 2R4JA 3PNVA 4R3DA 1FJGM 2DAMA 4G6ZA 3KSXA 5BR8M 2RGHA 2QCUA 1E9RA 1TR8A 4I8OA 3A42A 2WSCF 2VDBB 2JY5A 2K9DA 3KS4A 1Q39A 4IBIA 3U6EA 1JR3D 1IY0A 2KNZA 3PFIA 1IQPA 4DR2M 2YNMD 3FYCA 1IN6A 3KXEC 4NSOB 1NNJA 4B3SM 3MK6A 2RGOA 4NOOB 3VK8A 3E9SA 3FYDA 3K9PA 4B7HA 2LNHC 2WSFF 3FRIA 4IBEA 3HU2A 5FTKA 2UUBM 3AOEC 1XXHE 1TF0B 2KNAA 3AOGA 1QDTA 3PXGA 3J27B 3NBXX 4P17A 4AG6A 2R62A 3GP1A 5FTLA 3HGIA 4P16A 3K92A 2G8LA 2RKOA 3B7QA 3U6QA 2DZOB 2LH0A 2UUCM 2XLJA 2CUZA 1V34A 1W5TA 1SXJA 4II7A 5ITYA 4JI1M 2OOBA 3KS8A 1ZQ9A 2Y21A 1WHCA 1TTEA 3FUWA 3D8BA 5LMNM 3WHLA 1SG9A 1AIPC 1XB2B 2HAKA 2X8AA 4Y28F 3FE3A 3B74A 2O01F 3LQRA 2Y0TA 1VDDA 1VEKA 3KW6A 1IN8A 2R4EA 1DGHA 3FRHA 2A5YB 3F92A 5EP3A 1KFVA 3TE6A 4X64M 1QAQA 4M0DA 4JI0M 3SHFA 2VQFM 3A46A 2F5PA 2UXDM 4HL4A 1QQWA 3GLHB 4LZJA 1QUTA 2JY7A 4NC6A 1I94M 2L4EA 3T6PA 3U6DA 4OVZA 1E32A 3CF2A 5FLXS 2VF8A 2XFTA 2YQZA 3K9OA 3KOZE 1CUKA 2J7OA 1IN5A 4A3VB 1QANA 1GVNA 1XMQM 4IIWA 1H6UA 3K1JA 2CHVA 2XGNA 3LMMA 4LJ4A 1NJGA 2DWMA 5EXPA 3C9PA 4KODA 3SMSA 3IHPA 2L7IA 2GNOA 2L4FA 2LXEA 4FWDA 5KO3A 1R7RA 2WSEF 3HJ8A 2M60A 1Z5CA
chains in the Genus database with same CATH topology
5L8RF 4RKUF 4KT0F 2WSFF 1JB0F 4L6V6 4Y28F 4XK8F 2WSEF 3LW5F 2O01F 2WSCF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R F;  4RKU F;  4KT0 F;  2WSF F;  1JB0 F;  4L6V 6;  4Y28 F;  4XK8 F;  2WSE F;  3LW5 F;  2O01 F;  2WSC F; 
#chains in the Genus database with same CATH topology
 2BNK A;  3ZQJ A;  4LGY A;  4BB9 A;  2L6O A;  1VQ1 A;  4M0W A;  4MH0 E;  2AHM A;  2JY8 A;  3K2L A;  3UGJ A;  2CV0 A;  2F5S A;  1N32 M;  2KA6 B;  1HT2 E;  4AZF A;  4OU7 A;  2N35 A;  1MU5 A;  1XMO M;  4K0K M;  4IBF A;  3AOE A;  3SAW A;  2KXE A;  2EKK A;  2O5R A;  3BBZ A;  1E9S A;  1OIP A;  2C9O A;  2C9C A;  2LVP C;  1T3T A;  2KRK A;  2V6Z M;  4EIW A;  1DGF A;  2QPA A;  2YFQ A;  5KQ8 A;  1PJQ A;  3U60 A;  5FTM A;  2R6F A;  3KDS E;  1GJT A;  5IWA M;  4LFC M;  4GRI A;  4B7G A;  2DAI A;  1ZV1 A;  3KOX E;  3L29 A;  4FCW A;  3GPP A;  2F5N A;  1HR0 M;  3T38 A;  3AL0 C;  2G3Q A;  3FUX A;  2MJ5 B;  3J7B A;  3L2A A;  3AKZ A;  3SAV A;  5F3W A;  4AI6 A;  2XFS A;  4D81 A;  3MHV C;  5LMU M;  1QZE A;  2UXB M;  3HZJ A;  2I7P A;  4FWG A;  1IY1 A;  4IBD A;  4LJ5 A;  5FSW A;  3SAS A;  2BJV A;  4CGY B;  2DWL A;  3H4J A;  3GPU A;  2OPF A;  4JI3 M;  2YR0 A;  1DO0 A;  3LVW A;  2FFJ A;  2EA0 A;  1IFY A;  2Y20 A;  2JZ1 A;  1D0M A;  4F2L A;  1KYI A;  4WP2 A;  4GC9 A;  4CHT B;  3M0E A;  3RE8 A;  2HKJ A;  3EIH A;  3L28 A;  4NRV A;  1JR3 A;  3U5Z B;  1WXQ A;  1SXJ B;  3AJI B;  4GMQ A;  4W5W A;  5ITQ A;  3LVV A;  1E94 E;  3EIE A;  4Z6Y A;  1G8P A;  1OIZ A;  2DKL A;  2HWJ A;  4KT0 F;  2F5Q A;  3DA1 A;  4MGZ E;  3VFD A;  1K3W A;  4KHP M;  4DV7 M;  4WW0 A;  3GRV A;  3J80 S;  2JP7 A;  1Q3B A;  4RNA A;  1DO2 A;  2BWE A;  1HQY E;  2DEN A;  2M5Z A;  2X4A A;  4NXN M;  3TPZ A;  3GQ4 A;  4G4R A;  4PCZ A;  3VKG A;  2CEA A;  2LBC A;  3L26 A;  3KVW A;  3QWL A;  2GQF A;  1OFI A;  2KW0 A;  4L4U A;  3HHZ A;  4DV0 M;  1XC8 A;  3RGS A;  2KRU A;  4DV2 M;  7CAT A;  1NHW C;  4GC5 A;  1D0K A;  2LHG A;  4L78 A;  3R9X B;  3LCU A;  3DZD A;  3OTO M;  1EE8 A;  4DUY M;  2DHY A;  4LJ8 A;  2D7H A;  1OQY A;  4AG5 A;  2LHC A;  1Z5B A;  2FOI C;  3T15 A;  1GKI A;  1NO1 A;  2E5L M;  3GPY A;  2QBY B;  2CWB A;  1PGY A;  1T43 A;  3B89 A;  4DV5 M;  3HX3 A;  1Z5A A;  2QSF X;  4QNR A;  1JR3 E;  5GKN A;  4L8R C;  3A45 A;  3E4R A;  4L15 A;  4M9Z A;  2CV2 A;  2BJW A;  4X65 M;  1TGU A;  2C5R A;  1ZMV A;  4MB7 A;  1L2D A;  2DHR A;  3VLF B;  1HJP A;  4M9X A;  3ILK A;  5KPT A;  2Y0Q A;  3I01 M;  3V76 A;  2MH8 A;  4JI4 M;  4XBO A;  5KQD A;  4LJ6 A;  3GLI A;  3TWK A;  1N33 M;  2QQ8 A;  2K0B X;  2UU9 M;  3AV0 A;  4CIS A;  1SXJ C;  2QEN A;  1P3Q Q;  4F1I A;  1A5T A;  1MN3 A;  4DBG B;  4QOS A;  3R8F A;  1RU3 A;  1NV9 A;  2EO2 A;  3B7N A;  3FD9 A;  4PT5 A;  3UK6 A;  4AKG A;  3SFZ A;  2C96 A;  2EKF A;  2H1R A;  2VQE M;  2BWB A;  3NBI A;  4YY3 M;  1MX0 A;  1QAM A;  2DAG A;  4RF0 A;  3SYL A;  3SAR A;  4GKK M;  4GIT A;  1TH4 A;  5KPR A;  3FTD A;  3C3E A;  3HU3 A;  1N75 A;  4DR5 M;  3TWM A;  4LF9 M;  3GRY A;  3BOS A;  3SYK A;  2ERC A;  4FVM A;  1J09 A;  2DZL A;  1OKS A;  3E46 A;  4DR4 M;  4DR7 M;  1WIV A;  2KDL A;  1D2N A;  1QVR A;  3HY5 A;  3LW5 F;  3Q8X A;  4REZ A;  3U61 B;  3RGP A;  4MGK E;  4S12 A;  5EJC A;  2HHH M;  4GHA A;  1DV0 A;  1C7Y A;  3D8L A;  2CRU A;  2R18 A;  4LJA A;  4LF8 M;  3IG8 A;  4B08 A;  3HHW A;  3DOA A;  3A98 B;  2Z8Y M;  2X49 A;  4QOZ C;  4LFB M;  2Z4R A;  4ANR A;  3GLH A;  3GRU A;  3MMP A;  5FTN A;  1ZAE A;  4JXJ A;  1QAO A;  3W67 A;  3FTE A;  1G3I A;  3SAU A;  1HT1 E;  3C3D A;  4MGH A;  1GO5 A;  2C99 A;  4NRW A;  2QBY A;  4RKU F;  5C18 A;  1DGH B;  2ZM6 M;  3UMM A;  3M6A A;  4XGI A;  1HNW M;  3J2P B;  1TH2 A;  3SHG B;  1PJS A;  2OOA A;  1QZM A;  2ZBK B;  1XXH B;  2HCB A;  4DV1 M;  3C58 A;  1OJL A;  4OVZ B;  1PRB A;  4BLC A;  4JYA M;  2LVA A;  3BXW A;  3B7Z A;  1PM5 A;  1SXJ D;  3GLF A;  4JI5 M;  2LVQ D;  2MR9 A;  2Z7J A;  1NY5 A;  1Q3C A;  3GPX A;  3U6C A;  2CV1 A;  3VDP A;  2VII A;  3FKE A;  1VDL A;  3IEC A;  1N77 A;  3T1Y M;  3U6P A;  2V1C A;  3GO8 A;  4LJ7 A;  3PNY A;  3W68 A;  3ZC7 B;  5H37 D;  1HNZ M;  3KP0 E;  5ITR A;  3ZCB B;  1I4W A;  1Q02 A;  3KP1 E;  5DYG A;  2DVW B;  5L8R F;  1S3S A;  3W0F A;  2B3T A;  2D7G A;  5JI3 E;  2ZAM A;  3I51 A;  3LCV B;  2LTU A;  4GH9 A;  2XSZ D;  4X62 M;  1WJ7 A;  1GLN A;  2I7N A;  3GRR A;  2XEP A;  4L6V 6;  3UJN A;  3VKH A;  1JQJ C;  2CE7 A;  1K3X A;  2DXI A;  4I81 A;  4NXM M;  1R6B X;  1ZMW A;  1IN4 A;  1XNQ M;  3CGW A;  1MJG M;  4G4N A;  1UFZ A;  2J5Y A;  1G59 A;  1GJS A;  3RFW A;  2WZJ A;  4AW4 A;  1NY6 A;  4LF5 M;  2QP9 X;  2DAK A;  3VK7 A;  3I4Y A;  2H5X A;  1HNX M;  4LJ9 A;  5EQT A;  5BPV A;  3J7A S;  4ZPX A;  3KOY E;  3HHX A;  3SMP A;  5EP4 A;  1GL6 A;  5E6J A;  3ZH9 B;  4LRT A;  4IBJ A;  4TUW A;  4MGI E;  2W82 A;  1D0L A;  3GLF B;  1XWI A;  2JY6 B;  3NWL A;  3GLI E;  5KPZ A;  1G4A E;  4IBK A;  5IRE B;  1XNR M;  2XH9 A;  1R5L A;  3QYB A;  1OAO C;  1TDZ A;  2UUA M;  4CIZ A;  4LY6 A;  1JB0 F;  4DV3 M;  2XZF A;  2L7H A;  5EP1 A;  5IT9 S;  3CTW B;  2KHH A;  4AKI A;  3L27 A;  1GL7 A;  1PJJ A;  1UM8 A;  3CF0 A;  4RF1 A;  2XSZ A;  3JAM S;  3K8Z A;  4LF6 M;  2ZAO A;  2LVO C;  2QNJ A;  4MGY E;  4R7G A;  1AUA A;  2UXC M;  4NL4 H;  4LG2 A;  2FE8 A;  3GQ3 A;  2FS1 A;  2JNH A;  2CP8 A;  3HJS A;  3THG A;  2CHQ A;  4IJE A;  4JV5 M;  5EP2 A;  4OX9 M;  5DYI A;  1YUB A;  2DZN B;  3TL4 X;  1T6O A;  1VG5 A;  1YLA A;  1IBL M;  1K82 A;  3U6L A;  4GHL A;  3U60 B;  1F4I A;  3HKP A;  4DR3 M;  1X37 A;  1ZMU A;  3J81 S;  5EXS A;  1OFH A;  3VDU A;  3HHY A;  1L1T A;  1QUS A;  1EIJ A;  2DWN A;  2DWZ B;  5DFL A;  4IBC A;  5ITX A;  3M7G A;  4LCB A;  4Q7J A;  4BBA A;  5JI2 E;  4WUR A;  4D80 A;  2EUC A;  4FD2 A;  1PJI A;  1TH3 A;  5IZ7 D;  1WGN A;  4B7F A;  3H4M A;  1L8Q A;  4IBB A;  3FTF A;  4B3M M;  1IXS A;  3TWL A;  1L2C A;  1XHB A;  4PDG A;  4G4O A;  3T1H M;  1IXR C;  1YSY A;  3HWS A;  3IG5 A;  3TQS A;  1R4G A;  3FUT A;  1IM2 A;  2XF3 A;  3FUU A;  4GIP A;  4QNM A;  2EJS A;  4LF4 M;  1WR1 B;  2R46 A;  2R45 A;  3JR5 A;  3GLG A;  4FW9 A;  2JA2 A;  1OAI A;  4PDI A;  4DR6 M;  2C98 A;  4KLN A;  3U6O A;  1OTR A;  3DFZ A;  4HLQ A;  5A2Q S;  2FH0 A;  4JN6 A;  2F4V M;  3QAU A;  4LFA M;  3CF6 E;  2P5T A;  2APL A;  2O25 A;  1NHG C;  4JI6 M;  1GAB A;  4KO8 A;  3GLG E;  1PJT A;  1Z6T A;  2XZU A;  4QHT A;  1Y8G A;  3HU1 A;  5FTJ A;  3U6M A;  1N36 M;  5E26 A;  4JI8 M;  1KSF X;  2K47 A;  1IN7 A;  2CFO A;  2J7N A;  2Z3X A;  4B3T M;  3GLH E;  1SXJ E;  4Z8X A;  1NV8 A;  1V33 A;  3LQQ A;  2CHG A;  2K6B A;  4GEW A;  2OO9 A;  4PD2 A;  5ITX E;  4IJF A;  4YHH M;  4DUZ M;  3SAT A;  4AQY M;  1IXZ A;  1EFU B;  3GQ5 A;  2JWS A;  2R0I A;  4I5S A;  4LRS A;  3U6S A;  1W5S A;  2KZU A;  4X66 M;  4DR1 M;  1L1Z A;  1NJF A;  1NSF A;  3U5Z A;  4I4L A;  4IBG A;  1DGG A;  2NQ8 C;  1N34 M;  1R2Y A;  3GLF E;  1J5E M;  3HJQ A;  1IBM M;  8CAT A;  4AKH A;  4M9S A;  1XXH A;  1N78 A;  1J7K A;  2LWX A;  1LTM A;  3SBJ A;  5ITT A;  2QZ4 A;  2KEB A;  1WGL A;  2JXN A;  1IBK M;  1YE9 A;  4B3R M;  1G71 A;  2KNV A;  3E21 A;  3FUV A;  1NVM A;  3I04 M;  3WHK A;  3SC3 A;  3Q8G A;  5ITU A;  2R65 A;  3GLG B;  1HQC A;  3KFU G;  3I4V A;  1IY2 A;  2QHO B;  4ITQ A;  1V92 A;  2F5O A;  4JI7 M;  4FCV A;  3MJ5 A;  4JI2 M;  3AFH A;  1IXS B;  4LGM A;  2OQ4 A;  4OW0 A;  1Z59 A;  4LZZ A;  4GKJ M;  4D82 A;  4DV4 M;  2D7E A;  1LV7 A;  2HL7 A;  2MRO B;  5C1B A;  3JR4 A;  2L2D A;  5EXT A;  4HEO A;  4G3O A;  2VF7 A;  4CJ6 A;  2Z4S A;  2DNA A;  5DNY A;  2ZTC A;  1BVS A;  3UZU A;  4FCT A;  4DV6 M;  2ZTD A;  5EXX A;  3L25 A;  3KSJ A;  4FWH A;  3FTC A;  1QYR A;  3KOW E;  1C1K A;  3PVS A;  2DAE A;  2MGW A;  4G4Q A;  2DI0 A;  3W0L B;  2RRU A;  4XK8 F;  3U61 A;  2R44 A;  4NSR A;  1VEJ A;  4QHS A;  2L09 A;  3GLI B;  2G5G X;  1G41 A;  1TDH A;  4L16 A;  1R2Z A;  1NNU C;  1FNN A;  3B9P A;  2JUJ A;  1QDR A;  1DGB A;  1ORY B;  2Q2E B;  2JZ0 A;  4MM3 B;  4R71 A;  1L2B A;  2LVN C;  1VEG A;  4LF7 M;  2V1U A;  2ZAN A;  4UN2 B;  3QYE A;  2FNA A;  2KZS A;  2R4J A;  3PNV A;  4R3D A;  1FJG M;  2DAM A;  4G6Z A;  3KSX A;  5BR8 M;  2RGH A;  2QCU A;  1E9R A;  1TR8 A;  4I8O A;  3A42 A;  2WSC F;  2VDB B;  2JY5 A;  2K9D A;  3KS4 A;  1Q39 A;  4IBI A;  3U6E A;  1JR3 D;  1IY0 A;  2KNZ A;  3PFI A;  1IQP A;  4DR2 M;  2YNM D;  3FYC A;  1IN6 A;  3KXE C;  4NSO B;  1NNJ A;  4B3S M;  3MK6 A;  2RGO A;  4NOO B;  3VK8 A;  3E9S A;  3FYD A;  3K9P A;  4B7H A;  2LNH C;  2WSF F;  3FRI A;  4IBE A;  3HU2 A;  5FTK A;  2UUB M;  3AOE C;  1XXH E;  1TF0 B;  2KNA A;  3AOG A;  1QDT A;  3PXG A;  3J27 B;  3NBX X;  4P17 A;  4AG6 A;  2R62 A;  3GP1 A;  5FTL A;  3HGI A;  4P16 A;  3K92 A;  2G8L A;  2RKO A;  3B7Q A;  3U6Q A;  2DZO B;  2LH0 A;  2UUC M;  2XLJ A;  2CUZ A;  1V34 A;  1W5T A;  1SXJ A;  4II7 A;  5ITY A;  4JI1 M;  2OOB A;  3KS8 A;  1ZQ9 A;  2Y21 A;  1WHC A;  1TTE A;  3FUW A;  3D8B A;  5LMN M;  3WHL A;  1SG9 A;  1AIP C;  1XB2 B;  2HAK A;  2X8A A;  4Y28 F;  3FE3 A;  3B74 A;  2O01 F;  3LQR A;  2Y0T A;  1VDD A;  1VEK A;  3KW6 A;  1IN8 A;  2R4E A;  1DGH A;  3FRH A;  2A5Y B;  3F92 A;  5EP3 A;  1KFV A;  3TE6 A;  4X64 M;  1QAQ A;  4M0D A;  4JI0 M;  3SHF A;  2VQF M;  3A46 A;  2F5P A;  2UXD M;  4HL4 A;  1QQW A;  3GLH B;  4LZJ A;  1QUT A;  2JY7 A;  4NC6 A;  1I94 M;  2L4E A;  3T6P A;  3U6D A;  4OVZ A;  1E32 A;  3CF2 A;  5FLX S;  2VF8 A;  2XFT A;  2YQZ A;  3K9O A;  3KOZ E;  1CUK A;  2J7O A;  1IN5 A;  4A3V B;  1QAN A;  1GVN A;  1XMQ M;  4IIW A;  1H6U A;  3K1J A;  2CHV A;  2XGN A;  3LMM A;  4LJ4 A;  1NJG A;  2DWM A;  5EXP A;  3C9P A;  4KOD A;  3SMS A;  3IHP A;  2L7I A;  2GNO A;  2L4F A;  2LXE A;  4FWD A;  5KO3 A;  1R7R A;  2WSE F;  3HJ8 A;  2M60 A;  1Z5C A; 
#chains in the Genus database with same CATH homology
 5L8R F;  4RKU F;  4KT0 F;  2WSF F;  1JB0 F;  4L6V 6;  4Y28 F;  4XK8 F;  2WSE F;  3LW5 F;  2O01 F;  2WSC F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...