2O01J

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 6
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2o01J01
4Y28J 4RKUJ 2QJPC 2YIUC 2WSCJ 2WPVB 4KT0J 2FYNC 5KLIC 1VF5B 4H44B 1ZRTE 3C8VA 2E74B 2D2CB 2O01J 2QSIA 2QJKC 2QJYC 4OGQB 4H0LB 2ZT9B 1S5LX 2QIWA 4I7ZB 5KKZC 2WSEJ 2K9YA 2E75B 2E76B 1Q90D 3LW5J 4H13B 1JB0J 4PV1B 5L8RJ 2WSFJ 4IL6X
chains in the Genus database with same CATH superfamily
4H13C 2FYUK 3KDPB 3PRJA 3GHGC 4KJMA 2KLUA 5B66E 1GL2A 3SFDC 1IK9A 1AQTA 4I2LC 1YJ9P 2QJPB 1LJ2A 4D6TE 2R32A 2KNCA 4AQRD 1NTMK 3VMAA 1QVFO 2WSSH 1G1IA 1E5WA 5CCGD 5CJ4A 5KKZB 1SQVE 1M1KQ 1M8OB 1OVRA 2IFMA 4IOIH 1MKMA 1FZCA 2B9BA 3MUDA 2ZVOB 3KPEA 2O1KA 2K1AA 1LTGC 1QL2A 1VL2A 3IR9A 1L4AB 5E79H 2O1JA 1SQBK 3A0HE 3TGUE 2Y0CA 3KYQA 1R5LA 4TLFA 1VF5D 1IFJA 4U3FJ 2WVRA 4C46A 3IFMA 3U1CA 4IL6E 1VQOP 3QWOC 1RE4A 5AW8B 3JSVC 1VQ9P 1DX7A 1T3JA 1X79B 3G6EP 1IFDA 1GL2B 1H88A 2YIUC 2HODA 1MFTA 1G1JA 3D6YA 2KNCB 1IFMA 3H1LG 4PV1D 2HLOA 2OYOA 2O01N 1SVFA 2IPPA 4U7JA 4RKUJ 2JJLA 4YTPC 3BATA 1OXZA 2WSFH 1FZCB 2IBZG 2QE7H 1LTAC 1FZBA 2P58A 2YMKA 2OYHA 1S2EA 2WQYC 4XA4A 4DOJA 1U7MA 3A2AA 3H1JE 1SQPJ 2Y0DA 5KAIH 5KJ7A 1L0NK 3PLNA 3RK2B 3WUTA 4L73A 3L71J 2M5AA 1D7MA 3GG2A 4BWNA 1OIPA 2E74B 1JTHA 3A5TA 2Q1KA 2BASA 1M7LA 2BEZF 4M3LA 2NPSC 2PGDA 3CCQP 2A06G 4JPZB 1VQ6P 1IZNB 4L76A 1IC2A 2H7HA 4YXWH 4U3FD 3H1LD 1NTKK 1SFCC 1UIXA 1FOSE 1PFIA 1KQLA 3KXDA 3HUSC 3L75G 4OWFA 3PH0A 4PJ0E 3USSA 1KD1Q 1IJDB 2HODB 1JY2P 1TU3F 4IFFA 2M3EA 3IAOA 2IBZD 1NAYA 2ZAEB 3L70G 2HYNA 2I1JA 3Q5RA 2Y9ZA 1H8AA 2YXRB 5AVZB 1NU1K 3Q5PA 3A0BH 3LIDA 1DH3A 4HH2A 2OYIA 2V7QJ 1JM0A 4BXLA 2OYHB 4Y28J 4C7NB 1RQVA 1VQNP 2A06D 1OW6A 4N3YB 2JWAA 2H88C 2QJKC 5AVWB 2C9NY 1L0LK 3F89A 3HTKA 4TT3H 1NH4A 2M5AB 1SQPD 1GTWA 1JTHB 2R3CA 1KTMA 1JY3P 1S4XA 1K05A 3L75D 1OVUA 1FBMA 3C9IA 3O6QA 1OWAA 4YPCA 1WMKA 3W68A 3L70D 4RESB 3W67A 1Y47A 2E76D 3H1LE 1MV8A 1DD3A 2NZ2A 1S3JA 3AE9C 1YHQP 1BE3J 3AEFC 2Q7CA 2E5TA 3VP8A 1FJPA 2Q9IA 1AQ5A 2IBZE 1RF1A 1PV3A 2ZYGA 3WMM0 1E79H 1M57D 2JR8A 4UB6H 5E79E 1J1DB 3R4YA 3HD7A 1P84H 2XZRA 1PP9J 1AV1A 2WPSA 2OARA 3D70A 1JMMA 1HUCA 2OYIB 1NJIQ 2B87B 3I55P 1NTZK 1SS1A 3N7NA 1NVOA 2IYOA 3RL0D 2A06E 1ZMEC 3P8MC 4JF7A 2E75B 1QEXA 4CPGA 3HTKB 4H44D 4OVNF 1QGKB 1WRGA 4OGQD 1FDOA 1LTBC 3L75E 1IFIA 3U1AA 3CC2P 3GLMA 5AW9B 3S9OA 2A45I 1CI6A 3L70E 2WSEH 4R4MA 2AEJA 3ITKA 2QJPC 1AJYA 3CXHH 3CI9A 1KZUB 3HRNA 2PFXA 1KYOE 2BCCJ 4Z1MH 2JWDA 3KZIH 5KKZC 4GDOA 5CCGC 1RF1B 1PPJG 5APTA 2P2UA 3L74J 5KLIB 5KLVG 1SFCB 5KAIE 3HD7D 3L72J 1EDJA 3H1IJ 3HD7B 2AEFA 2P10A 3CX5H 1L4AC 2KLVA 1GW4A 1RF0A 3H1KG 1PP9D 3OAKA 1HF9A 3CCMP 1NWQA 4WY4A 5B5EH 1PGOA 4JYCA 3L74G 2K3RA 3M06A 2ZVNB 2XNXA 2XKMA 2WPRA 2Q5UA 2N9BA 3SFEC 1NKZB 2G8YA 3SSUA 2D2CD 3WUVA 1CI6B 1GL2C 1PPJD 3AE4C 3Q1MA 1T2KC 1HGVA 5AW6B 4EDFA 5TISH 1P84D 3RBZA 1EQ7A 1J2JB 2O3JA 3A0BE 4R4LA 1SQXG 3B5NA 3V2QA 3I5CA 2ZT9D 3M0DA 3H1KD 3PHLA 3PP5A 5BVZA 1FZCC 1S5LX 1VQ5P 4HJGH 3MUDC 2Y9YA 3L74D 1M1JA 1BCCJ 5GTIH 1X0TA 1LTSC 2LKMA 3RK2C 3AEDC 2AXCA 2YXQB 1YIJP 1RHZB 3U59A 3V5BA 3BCCE 2E74C 4WY4B 2JDIH 3CXHD 1GK6A 3MZWB 1FE6A 3Q3DA 1RE4C 1KV4A 4DJGA 2IZ0A 2RN0A 4ZKUA 3G3ZA 3TNUA 1PPJE 2K37A 3B8EB 1N7SD 4XFJA 4UB6E 2R5BA 5KLVE 2WTYA 1OW7A 1VPCA 1EXJA 1P84E 5AVTB 1EXIA 1OVVA 3CX5D 3P8CD 3B5ND 3B5NB 3MD0A 2ZFCA 4K35A 5APUA 1Q90D 3AE2C 3H1KE 1BDDA 4QMAA 1KFMA 2AXTH 2Q3IA 1JO5A 2FYUJ 1P84I 2OYHC 1YYCA 3CMEP 1JNMA 1SLQA 1M1JB 3L74E 2E42A 2V4HA 2FBWC 5KJ7C 1FZFA 2YKQA 1ZRTD 4JBZA 1NKNA 1VQKP 3ZDMA 3CD6P 1YTZT 1JY2N 1NTMJ 3TSIA 3AEGC 2QRXA 2QG4A 2PAJA 1CZQA 3CXHE 2ZXXA 2L91A 1FS0E 4DT0A 3KZIE 2P7JA 2KSJA 1SQXE 2QA4P 2B88A 3AEBC 3TNUB 1VF5B 3CWBJ 1OZHA 3B71A 1FAVA 3CXHI 3I56P 2A45H 1JY2O 2AEMA 4I7ZB 1SQBJ 5AVRB 1NTMG 3KHUA 3MTUE 3TF5A 1JOCA 3P8CE 1N73A 1J1DC 2IFNA 1IFNA 1KB9H 1JY3N 3JC22 5CBOA 2OYIC 5B5EE 2XU6A 4U3FG 3CX5I 3CWBG 2JO1A 3H6PA 1URQD 4PV1B 3PTZA 4GODA 2E75C 1VQ8P 1SQBG 3CL3D 3QH9A 1ZRTE 3C8VA 4H44C 4N78D 5AW4B 1PGJA 1LTJA 2UWJE 3WU2E 1JY3O 3GMAA 3E7KA 3RGUA 3D71A 2JP3A 4IL6X 1PGQA 4EI2A 1YTZI 1NTMD 3V2PA 4LC1A 3N4XA 5AVYB 2WSCH 1AA0A 2A45G 1L0NJ 4JYBA 1RF1C 2V7QH 2FXPA 2YNYA 5KLIC 1SQPG 1S9KD 3CWBD 1NHLA 1OW8A 2DW3A 1N73B 4AYCA 1S5LH 3HD7C 5AVVB 1LNQA 1SQBD 3L71G 1LP1A 3JCUH 1NOHA 3M9HA 5APQA 1NTKJ 2WSCJ 2NRGA 1RQUA 1AFOA 3NXSA 2IDBA 1KQSO 2R3SA 4DZOA 1VDFA 1N8RQ 1SQQK 4N78E 3SWFA 1K73Q 4I1LA 2M3BA 2POHA 1LTJB 3S4RA 4EYYQ 2JEEA 3V6IA 1IK7A 1NU1J 4I6MC 1NTME 2KYVA 4PD4I 3EWKA 1JB0J 3AE7C 1DIPA 2W6BA 1KB9D 4LLHA 3L71D 3AEEC 1L0LJ 1HTLC 1MZ9A 2E5YA 2P1JA 4ZNCA 4U3FE 5APYA 1S9KE 3CWBE 1OFCX 2E76B 3EFGA 2Q3EA 1LT9A 1A02J 1SQBE 3G71P 2Y0EA 3RK3D 1USEA 1RF0C 5APWA 1BSHA 2IX7C 2KZJA 4WY4C 1HGZA 3V2RA 2FYNB 4HKZH 5AW3B 1HWTC 4ASVA 1NTKD 4MN4C 3V2NA 1RH5B 3CCVP 2FFDA 1KORA 2CK3H 2G3AA 1BE3G 1GW3A 1N7LA 4BRYA 3CCUP 1X22A 3LW5J 1ZR2A 3RL0B 1VQPP 3Q2YA 2PP6A 5B66H 4H44B 3VN0A 1SQPE 1W2BO 1Q2NA 1NTZJ 2P67A 5KLVK 4OGQB 1PP9G 1VQ7P 1VQLP 3O6QB 3L71E 4GIFA 3L73J 3B5NC 2N9YB 1YBKA 4WBAA 3M0DC 1T3UA 2ZJSE 4EIJA 1BGYJ 5BU8B 1LT9B 1KB9I 4YXDC 1M1JC 1LTTC 2WT7A 3RK3E 1HH0A 2QM7A 1SQVK 2MKVA 4EOTA 1BE3D 2OTKE 1W2EA 3FGAD 2H89C 3MP7B 5APXA 1RE3A 3A0HH 4D6TJ 1DEEG 3OW2O 3AE1C 3M9BA 1EZVI 5AVUB 2CPSA 1Q86Q 1YJWP 2FFDB 2BCCG 4W7ZA 1S72P 2FXMA 4BRYB 1RY3A 1VF5C 1SQXK 2ZYDA 3H1HJ 3L72G 1ZN5A 3H1IG 4I7ZC 5AW0B 5L8RJ 3GF3A 3JCUE 5CCHA 2QJYB 2LR2A 1YQ3C 3CCEP 3TGUJ 2D2CB 3HE5A 1N7SA 1KMIZ 3AECC 1H0TA 2KZIA 1Q81Q 3H1HG 4PV1C 2WT7B 3SWKA 2H8PD 2BCCD 3P7KA 2JKVA 1KILA 2ZT9B 4IFDK 1BE3E 2HG5D 3TDKA 2GA1A 1EC5A 3VP9A 3OA7A 3P32A 1YITP 3F5HA 3L72D 3M9QA 5CHXA 3L37A 3H1ID 2J59M 3VMZA 1PP9E 3FWNA 4W80A 2KS1A 2QM8A 3CPWO 1EDIA 2YKOA 3CMAP 1JMBA 3H1JJ 5CCHD 3CCLP 4PD4H 1FJKA 3VMXA 3FWLA 4GKGA 1BCCG 4DCKA 1N73C 3HE4A 1NAFA 3H1HD 2LXBA 1JCCA 3VMYA 2K9YA 3L35A 1A02F 1GU5A 2W90A 5CMZA 3HE5B 5APSA 3IF4A 4N6JA 3EQ2A 2KOGA 1N7SB 1LWUA 2N1TA 3TGUD 2W6JH 1H0TB 1DEBA 2BEQD 1KILD 1FZAA 2BCCE 1KILB 1QVGO 3R2PA 1UIIA 1AVOA 1LTJC 2WMMA 3V4QA 2OTJP 2KB7P 3CCSP 2XV5A 1URQA 2WPQA 3L72E 3AE5C 3H1IE 2CPBA 2KS1B 1BCCD 2W8ZA 1KQGB 1EDKA 4KT0J 3KQGA 5KTBA 1VQMP 3EFFK 3IN6A 2HPCA 4L75A 2KI7B 1NO4A 1GK4A 5CBNA 2GUVA 2FYUG 2FXOA 1W5CE 2K88A 2LXCB 3E1IA 3BRVB 3K5BA 2E76C 3HE4B 4WB4A 1ZXGA 3H1HE 3H1JD 1CSBA 2WWWA 1Q82Q 4HYTB 1MUUA 1L4AD 3CC4P 3MHVA 4H0LD 2K9JA 2QSIA 4AUWA 2N1TD 3VOPA 1ZR4A 4H0LB 1LWUB 1LT1A 2N1TB 3RK3C 1KQFB 3CX5E 2I1KA 4A7PA 1S1CX 3H1LJ 3H25A 2FYNC 2KP8A 1KILE 1KC8Q 4HB1A 1HVVA 3NMDA 5AVQB 1NGMB 3MIWA 1BDCA 1G2CA 1R8EA 1FDMA 1GL2D 1T2KD 4UB8H 1JUNA 3E1RA 2Z5HA 3SWYA 1URQB 3RL0C 2FYUD 5AVSB 4PD4D 2RMZA 5DJTB 2Z5IA 2XNDH 2O01H 1BCCE 1MFZA 2RKLA 2ZYAA 1M56D 3GHGA 4OGQC 1SQPK 3CCRP 2HFED 2HPCB 5APVA 1FZGA 5TISE 1KYOH 5H2FH 4K3AA 2PRRA 3NFQA 3A7OA 3TK1A 4WWIA 2QEXP 2QIWA 5AVXB 4C7NA 1LT9C 3RK2D 2K9JB 2FYZA 3L75J 3O8ZA 4WVZA 2E74D 1IFPA 4ZKPA 1GD2E 1FDIA 3CCJP 5KAFH 3L70J 3M91A 2O01J 5GTIE 3H32A 1T6AA 3TYYA 4Y99B 1VQ4P 2KIKA 2KK7A 1KN7A 2WSFJ 1GZLA 5GTHH 1G2CB 3L4FA 4IFMA 2FFDC 5AW1B 1HJBA 2ITAA 1L0NG 3OJAB 2FYUE 1Y9BA 4H13D 4PD4E 5CJ0A 2Q6QA 1EZVG 4H13B 3T97A 1XTGB 1USDA 3GHGB 2C0XA 2QJYC 2IYPA 1JEKA 1U57A 2D2CC 4NPEA 3G9RA 1NTKG 3VTPC 2W83C 2B87A 3LIEA 2H43A 1SQQJ 1ZV8A 1PL5A 5KJ7D 1QL1A 3V4WA 1HBWA 2OQQA 1BSNA 2J5UA 2AXTE 3UIAA 1ZP0C 2SPZA 3AE3C 1FOSF 5TJHA 3BVHA 3GF7A 2ZT9C 3H32B 1L0ND 2FKWB 1Q7YQ 3RBXA 5M1BA 1NU1G 4LGDE 1RE3C 2FY8A 3LW5H 1M90Q 1Z56A 2VRSA 1AVYA 1LP1B 3VYIA 1SQQG 1EZVD 1GU4A 3RK3B 1YJNP 3RL0g 1KYOD 2NPSA 1L0LG 2XDJA 2YO2A 2WPVB 1K9MQ 1T8ZA 1LGHB 5AW5B 4OH8B 1SFCA 1N2DC 2W6AA 3T97B 1ZLLA 2KSEA 3HUSA 1J1EC 1DD4A 1YQ4C 5CCHC 1PGPA 5K5GB 2YIUB 1WT6A 2W27A 3BCCJ 1Y8AA 2KUBA 1KFNA 1ZW0A 5BU5A 3AEAC 2IBZI 2GM4A 2WITA 1N7SC 2YMYA 1NU1D 1KB9E 1K8AQ 2E75D 1H89A 1X9VA 1SQQD 3FX0A 2KXPB 2MJZA 2M8RA 2QVAA 2L5GB 4UB8E 1KILC 1FU1A 2OTLP 1L0NE 1HJ0A 5KLVJ 3BCCG 1L0LD 5C39A 3A3YB 1R5SA 1OMIA 4GOFA 3BRTB 1EZVE 4GOEA 1NTZG 5AW2B 3B4SA 2NPSD 2HR3A 4ZMDA 3H1KJ 3L73G 2NPSB 5H2FE 1GDTA 1SP4A 1NTKE 1FC2C 1SFCD 1BGYG 1SQVJ 3FXEA 4B86A 3FXDA 4IL6H 3HUSB 2IZ1A 1KYOI 1U7JA 1IO4A 5KAFE 3ABVC 2WSEJ 1EDLA 4H0LC 1LWUC 1S5LE 2N1TC 1JCDA 3S1KA 2C0WA 4D6TG 3BCCD 1NU1E 1FZEA 3WUUA 5GTHE 1SQQE 1SQVG 5EFWB 1SQXJ 1NTZD 3GW6A 3PJSK 1X8YA 1LTIC 3L73D 1L0LE 1PIXA 2QJKB 1XTCC 3C1LA 2B89A 3WU2H 1BGYD 1URQC 4O9BA 5KLVD 1K04A 5AW7B 3BASA 4RJTA 5DJUB 3TGUG 3L36A 4JQ0D 1N86A 4NPDA 3D6ZA 1CW5A 4L74A 2YO3A 4D6TD 2C9LY 2M0BA 4ASWA 2J58A 4C7RA 2R44A 3CC7P 1QLED 4W7YA 2RH0A 1SQVD 2I8DA 5CCGA 2Z4EA 4KHXA 3MGNA 4PJ0H 1OX3A 3M0AA 2WZ7A 3G4SP 2ZXEB 2E43A 1YI2P 1L2PA 4WY4D 1J1EB 3AE8C 2R5DA 1GMJA 4GT1A 3Q5SA 2GUSA 1NTZE 3CLQA 1L4AA 4Y99C 1ZOYC 1NYHA 3NTNA 3AE6C 3L73E 1SQXD 2OGUA 1QX8A 3H1JG 4XE5B 3II6A 4RO0A 1BGYE 4NPFX 2YKPA 1PZQA
chains in the Genus database with same CATH topology
3D70A 3Q5RA 1PIXA 2FXPA 2YIUC 3AEBC 1HF9A 1KQGB 4H13C 4KT0J 5KLIC 3Q3DA 1VF5B 3FGAD 2H89C 2OQQA 3D6YA 3IN6A 3B71A 1OW8A 2J5UA 1HJ0A 1K04A 1ZP0C 3Q5PA 3AE3C 3SFDC 4I7ZB 2QIWA 3AE1C 4PV1D 3SFEC 1ZMEC 1OMIA 3GF7A 2E75B 2ZT9C 2V7QJ 4XFJA 2G8YA 5M1BA 4H44D 1OW7A 2E76C 2E74D 2D2CD 4RKUJ 4U7JA 4Y28J 3D6ZA 4YTPC 1RQVA 2WSCJ 1EXJA 1EXIA 1FDIA 4OGQD 1FDOA 1OW6A 1RQUA 3AE4C 2O01J 4H0LD 3Q1MA 2H88C 2QSIA 2QJKC 1VF5C 1KORA 2YMKA 4H0LB 2WQYC 4TT3H 2IDBA 2G3AA 3GLMA 3S9OA 2K9YA 1KQFB 3RL0g 2JO1A 1KTMA 1Q90D 3AE2C 4I7ZC 3LW5J 1MKMA 1K05A 4PV1B 4R4LA 5L8RJ 3GF3A 4R4MA 2WSFJ 1S1CX 2E75C 2QJPC 3O6QA 3H25A 3Q2YA 1AJYA 2WPVB 2FYNC 4H44B 1YQ3C 1ZRTE 3C8VA 1KILE 2E74B 2D2CB 1WMKA 2ZT9D 1IK7A 4H44C 1VL2A 4Z1MH 4OGQB 3T97B 3AE8C 2BEZF 2FBWC 1GMJA 2BEQD 1NGMB 3Q5SA 2E76D 1S5LX 3ABVC 5KKZC 4GDOA 2WSEJ 1R8EA 1DD3A 1KMIZ 1DD4A 1Y9BA 3GMAA 1YQ4C 4H13D 4H0LC 3EWKA 2NZ2A 1JB0J 3AE7C 3AECC 4H13B 3D71A 1DIPA 2JP3A 1VF5D 4IL6X 3AE9C 1ZOYC 3AEGC 4PV1C 1NYHA 3AEAC 3AEFC 1UIXA 3AE6C 3AEDC 3AEEC 2QJYC 1PV3A 2P10A 2E74C 1U57A 2D2CC 2ZT9B 4YXDC 2E75D 3G9RA 1TU3F 4OGQC 2E76B 3AE5C 3RK3E 3IAOA 3R4YA 1PL5A 2MKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 J;  4RKU J;  2QJP C;  2YIU C;  2WSC J;  2WPV B;  4KT0 J;  2FYN C;  5KLI C;  1VF5 B;  4H44 B;  1ZRT E;  3C8V A;  2E74 B;  2D2C B;  2O01 J;  2QSI A;  2QJK C;  2QJY C;  4OGQ B;  4H0L B;  2ZT9 B;  1S5L X;  2QIW A;  4I7Z B;  5KKZ C;  2WSE J;  2K9Y A;  2E75 B;  2E76 B;  1Q90 D;  3LW5 J;  4H13 B;  1JB0 J;  4PV1 B;  5L8R J;  2WSF J;  4IL6 X; 
#chains in the Genus database with same CATH topology
 4H13 C;  2FYU K;  3KDP B;  3PRJ A;  3GHG C;  4KJM A;  2KLU A;  5B66 E;  1GL2 A;  3SFD C;  1IK9 A;  1AQT A;  4I2L C;  1YJ9 P;  2QJP B;  1LJ2 A;  4D6T E;  2R32 A;  2KNC A;  4AQR D;  1NTM K;  3VMA A;  1QVF O;  2WSS H;  1G1I A;  1E5W A;  5CCG D;  5CJ4 A;  5KKZ B;  1SQV E;  1M1K Q;  1M8O B;  1OVR A;  2IFM A;  4IOI H;  1MKM A;  1FZC A;  2B9B A;  3MUD A;  2ZVO B;  3KPE A;  2O1K A;  2K1A A;  1LTG C;  1QL2 A;  1VL2 A;  3IR9 A;  1L4A B;  5E79 H;  2O1J A;  1SQB K;  3A0H E;  3TGU E;  2Y0C A;  3KYQ A;  1R5L A;  4TLF A;  1VF5 D;  1IFJ A;  4U3F J;  2WVR A;  4C46 A;  3IFM A;  3U1C A;  4IL6 E;  1VQO P;  3QWO C;  1RE4 A;  5AW8 B;  3JSV C;  1VQ9 P;  1DX7 A;  1T3J A;  1X79 B;  3G6E P;  1IFD A;  1GL2 B;  1H88 A;  2YIU C;  2HOD A;  1MFT A;  1G1J A;  3D6Y A;  2KNC B;  1IFM A;  3H1L G;  4PV1 D;  2HLO A;  2OYO A;  2O01 N;  1SVF A;  2IPP A;  4U7J A;  4RKU J;  2JJL A;  4YTP C;  3BAT A;  1OXZ A;  2WSF H;  1FZC B;  2IBZ G;  2QE7 H;  1LTA C;  1FZB A;  2P58 A;  2YMK A;  2OYH A;  1S2E A;  2WQY C;  4XA4 A;  4DOJ A;  1U7M A;  3A2A A;  3H1J E;  1SQP J;  2Y0D A;  5KAI H;  5KJ7 A;  1L0N K;  3PLN A;  3RK2 B;  3WUT A;  4L73 A;  3L71 J;  2M5A A;  1D7M A;  3GG2 A;  4BWN A;  1OIP A;  2E74 B;  1JTH A;  3A5T A;  2Q1K A;  2BAS A;  1M7L A;  2BEZ F;  4M3L A;  2NPS C;  2PGD A;  3CCQ P;  2A06 G;  4JPZ B;  1VQ6 P;  1IZN B;  4L76 A;  1IC2 A;  2H7H A;  4YXW H;  4U3F D;  3H1L D;  1NTK K;  1SFC C;  1UIX A;  1FOS E;  1PFI A;  1KQL A;  3KXD A;  3HUS C;  3L75 G;  4OWF A;  3PH0 A;  4PJ0 E;  3USS A;  1KD1 Q;  1IJD B;  2HOD B;  1JY2 P;  1TU3 F;  4IFF A;  2M3E A;  3IAO A;  2IBZ D;  1NAY A;  2ZAE B;  3L70 G;  2HYN A;  2I1J A;  3Q5R A;  2Y9Z A;  1H8A A;  2YXR B;  5AVZ B;  1NU1 K;  3Q5P A;  3A0B H;  3LID A;  1DH3 A;  4HH2 A;  2OYI A;  2V7Q J;  1JM0 A;  4BXL A;  2OYH B;  4Y28 J;  4C7N B;  1RQV A;  1VQN P;  2A06 D;  1OW6 A;  4N3Y B;  2JWA A;  2H88 C;  2QJK C;  5AVW B;  2C9N Y;  1L0L K;  3F89 A;  3HTK A;  4TT3 H;  1NH4 A;  2M5A B;  1SQP D;  1GTW A;  1JTH B;  2R3C A;  1KTM A;  1JY3 P;  1S4X A;  1K05 A;  3L75 D;  1OVU A;  1FBM A;  3C9I A;  3O6Q A;  1OWA A;  4YPC A;  1WMK A;  3W68 A;  3L70 D;  4RES B;  3W67 A;  1Y47 A;  2E76 D;  3H1L E;  1MV8 A;  1DD3 A;  2NZ2 A;  1S3J A;  3AE9 C;  1YHQ P;  1BE3 J;  3AEF C;  2Q7C A;  2E5T A;  3VP8 A;  1FJP A;  2Q9I A;  1AQ5 A;  2IBZ E;  1RF1 A;  1PV3 A;  2ZYG A;  3WMM 0;  1E79 H;  1M57 D;  2JR8 A;  4UB6 H;  5E79 E;  1J1D B;  3R4Y A;  3HD7 A;  1P84 H;  2XZR A;  1PP9 J;  1AV1 A;  2WPS A;  2OAR A;  3D70 A;  1JMM A;  1HUC A;  2OYI B;  1NJI Q;  2B87 B;  3I55 P;  1NTZ K;  1SS1 A;  3N7N A;  1NVO A;  2IYO A;  3RL0 D;  2A06 E;  1ZME C;  3P8M C;  4JF7 A;  2E75 B;  1QEX A;  4CPG A;  3HTK B;  4H44 D;  4OVN F;  1QGK B;  1WRG A;  4OGQ D;  1FDO A;  1LTB C;  3L75 E;  1IFI A;  3U1A A;  3CC2 P;  3GLM A;  5AW9 B;  3S9O A;  2A45 I;  1CI6 A;  3L70 E;  2WSE H;  4R4M A;  2AEJ A;  3ITK A;  2QJP C;  1AJY A;  3CXH H;  3CI9 A;  1KZU B;  3HRN A;  2PFX A;  1KYO E;  2BCC J;  4Z1M H;  2JWD A;  3KZI H;  5KKZ C;  4GDO A;  5CCG C;  1RF1 B;  1PPJ G;  5APT A;  2P2U A;  3L74 J;  5KLI B;  5KLV G;  1SFC B;  5KAI E;  3HD7 D;  3L72 J;  1EDJ A;  3H1I J;  3HD7 B;  2AEF A;  2P10 A;  3CX5 H;  1L4A C;  2KLV A;  1GW4 A;  1RF0 A;  3H1K G;  1PP9 D;  3OAK A;  1HF9 A;  3CCM P;  1NWQ A;  4WY4 A;  5B5E H;  1PGO A;  4JYC A;  3L74 G;  2K3R A;  3M06 A;  2ZVN B;  2XNX A;  2XKM A;  2WPR A;  2Q5U A;  2N9B A;  3SFE C;  1NKZ B;  2G8Y A;  3SSU A;  2D2C D;  3WUV A;  1CI6 B;  1GL2 C;  1PPJ D;  3AE4 C;  3Q1M A;  1T2K C;  1HGV A;  5AW6 B;  4EDF A;  5TIS H;  1P84 D;  3RBZ A;  1EQ7 A;  1J2J B;  2O3J A;  3A0B E;  4R4L A;  1SQX G;  3B5N A;  3V2Q A;  3I5C A;  2ZT9 D;  3M0D A;  3H1K D;  3PHL A;  3PP5 A;  5BVZ A;  1FZC C;  1S5L X;  1VQ5 P;  4HJG H;  3MUD C;  2Y9Y A;  3L74 D;  1M1J A;  1BCC J;  5GTI H;  1X0T A;  1LTS C;  2LKM A;  3RK2 C;  3AED C;  2AXC A;  2YXQ B;  1YIJ P;  1RHZ B;  3U59 A;  3V5B A;  3BCC E;  2E74 C;  4WY4 B;  2JDI H;  3CXH D;  1GK6 A;  3MZW B;  1FE6 A;  3Q3D A;  1RE4 C;  1KV4 A;  4DJG A;  2IZ0 A;  2RN0 A;  4ZKU A;  3G3Z A;  3TNU A;  1PPJ E;  2K37 A;  3B8E B;  1N7S D;  4XFJ A;  4UB6 E;  2R5B A;  5KLV E;  2WTY A;  1OW7 A;  1VPC A;  1EXJ A;  1P84 E;  5AVT B;  1EXI A;  1OVV A;  3CX5 D;  3P8C D;  3B5N D;  3B5N B;  3MD0 A;  2ZFC A;  4K35 A;  5APU A;  1Q90 D;  3AE2 C;  3H1K E;  1BDD A;  4QMA A;  1KFM A;  2AXT H;  2Q3I A;  1JO5 A;  2FYU J;  1P84 I;  2OYH C;  1YYC A;  3CME P;  1JNM A;  1SLQ A;  1M1J B;  3L74 E;  2E42 A;  2V4H A;  2FBW C;  5KJ7 C;  1FZF A;  2YKQ A;  1ZRT D;  4JBZ A;  1NKN A;  1VQK P;  3ZDM A;  3CD6 P;  1YTZ T;  1JY2 N;  1NTM J;  3TSI A;  3AEG C;  2QRX A;  2QG4 A;  2PAJ A;  1CZQ A;  3CXH E;  2ZXX A;  2L91 A;  1FS0 E;  4DT0 A;  3KZI E;  2P7J A;  2KSJ A;  1SQX E;  2QA4 P;  2B88 A;  3AEB C;  3TNU B;  1VF5 B;  3CWB J;  1OZH A;  3B71 A;  1FAV A;  3CXH I;  3I56 P;  2A45 H;  1JY2 O;  2AEM A;  4I7Z B;  1SQB J;  5AVR B;  1NTM G;  3KHU A;  3MTU E;  3TF5 A;  1JOC A;  3P8C E;  1N73 A;  1J1D C;  2IFN A;  1IFN A;  1KB9 H;  1JY3 N;  3JC2 2;  5CBO A;  2OYI C;  5B5E E;  2XU6 A;  4U3F G;  3CX5 I;  3CWB G;  2JO1 A;  3H6P A;  1URQ D;  4PV1 B;  3PTZ A;  4GOD A;  2E75 C;  1VQ8 P;  1SQB G;  3CL3 D;  3QH9 A;  1ZRT E;  3C8V A;  4H44 C;  4N78 D;  5AW4 B;  1PGJ A;  1LTJ A;  2UWJ E;  3WU2 E;  1JY3 O;  3GMA A;  3E7K A;  3RGU A;  3D71 A;  2JP3 A;  4IL6 X;  1PGQ A;  4EI2 A;  1YTZ I;  1NTM D;  3V2P A;  4LC1 A;  3N4X A;  5AVY B;  2WSC H;  1AA0 A;  2A45 G;  1L0N J;  4JYB A;  1RF1 C;  2V7Q H;  2FXP A;  2YNY A;  5KLI C;  1SQP G;  1S9K D;  3CWB D;  1NHL A;  1OW8 A;  2DW3 A;  1N73 B;  4AYC A;  1S5L H;  3HD7 C;  5AVV B;  1LNQ A;  1SQB D;  3L71 G;  1LP1 A;  3JCU H;  1NOH A;  3M9H A;  5APQ A;  1NTK J;  2WSC J;  2NRG A;  1RQU A;  1AFO A;  3NXS A;  2IDB A;  1KQS O;  2R3S A;  4DZO A;  1VDF A;  1N8R Q;  1SQQ K;  4N78 E;  3SWF A;  1K73 Q;  4I1L A;  2M3B A;  2POH A;  1LTJ B;  3S4R A;  4EYY Q;  2JEE A;  3V6I A;  1IK7 A;  1NU1 J;  4I6M C;  1NTM E;  2KYV A;  4PD4 I;  3EWK A;  1JB0 J;  3AE7 C;  1DIP A;  2W6B A;  1KB9 D;  4LLH A;  3L71 D;  3AEE C;  1L0L J;  1HTL C;  1MZ9 A;  2E5Y A;  2P1J A;  4ZNC A;  4U3F E;  5APY A;  1S9K E;  3CWB E;  1OFC X;  2E76 B;  3EFG A;  2Q3E A;  1LT9 A;  1A02 J;  1SQB E;  3G71 P;  2Y0E A;  3RK3 D;  1USE A;  1RF0 C;  5APW A;  1BSH A;  2IX7 C;  2KZJ A;  4WY4 C;  1HGZ A;  3V2R A;  2FYN B;  4HKZ H;  5AW3 B;  1HWT C;  4ASV A;  1NTK D;  4MN4 C;  3V2N A;  1RH5 B;  3CCV P;  2FFD A;  1KOR A;  2CK3 H;  2G3A A;  1BE3 G;  1GW3 A;  1N7L A;  4BRY A;  3CCU P;  1X22 A;  3LW5 J;  1ZR2 A;  3RL0 B;  1VQP P;  3Q2Y A;  2PP6 A;  5B66 H;  4H44 B;  3VN0 A;  1SQP E;  1W2B O;  1Q2N A;  1NTZ J;  2P67 A;  5KLV K;  4OGQ B;  1PP9 G;  1VQ7 P;  1VQL P;  3O6Q B;  3L71 E;  4GIF A;  3L73 J;  3B5N C;  2N9Y B;  1YBK A;  4WBA A;  3M0D C;  1T3U A;  2ZJS E;  4EIJ A;  1BGY J;  5BU8 B;  1LT9 B;  1KB9 I;  4YXD C;  1M1J C;  1LTT C;  2WT7 A;  3RK3 E;  1HH0 A;  2QM7 A;  1SQV K;  2MKV A;  4EOT A;  1BE3 D;  2OTK E;  1W2E A;  3FGA D;  2H89 C;  3MP7 B;  5APX A;  1RE3 A;  3A0H H;  4D6T J;  1DEE G;  3OW2 O;  3AE1 C;  3M9B A;  1EZV I;  5AVU B;  2CPS A;  1Q86 Q;  1YJW P;  2FFD B;  2BCC G;  4W7Z A;  1S72 P;  2FXM A;  4BRY B;  1RY3 A;  1VF5 C;  1SQX K;  2ZYD A;  3H1H J;  3L72 G;  1ZN5 A;  3H1I G;  4I7Z C;  5AW0 B;  5L8R J;  3GF3 A;  3JCU E;  5CCH A;  2QJY B;  2LR2 A;  1YQ3 C;  3CCE P;  3TGU J;  2D2C B;  3HE5 A;  1N7S A;  1KMI Z;  3AEC C;  1H0T A;  2KZI A;  1Q81 Q;  3H1H G;  4PV1 C;  2WT7 B;  3SWK A;  2H8P D;  2BCC D;  3P7K A;  2JKV A;  1KIL A;  2ZT9 B;  4IFD K;  1BE3 E;  2HG5 D;  3TDK A;  2GA1 A;  1EC5 A;  3VP9 A;  3OA7 A;  3P32 A;  1YIT P;  3F5H A;  3L72 D;  3M9Q A;  5CHX A;  3L37 A;  3H1I D;  2J59 M;  3VMZ A;  1PP9 E;  3FWN A;  4W80 A;  2KS1 A;  2QM8 A;  3CPW O;  1EDI A;  2YKO A;  3CMA P;  1JMB A;  3H1J J;  5CCH D;  3CCL P;  4PD4 H;  1FJK A;  3VMX A;  3FWL A;  4GKG A;  1BCC G;  4DCK A;  1N73 C;  3HE4 A;  1NAF A;  3H1H D;  2LXB A;  1JCC A;  3VMY A;  2K9Y A;  3L35 A;  1A02 F;  1GU5 A;  2W90 A;  5CMZ A;  3HE5 B;  5APS A;  3IF4 A;  4N6J A;  3EQ2 A;  2KOG A;  1N7S B;  1LWU A;  2N1T A;  3TGU D;  2W6J H;  1H0T B;  1DEB A;  2BEQ D;  1KIL D;  1FZA A;  2BCC E;  1KIL B;  1QVG O;  3R2P A;  1UII A;  1AVO A;  1LTJ C;  2WMM A;  3V4Q A;  2OTJ P;  2KB7 P;  3CCS P;  2XV5 A;  1URQ A;  2WPQ A;  3L72 E;  3AE5 C;  3H1I E;  2CPB A;  2KS1 B;  1BCC D;  2W8Z A;  1KQG B;  1EDK A;  4KT0 J;  3KQG A;  5KTB A;  1VQM P;  3EFF K;  3IN6 A;  2HPC A;  4L75 A;  2KI7 B;  1NO4 A;  1GK4 A;  5CBN A;  2GUV A;  2FYU G;  2FXO A;  1W5C E;  2K88 A;  2LXC B;  3E1I A;  3BRV B;  3K5B A;  2E76 C;  3HE4 B;  4WB4 A;  1ZXG A;  3H1H E;  3H1J D;  1CSB A;  2WWW A;  1Q82 Q;  4HYT B;  1MUU A;  1L4A D;  3CC4 P;  3MHV A;  4H0L D;  2K9J A;  2QSI A;  4AUW A;  2N1T D;  3VOP A;  1ZR4 A;  4H0L B;  1LWU B;  1LT1 A;  2N1T B;  3RK3 C;  1KQF B;  3CX5 E;  2I1K A;  4A7P A;  1S1C X;  3H1L J;  3H25 A;  2FYN C;  2KP8 A;  1KIL E;  1KC8 Q;  4HB1 A;  1HVV A;  3NMD A;  5AVQ B;  1NGM B;  3MIW A;  1BDC A;  1G2C A;  1R8E A;  1FDM A;  1GL2 D;  1T2K D;  4UB8 H;  1JUN A;  3E1R A;  2Z5H A;  3SWY A;  1URQ B;  3RL0 C;  2FYU D;  5AVS B;  4PD4 D;  2RMZ A;  5DJT B;  2Z5I A;  2XND H;  2O01 H;  1BCC E;  1MFZ A;  2RKL A;  2ZYA A;  1M56 D;  3GHG A;  4OGQ C;  1SQP K;  3CCR P;  2HFE D;  2HPC B;  5APV A;  1FZG A;  5TIS E;  1KYO H;  5H2F H;  4K3A A;  2PRR A;  3NFQ A;  3A7O A;  3TK1 A;  4WWI A;  2QEX P;  2QIW A;  5AVX B;  4C7N A;  1LT9 C;  3RK2 D;  2K9J B;  2FYZ A;  3L75 J;  3O8Z A;  4WVZ A;  2E74 D;  1IFP A;  4ZKP A;  1GD2 E;  1FDI A;  3CCJ P;  5KAF H;  3L70 J;  3M91 A;  2O01 J;  5GTI E;  3H32 A;  1T6A A;  3TYY A;  4Y99 B;  1VQ4 P;  2KIK A;  2KK7 A;  1KN7 A;  2WSF J;  1GZL A;  5GTH H;  1G2C B;  3L4F A;  4IFM A;  2FFD C;  5AW1 B;  1HJB A;  2ITA A;  1L0N G;  3OJA B;  2FYU E;  1Y9B A;  4H13 D;  4PD4 E;  5CJ0 A;  2Q6Q A;  1EZV G;  4H13 B;  3T97 A;  1XTG B;  1USD A;  3GHG B;  2C0X A;  2QJY C;  2IYP A;  1JEK A;  1U57 A;  2D2C C;  4NPE A;  3G9R A;  1NTK G;  3VTP C;  2W83 C;  2B87 A;  3LIE A;  2H43 A;  1SQQ J;  1ZV8 A;  1PL5 A;  5KJ7 D;  1QL1 A;  3V4W A;  1HBW A;  2OQQ A;  1BSN A;  2J5U A;  2AXT E;  3UIA A;  1ZP0 C;  2SPZ A;  3AE3 C;  1FOS F;  5TJH A;  3BVH A;  3GF7 A;  2ZT9 C;  3H32 B;  1L0N D;  2FKW B;  1Q7Y Q;  3RBX A;  5M1B A;  1NU1 G;  4LGD E;  1RE3 C;  2FY8 A;  3LW5 H;  1M90 Q;  1Z56 A;  2VRS A;  1AVY A;  1LP1 B;  3VYI A;  1SQQ G;  1EZV D;  1GU4 A;  3RK3 B;  1YJN P;  3RL0 g;  1KYO D;  2NPS A;  1L0L G;  2XDJ A;  2YO2 A;  2WPV B;  1K9M Q;  1T8Z A;  1LGH B;  5AW5 B;  4OH8 B;  1SFC A;  1N2D C;  2W6A A;  3T97 B;  1ZLL A;  2KSE A;  3HUS A;  1J1E C;  1DD4 A;  1YQ4 C;  5CCH C;  1PGP A;  5K5G B;  2YIU B;  1WT6 A;  2W27 A;  3BCC J;  1Y8A A;  2KUB A;  1KFN A;  1ZW0 A;  5BU5 A;  3AEA C;  2IBZ I;  2GM4 A;  2WIT A;  1N7S C;  2YMY A;  1NU1 D;  1KB9 E;  1K8A Q;  2E75 D;  1H89 A;  1X9V A;  1SQQ D;  3FX0 A;  2KXP B;  2MJZ A;  2M8R A;  2QVA A;  2L5G B;  4UB8 E;  1KIL C;  1FU1 A;  2OTL P;  1L0N E;  1HJ0 A;  5KLV J;  3BCC G;  1L0L D;  5C39 A;  3A3Y B;  1R5S A;  1OMI A;  4GOF A;  3BRT B;  1EZV E;  4GOE A;  1NTZ G;  5AW2 B;  3B4S A;  2NPS D;  2HR3 A;  4ZMD A;  3H1K J;  3L73 G;  2NPS B;  5H2F E;  1GDT A;  1SP4 A;  1NTK E;  1FC2 C;  1SFC D;  1BGY G;  1SQV J;  3FXE A;  4B86 A;  3FXD A;  4IL6 H;  3HUS B;  2IZ1 A;  1KYO I;  1U7J A;  1IO4 A;  5KAF E;  3ABV C;  2WSE J;  1EDL A;  4H0L C;  1LWU C;  1S5L E;  2N1T C;  1JCD A;  3S1K A;  2C0W A;  4D6T G;  3BCC D;  1NU1 E;  1FZE A;  3WUU A;  5GTH E;  1SQQ E;  1SQV G;  5EFW B;  1SQX J;  1NTZ D;  3GW6 A;  3PJS K;  1X8Y A;  1LTI C;  3L73 D;  1L0L E;  1PIX A;  2QJK B;  1XTC C;  3C1L A;  2B89 A;  3WU2 H;  1BGY D;  1URQ C;  4O9B A;  5KLV D;  1K04 A;  5AW7 B;  3BAS A;  4RJT A;  5DJU B;  3TGU G;  3L36 A;  4JQ0 D;  1N86 A;  4NPD A;  3D6Z A;  1CW5 A;  4L74 A;  2YO3 A;  4D6T D;  2C9L Y;  2M0B A;  4ASW A;  2J58 A;  4C7R A;  2R44 A;  3CC7 P;  1QLE D;  4W7Y A;  2RH0 A;  1SQV D;  2I8D A;  5CCG A;  2Z4E A;  4KHX A;  3MGN A;  4PJ0 H;  1OX3 A;  3M0A A;  2WZ7 A;  3G4S P;  2ZXE B;  2E43 A;  1YI2 P;  1L2P A;  4WY4 D;  1J1E B;  3AE8 C;  2R5D A;  1GMJ A;  4GT1 A;  3Q5S A;  2GUS A;  1NTZ E;  3CLQ A;  1L4A A;  4Y99 C;  1ZOY C;  1NYH A;  3NTN A;  3AE6 C;  3L73 E;  1SQX D;  2OGU A;  1QX8 A;  3H1J G;  4XE5 B;  3II6 A;  4RO0 A;  1BGY E;  4NPF X;  2YKP A;  1PZQ A; 
#chains in the Genus database with same CATH homology
 3D70 A;  3Q5R A;  1PIX A;  2FXP A;  2YIU C;  3AEB C;  1HF9 A;  1KQG B;  4H13 C;  4KT0 J;  5KLI C;  3Q3D A;  1VF5 B;  3FGA D;  2H89 C;  2OQQ A;  3D6Y A;  3IN6 A;  3B71 A;  1OW8 A;  2J5U A;  1HJ0 A;  1K04 A;  1ZP0 C;  3Q5P A;  3AE3 C;  3SFD C;  4I7Z B;  2QIW A;  3AE1 C;  4PV1 D;  3SFE C;  1ZME C;  1OMI A;  3GF7 A;  2E75 B;  2ZT9 C;  2V7Q J;  4XFJ A;  2G8Y A;  5M1B A;  4H44 D;  1OW7 A;  2E76 C;  2E74 D;  2D2C D;  4RKU J;  4U7J A;  4Y28 J;  3D6Z A;  4YTP C;  1RQV A;  2WSC J;  1EXJ A;  1EXI A;  1FDI A;  4OGQ D;  1FDO A;  1OW6 A;  1RQU A;  3AE4 C;  2O01 J;  4H0L D;  3Q1M A;  2H88 C;  2QSI A;  2QJK C;  1VF5 C;  1KOR A;  2YMK A;  4H0L B;  2WQY C;  4TT3 H;  2IDB A;  2G3A A;  3GLM A;  3S9O A;  2K9Y A;  1KQF B;  3RL0 g;  2JO1 A;  1KTM A;  1Q90 D;  3AE2 C;  4I7Z C;  3LW5 J;  1MKM A;  1K05 A;  4PV1 B;  4R4L A;  5L8R J;  3GF3 A;  4R4M A;  2WSF J;  1S1C X;  2E75 C;  2QJP C;  3O6Q A;  3H25 A;  3Q2Y A;  1AJY A;  2WPV B;  2FYN C;  4H44 B;  1YQ3 C;  1ZRT E;  3C8V A;  1KIL E;  2E74 B;  2D2C B;  1WMK A;  2ZT9 D;  1IK7 A;  4H44 C;  1VL2 A;  4Z1M H;  4OGQ B;  3T97 B;  3AE8 C;  2BEZ F;  2FBW C;  1GMJ A;  2BEQ D;  1NGM B;  3Q5S A;  2E76 D;  1S5L X;  3ABV C;  5KKZ C;  4GDO A;  2WSE J;  1R8E A;  1DD3 A;  1KMI Z;  1DD4 A;  1Y9B A;  3GMA A;  1YQ4 C;  4H13 D;  4H0L C;  3EWK A;  2NZ2 A;  1JB0 J;  3AE7 C;  3AEC C;  4H13 B;  3D71 A;  1DIP A;  2JP3 A;  1VF5 D;  4IL6 X;  3AE9 C;  1ZOY C;  3AEG C;  4PV1 C;  1NYH A;  3AEA C;  3AEF C;  1UIX A;  3AE6 C;  3AED C;  3AEE C;  2QJY C;  1PV3 A;  2P10 A;  2E74 C;  1U57 A;  2D2C C;  2ZT9 B;  4YXD C;  2E75 D;  3G9R A;  1TU3 F;  4OGQ C;  2E76 B;  3AE5 C;  3RK3 E;  3IAO A;  3R4Y A;  1PL5 A;  2MKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...