2O01F

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 17
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2o01F00
5L8RF 2WSCF 2WSFF 4KT0F 3LW5F 4L6V6 4XK8F 1JB0F 2WSEF 2O01F 4Y28F 4RKUF
chains in the Genus database with same CATH superfamily
1XB2B 2E5LM 1VG5A 4DV7M 2CV1A 4FWGA 4I4LA 1D0KA 4JI2M 2XFSA 1NY6A 2XSZD 5EXXA 1NV8A 1ORYB 1OKSA 4PDIA 2RGHA 2XH9A 2JA2A 1N75A 3K1JA 3HY5A 2LVAA 1OAOC 2DAMA 3IHPA 4L16A 1DO2A 4QHSA 2APLA 3IG8A 1H6UA 4DR3M 2FNAA 1OTRA 1IN5A 1IN7A 4QNRA 3U60B 4I5SA 2DZLA 2CUZA 1IXSA 5DYGA 1QDRA 2CFOA 3SFZA 2MROB 5KO3A 4NOOB 4MGKE 1OQYA 2LHCA 3FRHA 4FCWA 2R18A 3EIHA 2KNVA 3M6AA 2K9DA 2R4EA 1FNNA 3VK8A 1JR3E 2QPAA 2XZUA 1XNRM 2FOIC 2J5YA 2BWEA 4LJ9A 1EE8A 3GO8A 1G71A 2C9OA 3GPUA 5KPRA 3VDPA 3W0LB 3UMMA 4KHPM 1G4AE 2H1RA 4MM3B 3QYBA 1IN4A 2LXEA 2JUJA 3PNYA 3BXWA 1D2NA 2MH8A 5ITYA 3LVVA 4LF5M 3HU2A 3SBJA 1GVNA 1SXJC 4DV0M 3F92A 4B7HA 4F2LA 4DR4M 4OW0A 4AKGA 2R65A 2DI0A 2G3QA 1E32A 3U5ZB 1RU3A 3FYDA 3U6PA 1GL6A 1MU5A 4LCBA 3UZUA 3SAWA 3FUWA 4LGYA 4AKIA 2Q2EB 4LG2A 1NO1A 3HKPA 4LJ6A 1G59A 4GC5A 4G3OA 2OOAA 1MN3A 4LY6A 2XF3A 2ZM6M 1NJGA 4WP2A 3VDUA 1NNJA 3VFDA 1EIJA 5KPTA 3SAVA 2HKJA 8CATA 2FH0A 4DV1M 2MJ5B 4UN2B 3HGIA 1PJIA 1AIPC 3HHXA 2D7HA 2VF8A 3U6SA 4KT0F 1TDZA 3QAUA 5EJCA 3GPXA 4JN6A 2QBYA 2O01F 4PT5A 4CIZA 1FJGM 2RGOA 2WSFF 1KSFX 4DR2M 4LJ5A 1XWIA 2LWXA 4PD2A 1DGFA 3SMSA 3FTDA 2Y0TA 5DNYA 1IY0A 4W5WA 2LVQD 1I94M 1IN6A 1R6BX 1Y8GA 4QHTA 2Z4SA 4IBEA 2FS1A 5E26A 2GNOA 1HR0M 3I4VA 4XGIA 1BVSA 4OX9M 3T1HM 1A5TA 3IG5A 1F4IA 4DV3M 2CWBA 4OVZB 4R7GA 1V33A 1LTMA 4R3DA 2XEPA 4PCZA 3KVWA 5FTKA 4L78A 4P16A 4QNMA 2DENA 3GLIA 1OJLA 2MGWA 1HT2E 4FCTA 2KA6B 2UXCM 2VDBB 2VF7A 2BWBA 2ZANA 2X8AA 3K9PA 2HCBA 2BNKA 5ITQA 3LCVB 1G41A 2JZ0A 3TPZA 3SYLA 5IREB 4DV6M 1N33M 1WXQA 4GEWA 4Y28F 1QANA 2JZ1A 1L2DA 4AI6A 2F5NA 3AL0C 2LBCA 4JI5M 3JAMS 1QUTA 1N34M 1IXRC 1IXZA 2QCUA 5JI2E 3KW6A 4YHHM 1SXJD 1R4GA 2DKLA 4IBKA 3U6OA 2I7NA 4LZJA 3BOSA 3BBZA 1KYIA 3GLFA 2L09A 4JXJA 1C1KA 2L2DA 4Q7JA 3L28A 4GITA 3VKGA 3HJSA 3PXGA 4NSRA 2LNHC 1N78A 4LRTA 1TDHA 4PDGA 4QOZC 4FCVA 4G4RA 2LTUA 4FVMA 1V92A 4DV5M 1NV9A 2G5GX 3GQ3A 2CHGA 3JR4A 3MMPA 4ZPXA 5EP4A 2DZOB 4II7A 1PGYA 4RF1A 3SC3A 4CGYB 5IT9S 1OAIA 1OIZA 2OO9A 4IIWA 1HNZM 4L4UA 1TF0B 4FW9A 3AOGA 4I81A 2L7IA 4JYAM 5LMNM 1ZQ9A 4DV4M 1IM2A 2JNHA 3AKZA 3C3EA 2XZFA 2CHQA 2DNAA 5JI3E 2CP8A 2UUBM 3VKHA 1VEKA 3GLHE 5FLXS 1NHGC 2DHYA 3KSJA 2R62A 3GQ5A 2C5RA 4D82A 4G4NA 2R46A 2QNJA 4CISA 3I04M 2M60A 3VLFB 3B7NA 3MK6A 4M0DA 4B7GA 2NQ8C 2Z3XA 3U6CA 1L8QA 2J7OA 4IBFA 7CATA 1YE9A 5GKNA 2V1UA 3GPPA 1YSYA 2C98A 4LF7M 1DGHA 1R7RA 2QHOB 1GLNA 1I4WA 1SG9A 2KZUA 3L26A 3FTEA 1QVRA 4GMQA 3HHYA 4MH0E 2F4VM 3U61A 1ZAEA 2JY6B 3IECA 3KXEC 4DR7M 1MX0A 4WW0A 1DO0A 3CTWB 1UM8A 2JXNA 2KHHA 4ANRA 1XXHA 1G8PA 3LMMA 2ZBKB 4LJ4A 3W68A 5LMUM 4LFAM 3SYKA 1TTEA 4LJ8A 1GJSA 3GLFE 3U6QA 3C3DA 2R44A 2UUCM 2X49A 4NXMM 2EO2A 1QZMA 1WGNA 3WHKA 3GRUA 4DR1M 1XHBA 2WZJA 5FTMA 3ZH9B 1PM5A 3U6DA 5A2QS 5F3WA 1D0LA 2EUCA 2LHGA 4HEOA 2QSFX 4LF9M 3GQ4A 4YY3M 4JI1M 3TWLA 2Y0QA 2QQ8A 1N36M 1K3XA 3KOWE 2QENA 4GIPA 3AJIB 3RE8A 5H37D 4AKHA 1ZV1A 3CF6E 2H5XA 4FWDA 3HJQA 3GLHB 3A46A 4MGIE 2EKFA 1WHCA 3CF0A 4AW4A 1VEJA 2FE8A 3UJNA 1ZMUA 1OIPA 2EJSA 2FFJA 1PJJA 2KNZA 4K0KM 2KXEA 3CGWA 3GLGA 3B89A 3D8BA 1HNXM 3OTOM 1IFYA 3K2LA 1X37A 4CJ6A 3FTFA 2V6ZM 1Q3CA 3B7QA 3HU3A 3KP1E 1SXJA 1L1TA 5BR8M 2UXBM 4LFCM 1VDDA 5DYIA 5C1BA 4P17A 1K3WA 1IY1A 2W82A 2F5SA 5EP2A 1WJ7A 3LQRA 3HX3A 4I8OA 1WR1B 3GLFB 1QQWA 3FUTA 2XGNA 3PVSA 1Z59A 3SHGB 1Q3BA 3KSXA 1IQPA 2L4FA 1QAMA 2WSCF 1HQCA 2DWLA 4JV5M 3QYEA 1XXHE 4GH9A 2DWMA 4DUYM 4IJEA 3E21A 3J2PB 4KLNA 3GP1A 3SATA 4AG6A 1IBMM 1YLAA 2C96A 2GQFA 3T6PA 2CE7A 2DAKA 4M9ZA 3EIEA 4G6ZA 4IBCA 3U5ZA 4AQYM 3ILKA 2VQFM 2L4EA 3PNVA 4LJ7A 4B08A 3T1YM 1HJPA 1TR8A 2ZTDA 4BLCA 3M0EA 2O25A 2LVNC 4MGHA 1N77A 1C7YA 1Z5BA 1Z5CA 1TH2A 2DWZB 3I01M 3B74A 3B7ZA 4DR5M 1QZEA 3E46A 1IXSB 3H4JA 5ITXA 2OQ4A 1L2CA 2DVWB 3VK7A 4A3VB 2BJWA 2JY7A 3M7GA 2UXDM 2A5YB 1E9RA 4G4QA 2BJVA 2QP9X 2EA0A 3GRVA 3K9OA 2CV0A 3AV0A 3KOYE 1NHWC 2MR9A 1R2ZA 2DAGA 1TGUA 1JR3A 1EFUB 3GLGE 3UK6A 5EXPA 3THGA 3W67A 1DGHB 2YQZA 1SXJE 2YNMD 2KEBA 2F5PA 4JI3M 1XC8A 3KDSE 4L6V6 3R8FA 1GJTA 2ZAMA 3L27A 3U61B 2HAKA 3DA1A 1E9SA 3NBXX 4AZFA 4OU7A 3SARA 2VQEM 4L8RC 4XBOA 3PFIA 2CHVA 3K92A 1NVMA 2KNAA 3DOAA 3LW5F 2CV2A 2B3TA 2HL7A 4B7FA 3RGSA 3UGJA 4GHLA 4LRSA 3U6EA 1UFZA 3U6LA 2Z4RA 4Z8XA 4LF8M 2D7GA 4RNAA 2KRUA 1IBKM 2RKOA 5FTJA 2Z7JA 3SAUA 2ZAOA 3A42A 4KODA 5L8RF 2G8LA 2K6BA 2M5ZA 3GLIE 3R9XB 2JY8A 3TE6A 4X64M 1GABA 2LH0A 1ZMWA 1D0MA 4MGYE 4D81A 1G3IA 3MJ5A 1QAOA 3KP0E 1Z6TA 3NBIA 4M0WA 5FTNA 3V76A 4FD2A 4DR6M 4RKUF 4JI6M 2R6FA 1T43A 3B9PA 3L2AA 2F5QA 5EQTA 1JR3D 5FSWA 5ITXE 2QBYB 3Q8XA 3GLGB 2C99A 3J27B 1J09A 4GKJM 3LQQA 1PJTA 1L1ZA 4LF4M 4NRVA 4M9XA 3FKEA 1OFIA 1SXJB 5KQ8A 1JB0F 3Q8GA 3CF2A 3K8ZA 2DWNA 1Q02A 2EKKA 3NWLA 2DHRA 2LVPC 2DAEA 2JP7A 4DV2M 1NY5A 2OOBA 2LVOC 4EIWA 4X66M 2HHHM 1R5LA 2ERCA 2V1CA 3ZCBB 3HU1A 2JWSA 5E6JA 1WGLA 1QDTA 5BPVA 3KS8A 1J7KA 1W5SA 1P3QQ 2DAIA 5FTLA 2WSEF 4IJFA 3TQSA 3JR5A 3HWSA 5EP3A 5ITTA 3FUXA 4IBIA 3HHZA 3GRRA 1LV7A 4G4OA 1J5EM 1HNWM 1NNUC 4X65M 3ZC7B 3W0FA 4NXNM 2P5TA 2Y20A 4LGMA 3FE3A 5DFLA 1VEGA 3FYCA 4REZA 3GLIB 3A98B 4HL4A 5EXTA 1IN8A 1VDLA 3T38A 5C18A 1PJQA 3TWMA 2R0IA 2XFTA 1QUSA 1T3TA 3D8LA 1CUKA 2QZ4A 1HT1E 1IBLM 3U60A 1W5TA 3H4MA 3MHVC 3HHWA 4IBJA 4NC6A 3RFWA 4LF6M 2DXIA 2I7PA 3AFHA 3FD9A 1E94E 1S3SA 2O5RA 2ZTCA 3E4RA 3RGPA 2CEAA 3SASA 4MGZE 4S12A 3AOEC 2HWJA 4IBBA 1L2BA 2L6OA 3J7AS 4DBGB 2K47A 3J81S 4TUWA 1Z5AA 5IZ7D 4JI7M 4L15A 1QYRA 3E9SA 2UU9M 4AG5A 3GPYA 3LCUA 4M9SA 1NSFA 2KRKA 2R4JA 3T15A 2UUAM 3GRYA 5KPZA 4XK8F 3SHFA 4NL4H 3TL4X 1XMQM 2DZNB 3KOXE 1ZMVA 5ITUA 5IWAM 1QAQA 4B3MM 4MB7A 4ITQA 2C9CA 2KDLA 4IBGA 4DUZM 3KOZE 2XLJA 1DGGA 4GC9A 1R2YA 2Y21A 4LZZA 3FUUA 1HQYE 1JQJC 1GKIA 3C58A 2AHMA 1TH3A 2JY5A 4NSOB 4NRWA 3L25A 4CHTB 1OFHA 3I4YA 4B3TM 2KZSA 2XSZA 2RRUA 2K0BX 3AOEA 4X62M 1K82A 2Z8YM 4BB9A 4B3RM 3L29A 3GLHA 3FUVA 4GHAA 3KFUG 1NJFA 1GL7A 4F1IA 4R71A 1V34A 1DGBA 5EXSA 1AUAA 4BBAA 1PJSA 1GO5A 2VIIA 1TH4A 1Q39A 2D7EA 2YR0A 5EP1A 3LVWA 4HLQA 3SMPA 4B3SM 2F5OA 3WHLA 4D80A 3A45A 1YUBA 4GKKM 1MJGM 3I51A 3J80S 3DZDA 4LJAA 1XXHB 2J7NA 4KO8A 3C9PA 2CRUA 1XNQM 1VQ1A 3HJ8A 3FTCA 1DV0A 1T6OA 1XMOM 2L7HA 3QWLA 4JI8M 4LFBM 2KW0A 3ZQJA 1KFVA 3U6MA 1N32M 4GRIA 1PRBA 4WURA 3DFZA 2OPFA 3FRIA 4OVZA 2X4AA 4RF0A 4QOSA 4Z6YA 5ITRA 4JI0M 4JI4M 2YFQA 1IY2A 1WIVA 3TWKA 2R45A 2N35A 3HZJA 5KQDA 3KS4A 4FWHA 4IBDA 3J7BA
chains in the Genus database with same CATH topology
5L8RF 2WSCF 2WSFF 4KT0F 3LW5F 4L6V6 4XK8F 1JB0F 2WSEF 2O01F 4Y28F 4RKUF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R F;  2WSC F;  2WSF F;  4KT0 F;  3LW5 F;  4L6V 6;  4XK8 F;  1JB0 F;  2WSE F;  2O01 F;  4Y28 F;  4RKU F; 
#chains in the Genus database with same CATH topology
 1XB2 B;  2E5L M;  1VG5 A;  4DV7 M;  2CV1 A;  4FWG A;  4I4L A;  1D0K A;  4JI2 M;  2XFS A;  1NY6 A;  2XSZ D;  5EXX A;  1NV8 A;  1ORY B;  1OKS A;  4PDI A;  2RGH A;  2XH9 A;  2JA2 A;  1N75 A;  3K1J A;  3HY5 A;  2LVA A;  1OAO C;  2DAM A;  3IHP A;  4L16 A;  1DO2 A;  4QHS A;  2APL A;  3IG8 A;  1H6U A;  4DR3 M;  2FNA A;  1OTR A;  1IN5 A;  1IN7 A;  4QNR A;  3U60 B;  4I5S A;  2DZL A;  2CUZ A;  1IXS A;  5DYG A;  1QDR A;  2CFO A;  3SFZ A;  2MRO B;  5KO3 A;  4NOO B;  4MGK E;  1OQY A;  2LHC A;  3FRH A;  4FCW A;  2R18 A;  3EIH A;  2KNV A;  3M6A A;  2K9D A;  2R4E A;  1FNN A;  3VK8 A;  1JR3 E;  2QPA A;  2XZU A;  1XNR M;  2FOI C;  2J5Y A;  2BWE A;  4LJ9 A;  1EE8 A;  3GO8 A;  1G71 A;  2C9O A;  3GPU A;  5KPR A;  3VDP A;  3W0L B;  3UMM A;  4KHP M;  1G4A E;  2H1R A;  4MM3 B;  3QYB A;  1IN4 A;  2LXE A;  2JUJ A;  3PNY A;  3BXW A;  1D2N A;  2MH8 A;  5ITY A;  3LVV A;  4LF5 M;  3HU2 A;  3SBJ A;  1GVN A;  1SXJ C;  4DV0 M;  3F92 A;  4B7H A;  4F2L A;  4DR4 M;  4OW0 A;  4AKG A;  2R65 A;  2DI0 A;  2G3Q A;  1E32 A;  3U5Z B;  1RU3 A;  3FYD A;  3U6P A;  1GL6 A;  1MU5 A;  4LCB A;  3UZU A;  3SAW A;  3FUW A;  4LGY A;  4AKI A;  2Q2E B;  4LG2 A;  1NO1 A;  3HKP A;  4LJ6 A;  1G59 A;  4GC5 A;  4G3O A;  2OOA A;  1MN3 A;  4LY6 A;  2XF3 A;  2ZM6 M;  1NJG A;  4WP2 A;  3VDU A;  1NNJ A;  3VFD A;  1EIJ A;  5KPT A;  3SAV A;  2HKJ A;  8CAT A;  2FH0 A;  4DV1 M;  2MJ5 B;  4UN2 B;  3HGI A;  1PJI A;  1AIP C;  3HHX A;  2D7H A;  2VF8 A;  3U6S A;  4KT0 F;  1TDZ A;  3QAU A;  5EJC A;  3GPX A;  4JN6 A;  2QBY A;  2O01 F;  4PT5 A;  4CIZ A;  1FJG M;  2RGO A;  2WSF F;  1KSF X;  4DR2 M;  4LJ5 A;  1XWI A;  2LWX A;  4PD2 A;  1DGF A;  3SMS A;  3FTD A;  2Y0T A;  5DNY A;  1IY0 A;  4W5W A;  2LVQ D;  1I94 M;  1IN6 A;  1R6B X;  1Y8G A;  4QHT A;  2Z4S A;  4IBE A;  2FS1 A;  5E26 A;  2GNO A;  1HR0 M;  3I4V A;  4XGI A;  1BVS A;  4OX9 M;  3T1H M;  1A5T A;  3IG5 A;  1F4I A;  4DV3 M;  2CWB A;  4OVZ B;  4R7G A;  1V33 A;  1LTM A;  4R3D A;  2XEP A;  4PCZ A;  3KVW A;  5FTK A;  4L78 A;  4P16 A;  4QNM A;  2DEN A;  3GLI A;  1OJL A;  2MGW A;  1HT2 E;  4FCT A;  2KA6 B;  2UXC M;  2VDB B;  2VF7 A;  2BWB A;  2ZAN A;  2X8A A;  3K9P A;  2HCB A;  2BNK A;  5ITQ A;  3LCV B;  1G41 A;  2JZ0 A;  3TPZ A;  3SYL A;  5IRE B;  4DV6 M;  1N33 M;  1WXQ A;  4GEW A;  4Y28 F;  1QAN A;  2JZ1 A;  1L2D A;  4AI6 A;  2F5N A;  3AL0 C;  2LBC A;  4JI5 M;  3JAM S;  1QUT A;  1N34 M;  1IXR C;  1IXZ A;  2QCU A;  5JI2 E;  3KW6 A;  4YHH M;  1SXJ D;  1R4G A;  2DKL A;  4IBK A;  3U6O A;  2I7N A;  4LZJ A;  3BOS A;  3BBZ A;  1KYI A;  3GLF A;  2L09 A;  4JXJ A;  1C1K A;  2L2D A;  4Q7J A;  3L28 A;  4GIT A;  3VKG A;  3HJS A;  3PXG A;  4NSR A;  2LNH C;  1N78 A;  4LRT A;  1TDH A;  4PDG A;  4QOZ C;  4FCV A;  4G4R A;  2LTU A;  4FVM A;  1V92 A;  4DV5 M;  1NV9 A;  2G5G X;  3GQ3 A;  2CHG A;  3JR4 A;  3MMP A;  4ZPX A;  5EP4 A;  2DZO B;  4II7 A;  1PGY A;  4RF1 A;  3SC3 A;  4CGY B;  5IT9 S;  1OAI A;  1OIZ A;  2OO9 A;  4IIW A;  1HNZ M;  4L4U A;  1TF0 B;  4FW9 A;  3AOG A;  4I81 A;  2L7I A;  4JYA M;  5LMN M;  1ZQ9 A;  4DV4 M;  1IM2 A;  2JNH A;  3AKZ A;  3C3E A;  2XZF A;  2CHQ A;  2DNA A;  5JI3 E;  2CP8 A;  2UUB M;  3VKH A;  1VEK A;  3GLH E;  5FLX S;  1NHG C;  2DHY A;  3KSJ A;  2R62 A;  3GQ5 A;  2C5R A;  4D82 A;  4G4N A;  2R46 A;  2QNJ A;  4CIS A;  3I04 M;  2M60 A;  3VLF B;  3B7N A;  3MK6 A;  4M0D A;  4B7G A;  2NQ8 C;  2Z3X A;  3U6C A;  1L8Q A;  2J7O A;  4IBF A;  7CAT A;  1YE9 A;  5GKN A;  2V1U A;  3GPP A;  1YSY A;  2C98 A;  4LF7 M;  1DGH A;  1R7R A;  2QHO B;  1GLN A;  1I4W A;  1SG9 A;  2KZU A;  3L26 A;  3FTE A;  1QVR A;  4GMQ A;  3HHY A;  4MH0 E;  2F4V M;  3U61 A;  1ZAE A;  2JY6 B;  3IEC A;  3KXE C;  4DR7 M;  1MX0 A;  4WW0 A;  1DO0 A;  3CTW B;  1UM8 A;  2JXN A;  2KHH A;  4ANR A;  1XXH A;  1G8P A;  3LMM A;  2ZBK B;  4LJ4 A;  3W68 A;  5LMU M;  4LFA M;  3SYK A;  1TTE A;  4LJ8 A;  1GJS A;  3GLF E;  3U6Q A;  3C3D A;  2R44 A;  2UUC M;  2X49 A;  4NXM M;  2EO2 A;  1QZM A;  1WGN A;  3WHK A;  3GRU A;  4DR1 M;  1XHB A;  2WZJ A;  5FTM A;  3ZH9 B;  1PM5 A;  3U6D A;  5A2Q S;  5F3W A;  1D0L A;  2EUC A;  2LHG A;  4HEO A;  2QSF X;  4LF9 M;  3GQ4 A;  4YY3 M;  4JI1 M;  3TWL A;  2Y0Q A;  2QQ8 A;  1N36 M;  1K3X A;  3KOW E;  2QEN A;  4GIP A;  3AJI B;  3RE8 A;  5H37 D;  4AKH A;  1ZV1 A;  3CF6 E;  2H5X A;  4FWD A;  3HJQ A;  3GLH B;  3A46 A;  4MGI E;  2EKF A;  1WHC A;  3CF0 A;  4AW4 A;  1VEJ A;  2FE8 A;  3UJN A;  1ZMU A;  1OIP A;  2EJS A;  2FFJ A;  1PJJ A;  2KNZ A;  4K0K M;  2KXE A;  3CGW A;  3GLG A;  3B89 A;  3D8B A;  1HNX M;  3OTO M;  1IFY A;  3K2L A;  1X37 A;  4CJ6 A;  3FTF A;  2V6Z M;  1Q3C A;  3B7Q A;  3HU3 A;  3KP1 E;  1SXJ A;  1L1T A;  5BR8 M;  2UXB M;  4LFC M;  1VDD A;  5DYI A;  5C1B A;  4P17 A;  1K3W A;  1IY1 A;  2W82 A;  2F5S A;  5EP2 A;  1WJ7 A;  3LQR A;  3HX3 A;  4I8O A;  1WR1 B;  3GLF B;  1QQW A;  3FUT A;  2XGN A;  3PVS A;  1Z59 A;  3SHG B;  1Q3B A;  3KSX A;  1IQP A;  2L4F A;  1QAM A;  2WSC F;  1HQC A;  2DWL A;  4JV5 M;  3QYE A;  1XXH E;  4GH9 A;  2DWM A;  4DUY M;  4IJE A;  3E21 A;  3J2P B;  4KLN A;  3GP1 A;  3SAT A;  4AG6 A;  1IBM M;  1YLA A;  2C96 A;  2GQF A;  3T6P A;  2CE7 A;  2DAK A;  4M9Z A;  3EIE A;  4G6Z A;  4IBC A;  3U5Z A;  4AQY M;  3ILK A;  2VQF M;  2L4E A;  3PNV A;  4LJ7 A;  4B08 A;  3T1Y M;  1HJP A;  1TR8 A;  2ZTD A;  4BLC A;  3M0E A;  2O25 A;  2LVN C;  4MGH A;  1N77 A;  1C7Y A;  1Z5B A;  1Z5C A;  1TH2 A;  2DWZ B;  3I01 M;  3B74 A;  3B7Z A;  4DR5 M;  1QZE A;  3E46 A;  1IXS B;  3H4J A;  5ITX A;  2OQ4 A;  1L2C A;  2DVW B;  3VK7 A;  4A3V B;  2BJW A;  2JY7 A;  3M7G A;  2UXD M;  2A5Y B;  1E9R A;  4G4Q A;  2BJV A;  2QP9 X;  2EA0 A;  3GRV A;  3K9O A;  2CV0 A;  3AV0 A;  3KOY E;  1NHW C;  2MR9 A;  1R2Z A;  2DAG A;  1TGU A;  1JR3 A;  1EFU B;  3GLG E;  3UK6 A;  5EXP A;  3THG A;  3W67 A;  1DGH B;  2YQZ A;  1SXJ E;  2YNM D;  2KEB A;  2F5P A;  4JI3 M;  1XC8 A;  3KDS E;  4L6V 6;  3R8F A;  1GJT A;  2ZAM A;  3L27 A;  3U61 B;  2HAK A;  3DA1 A;  1E9S A;  3NBX X;  4AZF A;  4OU7 A;  3SAR A;  2VQE M;  4L8R C;  4XBO A;  3PFI A;  2CHV A;  3K92 A;  1NVM A;  2KNA A;  3DOA A;  3LW5 F;  2CV2 A;  2B3T A;  2HL7 A;  4B7F A;  3RGS A;  3UGJ A;  4GHL A;  4LRS A;  3U6E A;  1UFZ A;  3U6L A;  2Z4R A;  4Z8X A;  4LF8 M;  2D7G A;  4RNA A;  2KRU A;  1IBK M;  2RKO A;  5FTJ A;  2Z7J A;  3SAU A;  2ZAO A;  3A42 A;  4KOD A;  5L8R F;  2G8L A;  2K6B A;  2M5Z A;  3GLI E;  3R9X B;  2JY8 A;  3TE6 A;  4X64 M;  1GAB A;  2LH0 A;  1ZMW A;  1D0M A;  4MGY E;  4D81 A;  1G3I A;  3MJ5 A;  1QAO A;  3KP0 E;  1Z6T A;  3NBI A;  4M0W A;  5FTN A;  3V76 A;  4FD2 A;  4DR6 M;  4RKU F;  4JI6 M;  2R6F A;  1T43 A;  3B9P A;  3L2A A;  2F5Q A;  5EQT A;  1JR3 D;  5FSW A;  5ITX E;  2QBY B;  3Q8X A;  3GLG B;  2C99 A;  3J27 B;  1J09 A;  4GKJ M;  3LQQ A;  1PJT A;  1L1Z A;  4LF4 M;  4NRV A;  4M9X A;  3FKE A;  1OFI A;  1SXJ B;  5KQ8 A;  1JB0 F;  3Q8G A;  3CF2 A;  3K8Z A;  2DWN A;  1Q02 A;  2EKK A;  3NWL A;  2DHR A;  2LVP C;  2DAE A;  2JP7 A;  4DV2 M;  1NY5 A;  2OOB A;  2LVO C;  4EIW A;  4X66 M;  2HHH M;  1R5L A;  2ERC A;  2V1C A;  3ZCB B;  3HU1 A;  2JWS A;  5E6J A;  1WGL A;  1QDT A;  5BPV A;  3KS8 A;  1J7K A;  1W5S A;  1P3Q Q;  2DAI A;  5FTL A;  2WSE F;  4IJF A;  3TQS A;  3JR5 A;  3HWS A;  5EP3 A;  5ITT A;  3FUX A;  4IBI A;  3HHZ A;  3GRR A;  1LV7 A;  4G4O A;  1J5E M;  1HNW M;  1NNU C;  4X65 M;  3ZC7 B;  3W0F A;  4NXN M;  2P5T A;  2Y20 A;  4LGM A;  3FE3 A;  5DFL A;  1VEG A;  3FYC A;  4REZ A;  3GLI B;  3A98 B;  4HL4 A;  5EXT A;  1IN8 A;  1VDL A;  3T38 A;  5C18 A;  1PJQ A;  3TWM A;  2R0I A;  2XFT A;  1QUS A;  1T3T A;  3D8L A;  1CUK A;  2QZ4 A;  1HT1 E;  1IBL M;  3U60 A;  1W5T A;  3H4M A;  3MHV C;  3HHW A;  4IBJ A;  4NC6 A;  3RFW A;  4LF6 M;  2DXI A;  2I7P A;  3AFH A;  3FD9 A;  1E94 E;  1S3S A;  2O5R A;  2ZTC A;  3E4R A;  3RGP A;  2CEA A;  3SAS A;  4MGZ E;  4S12 A;  3AOE C;  2HWJ A;  4IBB A;  1L2B A;  2L6O A;  3J7A S;  4DBG B;  2K47 A;  3J81 S;  4TUW A;  1Z5A A;  5IZ7 D;  4JI7 M;  4L15 A;  1QYR A;  3E9S A;  2UU9 M;  4AG5 A;  3GPY A;  3LCU A;  4M9S A;  1NSF A;  2KRK A;  2R4J A;  3T15 A;  2UUA M;  3GRY A;  5KPZ A;  4XK8 F;  3SHF A;  4NL4 H;  3TL4 X;  1XMQ M;  2DZN B;  3KOX E;  1ZMV A;  5ITU A;  5IWA M;  1QAQ A;  4B3M M;  4MB7 A;  4ITQ A;  2C9C A;  2KDL A;  4IBG A;  4DUZ M;  3KOZ E;  2XLJ A;  1DGG A;  4GC9 A;  1R2Y A;  2Y21 A;  4LZZ A;  3FUU A;  1HQY E;  1JQJ C;  1GKI A;  3C58 A;  2AHM A;  1TH3 A;  2JY5 A;  4NSO B;  4NRW A;  3L25 A;  4CHT B;  1OFH A;  3I4Y A;  4B3T M;  2KZS A;  2XSZ A;  2RRU A;  2K0B X;  3AOE A;  4X62 M;  1K82 A;  2Z8Y M;  4BB9 A;  4B3R M;  3L29 A;  3GLH A;  3FUV A;  4GHA A;  3KFU G;  1NJF A;  1GL7 A;  4F1I A;  4R71 A;  1V34 A;  1DGB A;  5EXS A;  1AUA A;  4BBA A;  1PJS A;  1GO5 A;  2VII A;  1TH4 A;  1Q39 A;  2D7E A;  2YR0 A;  5EP1 A;  3LVW A;  4HLQ A;  3SMP A;  4B3S M;  2F5O A;  3WHL A;  4D80 A;  3A45 A;  1YUB A;  4GKK M;  1MJG M;  3I51 A;  3J80 S;  3DZD A;  4LJA A;  1XXH B;  2J7N A;  4KO8 A;  3C9P A;  2CRU A;  1XNQ M;  1VQ1 A;  3HJ8 A;  3FTC A;  1DV0 A;  1T6O A;  1XMO M;  2L7H A;  3QWL A;  4JI8 M;  4LFB M;  2KW0 A;  3ZQJ A;  1KFV A;  3U6M A;  1N32 M;  4GRI A;  1PRB A;  4WUR A;  3DFZ A;  2OPF A;  3FRI A;  4OVZ A;  2X4A A;  4RF0 A;  4QOS A;  4Z6Y A;  5ITR A;  4JI0 M;  4JI4 M;  2YFQ A;  1IY2 A;  1WIV A;  3TWK A;  2R45 A;  2N35 A;  3HZJ A;  5KQD A;  3KS4 A;  4FWH A;  4IBD A;  3J7B A; 
#chains in the Genus database with same CATH homology
 5L8R F;  2WSC F;  2WSF F;  4KT0 F;  3LW5 F;  4L6V 6;  4XK8 F;  1JB0 F;  2WSE F;  2O01 F;  4Y28 F;  4RKU F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...