2O01J

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
42
structure length
42
Chain Sequence
b'MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 6
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2o01J01
2QJPC 2QJYC 2QSIA 5KKZC 2WSEJ 4H44B 1VF5B 2WSCJ 1Q90D 1S5LX 2QJKC 2YIUC 2QIWA 2WPVB 4PV1B 4IL6X 1JB0J 4RKUJ 1ZRTE 4KT0J 2ZT9B 2K9YA 4I7ZB 4Y28J 5KLIC 3C8VA 2D2CB 2WSFJ 2E75B 4OGQB 2E74B 2FYNC 4H13B 5L8RJ 2E76B 4H0LB 3LW5J 2O01J
chains in the Genus database with same CATH superfamily
1D7MA 1NWQA 2XNDH 2WSEJ 1NTZJ 1LWUC 4ZKPA 3V4QA 5KTBA 3U1AA 1S5LH 4C7NB 3WMM0 3V2PA 5E79E 2OYHA 1SQQE 1XTCC 5KLVG 2YKPA 1YIJP 1GW4A 1M57D 4YTPC 1NVOA 1SQVD 3L72G 1JCDA 1BGYD 1Q90D 1Q86Q 3H1JJ 3CWBD 2J59M 2OYOA 1YBKA 3KZIE 5GTIE 1N7SB 2FXOA 4EYYQ 1BCCJ 2LR2A 3CC4P 4C7NA 2AXTH 5AW7B 1VQ8P 1SQBG 2OYHC 1VF5C 4ASWA 4JF7A 3MD0A 3S4RA 2I8DA 2E74B 1PGJA 2YKQA 3B71A 1VQKP 1KILE 5H2FH 2K37A 2WSCH 4KHXA 1G2CB 2XV5A 1A02F 2Q1KA 1H89A 4U3FG 1LP1B 3ITKA 4O9BA 1GZLA 2G3AA 3A7OA 1FJKA 1BGYE 1MZ9A 1FZGA 2W6BA 4ZNCA 1L0LK 2D2CB 1IFNA 2Y0CA 2YMKA 3CX5H 4L73A 1G2CA 2CK3H 4MN4C 1NTZK 1NJIQ 1HTLC 3CMEP 1JY2N 5CJ4A 4JYCA 5APWA 3HE5A 2NPSD 5AVRB 4W7YA 1ZN5A 5APYA 2KZIA 3IN6A 1FZEA 1NYHA 2HLOA 1SS1A 2P58A 1VQOP 1KFMA 3CXHH 1K05A 1FAVA 4RKUJ 2G8YA 2QM7A 4HH2A 1FDMA 1NTMG 2WSFJ 5KLVJ 2O1JA 1SVFA 1EZVE 1L0LE 1KTMA 3L72J 3B5NB 3P8CD 1KC8Q 2BEZF 1H0TA 3L71D 2KZJA 4K3AA 1BSNA 3IFMA 1YJWP 5KJ7D 4YXWH 1U7JA 4WBAA 2PFXA 2JWAA 3V2QA 1QL2A 2KI7B 1ZR4A 2Z5HA 2E43A 3B5NA 1IC2A 1FDOA 2W90A 1EDKA 1TU3F 1OW8A 4XFJA 3JSVC 3L75D 5CHXA 5KAIH 1BE3D 2YKOA 1AQTA 1HWTC 4JYBA 1EQ7A 1FZCB 4U3FJ 2QG4A 2Q7CA 2L91A 3U1CA 2N9YB 1S9KD 1QGKB 1NGMB 1ZV8A 2V4HA 1NTKJ 1EXIA 1YJ9P 2A06D 2IZ1A 3B5NC 1URQB 4C7RA 1LGHB 2MJZA 1SFCB 4L76A 5CCHA 1NU1J 3RL0g 3TK1A 2O01J 1PGQA 3G71P 3G3ZA 2H43A 5E79H 2E5YA 2ZT9D 2N1TD 2SPZA 4WY4D 2O1KA 1PPJD 1L4AD 2P10A 2W8ZA 2YIUB 4QMAA 2PGDA 3CX5D 4XE5B 3KZIH 3TGUG 1ZW0A 3FX0A 1URQA 3H1KG 1SFCA 3L75E 3SSUA 1BE3E 1DH3A 1X8YA 2RMZA 1MKMA 1N8RQ 3C9IA 1SQBD 3L73G 3NMDA 1AVYA 3RBZA 3M9HA 3W67A 1LTAC 4OGQC 4DOJA 2JEEA 2KS1B 1IK7A 1IZNB 3CXHD 1MV8A 2E75D 5EFWB 1S1CX 3CXHI 3VP9A 1KYOH 1Y47A 3NXSA 1VDFA 3V6IA 2ZFCA 1URQC 3RK3D 5KLVE 4H44B 1FU1A 1SFCC 4IL6X 3L72E 1T2KD 4KT0J 1M8OB 1FDIA 1EDLA 2KS1A 1OFCX 2O01N 1OVVA 3L74J 1OZHA 1NTZG 3CX5E 1W2EA 2KIKA 3JC22 1NTKK 2M3BA 2OTKE 4I1LA 3RGUA 2W27A 4EI2A 5AW5B 3Q5SA 2ZYGA 3IAOA 1SQBE 2YNYA 3H1LJ 1GU5A 1NU1K 2C0WA 2KK7A 1HGVA 2KSJA 2MKVA 3H1JG 1L2PA 1RE4A 4H13D 3L35A 1NTMD 1BCCG 5B5EE 1GW3A 1KQFB 4U3FE 1LT9A 3VMZA 3WUVA 1GL2B 3BCCJ 2Q3IA 2FY8A 1PP9G 1KORA 3AEAC 2R5DA 1NHLA 2WPRA 3M91A 3V4WA 4H44C 5DJTB 1R8EA 1RF1B 2WQYC 2XU6A 1JY2P 2WSEH 1J1DB 3AE4C 5AW0B 3HE4A 3N4XA 1NU1E 5AVQB 1E79H 1RE4C 1SQQD 3L73J 3AE5C 1FZAA 1NAYA 2R5BA 2Q9IA 1LT9C 3H25A 2BCCJ 4R4MA 3MIWA 3CPWO 4H0LC 3BASA 1RF1A 3HD7D 4I2LC 2P2UA 1R5SA 3AE1C 3PH0A 1K73Q 2KOGA 4L74A 3H1HG 5CMZA 2LXBA 3H1IJ 4GODA 1VF5B 3PRJA 3E7KA 1SQXJ 3FWLA 1JCCA 3C1LA 3GF7A 4JBZA 4YPCA 1U57A 3E1IA 2B88A 2NRGA 3A3YB 1HH0A 2B87A 1KYOD 3TYYA 3PTZA 3PHLA 1RF1C 1KYOI 3OAKA 2JP3A 4TT3H 1J2JB 1J1DC 3K5BA 1GTWA 3VMAA 2OGUA 2A45H 2IZ0A 5AVWB 1YTZI 3I55P 3EQ2A 1KQLA 1Q7YQ 1ZR2A 1K8AQ 1YYCA 3SFDC 1JY3N 3TGUD 2J5UA 3L74E 3H1KD 5AVYB 1VQPP 4HJGH 3BATA 2FYUJ 5AW3B 5AVUB 4CPGA 2ZYAA 3RK2D 3JCUE 2E76B 3AE6C 1AA0A 3Q2YA 2YXQB 1DD3A 1KZUB 1PP9J 3H1LE 4XA4A 1SP4A 2H8PD 3H32A 4A7PA 4IFMA 2JKVA 1K04A 1NOHA 3Q3DA 3FXDA 2HFED 1GK4A 1N2DC 4RO0A 3CCEP 5AW1B 2WITA 1VQ5P 1X79B 2PAJA 3B4SA 3AEEC 1KYOE 1PIXA 3HUSA 3Q5RA 3SWKA 2WSFH 1EZVD 1L0LD 2R3SA 1EZVI 2M8RA 3L70J 3CMAP 1RQVA 1H8AA 1Y8AA 4TLFA 1T8ZA 3HE5B 4D6TJ 5KLIB 3VOPA 1NTZD 1NTKG 2KP8A 1WT6A 4IL6H 2WTYA 3TGUE 1P84H 1SQXK 2J58A 3CC7P 1N7SD 3H1KE 3MP7B 5CCGA 2IYPA 2FXPA 1HUCA 3L73E 1NU1G 2Z4EA 3H1HJ 2RKLA 1NAFA 4N6JA 3TNUB 2WZ7A 1IO4A 3HUSC 2E76C 3CCJP 2BCCE 2PP6A 2NPSA 3H1JD 1PV3A 2C0XA 2E74D 4OH8B 3AEBC 2ZAEB 1H0TB 3O8ZA 5B66E 2ZXXA 3GLMA 1BCCD 3OW2O 3I5CA 1GDTA 1S2EA 3Q1MA 2OQQA 1VQ6P 2W6AA 4JPZB 5B5EH 5CCGC 3M9BA 4OVNF 2FYUK 3TNUA 1MFTA 3OJAB 1SQXE 3S9OA 2QJKB 2N9BA 3D6YA 5BU5A 3OA7A 3R2PA 3KQGA 2AEMA 3CCVP 2KB7P 2NPSC 2Q5UA 3H6PA 5C39A 3L4FA 5KJ7A 1LJ2A 5TJHA 1NTZE 2D2CD 5KLIC 1JMBA 2R32A 3MUDA 2M3EA 5AW2B 2A45I 2IPPA 5CBOA 1N7LA 3QWOC 3AE2C 1JEKA 1CI6B 2Q6QA 3F89A 2CPBA 1KB9H 2JJLA 1J1EB 4DJGA 3H1JE 1BSHA 1QL1A 2IX7C 2FYUE 1W5CE 3L74G 1HJBA 1BCCE 1S3JA 3KPEA 1JY2O 5KJ7C 3MHVA 1DX7A 1N73A 2Y0EA 1FBMA 1PP9E 3ZDMA 3MUDC 4WY4B 1YJNP 4EIJA 3RL0D 1OVRA 4OGQB 3N7NA 3KXDA 1CI6A 3H1LG 3B5ND 3RBXA 2AEFA 3MZWB 2VRSA 2QJKC 1Y9BA 1PGOA 2QM8A 4GIFA 2H7HA 3FWNA 1VQLP 1Z56A 1Q81Q 3G4SP 5KLVD 1G1JA 1MUUA 1WMKA 1N73C 3BCCG 4WY4A 1A02J 1S5LX 3L72D 1EDIA 3EFFK 4GDOA 4PD4E 1IK9A 1P84D 3O6QB 5AW6B 3SWFA 1KFNA 1J1EC 4DZOA 1SQPJ 3RK3B 5CCHD 3CX5I 3H1HE 3JCUH 4BWNA 1FJPA 2O3JA 4WY4C 3GG2A 1CZQA 1AFOA 1Q2NA 2BCCG 3CWBG 2YO2A 4N78E 2K88A 1NO4A 1FOSE 3O6QA 1VQ9P 1URQD 3D6ZA 1SFCD 1EC5A 1L0NJ 4U3FD 2AEJA 3H1IG 1HJ0A 1JNMA 5AVTB 4LGDE 1AV1A 1NTKD 1SQXG 4DCKA 4IL6E 1MFZA 1P84E 1KMIZ 1NU1D 1EXJA 2WPQA 1LT9B 3V5BA 1NKNA 3R4YA 3RK3C 5KKZB 1GU4A 3T97B 1M1JA 1KB9D 3A0BE 1T2KC 4H0LB 2IFMA 2YO3A 1KB9I 2QA4P 3CCRP 1PL5A 4U7JA 3II6A 1OIPA 3EWKA 3A2AA 1PGPA 1QEXA 5B66H 1IFMA 2WWWA 2FYUG 3HE4B 2P7JA 4Y99B 1T3JA 2XZRA 1LNQA 1JTHB 3G9RA 1SQPK 4HYTB 3T97A 4ZMDA 3P7KA 2GUSA 3HD7B 2OYIA 1M1JC 1NTKE 1ZMEC 2ZVOB 1Q82Q 4AYCA 1QLED 3HRNA 1GD2E 4H13C 3U59A 5GTHE 5APXA 4W80A 4RJTA 3PP5A 4NPDA 3AEDC 2Y9YA 1YI2P 1JTHA 3AE3C 1SQVJ 1RE3A 1X9VA 3AEGC 4LC1A 3CCMP 1L0NK 1KILB 1QX8A 3L70G 1BGYJ 2H88C 5KKZC 1KB9E 1USDA 2L5GB 3WUTA 3CWBJ 3HD7A 3L74D 2KXPB 3L71G 3LIDA 4D6TG 3UIAA 1JB0J 4WWIA 2YMYA 1M1KQ 2OYIC 2IBZG 2B87B 3G6EP 2E5TA 1T6AA 1YQ4C 1GK6A 1CSBA 3HTKB 1GL2D 3M0AA 1QVFO 5KAFE 1VQ7P 3H1LD 3SWYA 4PV1D 4Y99C 1FOSF 3GHGC 1M90Q 3L37A 3A0HE 1KILA 1RH5B 5APTA 5AW9B 1RE3C 1VQNP 2CPSA 1ZP0C 2WT7B 1KQSO 4Z1MH 5APUA 1UIXA 5AW8B 2UWJE 1OW6A 3LW5J 3HD7C 2QRXA 1SLQA 1DD4A 5TISE 1E5WA 2JR8A 1L0NE 3BCCD 3HTKA 3WU2H 4RESB 4OWFA 4Y28J 1VQMP 5APQA 3FGAD 3H32B 2Y0DA 4PJ0E 2GA1A 2QJYC 3IF4A 2BEQD 4PD4H 2A06G 2M5AB 2M0BA 4C46A 1KILC 1XTGB 2WT7A 1VQ4P 4UB8E 1LTIC 4YXDC 2E42A 1N86A 2LXCB 3L73D 3HUSB 2IYOA 4I7ZC 2IDBA 1VF5D 2BCCD 1RQUA 2FYZA 1PPJG 3TDKA 4IFFA 4GKGA 2C9NY 4IFDK 4M3LA 2M5AA 1SQVK 2P1JA 2IFNA 3RK2C 3H1ID 5CBNA 3BCCE 1LT1A 1HVVA 2V7QJ 1SQXD 4HKZH 1OX3A 3GW6A 2NPSB 3CD6P 1FC2C 1YTZT 3USSA 3L71J 1N7SA 1ZRTD 2QIWA 3BRVB 1HBWA 4GOEA 3C8VA 4NPFX 3IR9A 2E76D 3B8EB 1LTBC 3VP8A 3M0DA 2QE7H 3AECC 3A5TA 1JY3O 2W83C 1M7LA 1SQVE 1LTGC 4K35A 3F5HA 1JUNA 2K9YA 3A0BH 3CWBE 3VMXA 4I6MC 1CW5A 4BRYB 2FYUD 2OTLP 3L75J 5CCGD 1N7SC 1BE3J 2R3CA 1SQPG 1HGZA 1LP1A 2AXCA 1WRGA 1PP9D 3H1IE 1HF9A 2QJPB 3M0DC 1RF0A 3CCQP 2E74C 2JWDA 2WSCJ 2XNXA 4BRYA 5APVA 3D70A 1USEA 1ZRTE 1T3UA 4LLHA 2HYNA 4L75A 3RL0B 5GTHH 3D71A 1AVOA 1N73B 1L0NG 1DEEG 2O01H 3KDPB 3PJSK 1U7MA 3L70D 2FKWB 3M06A 3CCLP 2HODB 3MGNA 4D6TD 4PD4D 2WPSA 2JDIH 4PD4I 2IBZD 3E1RA 1RF0C 4UB6E 3AE7C 2IBZI 2JO1A 2W6JH 2D2CC 3V2NA 3VN0A 5BVZA 3CC2P 3H1HD 1SQQG 2FYNB 1SQBJ 2ZT9B 1QVGO 2HR3A 1LTSC 2FBWC 3W68A 5BU8B 5KAFH 2N1TB 1W2BO 2HODA 1L4AB 2ZXEB 4NPEA 2QJPC 3A0HH 4N78D 1FE6A 2GUVA 4WVZA 4WB4A 3CL3D 1EDJA 4GT1A 3EFGA 3VMYA 4R4LA 5TISH 4AQRD 5AW4B 2QVAA 3WU2E 5AVSB 3V2RA 1NH4A 1OW7A 3RL0C 2N1TA 3L70E 2K1AA 2WVRA 1X22A 3CI9A 5M1BA 3P8CE 1L4AA 4PJ0H 3L71E 2POHA 4D6TE 2E75B 1S5LE 1YHQP 2KLVA 2Q3EA 1ZXGA 2IBZE 1H88A 3ABVC 3NTNA 1P84I 4UB8H 1FZCA 1PFIA 4OGQD 1K9MQ 1AJYA 1JMMA 1UIIA 2HG5D 2BASA 2FYNC 5KLVK 1G1IA 2FFDB 3NFQA 2ZT9C 1KQGB 1SQVG 5AVZB 1LTTC 1OXZA 4GOFA 2N1TC 2QSIA 1BGYG 5GTIH 5CJ0A 1L4AC 2HPCB 1VL2A 2I1KA 5APSA 2KLUA 1LTJB 3GMAA 1JM0A 2AXTE 1NTMJ 1JOCA 3L36A 5CCHC 1OWAA 1DEBA 4IOIH 2LKMA 2KNCB 1IFJA 1JY3P 2C9LY 1AQ5A 4ZKUA 1BDCA 1KV4A 1FZCC 2B9BA 3MTUE 4DT0A 1S9KE 3KHUA 2PRRA 1VPCA 1FZFA 1M1JB 2FFDA 1SQBK 5H2FE 2A06E 1X0TA 1IJDB 2B89A 3KYQA 2R44A 3CCUP 2RH0A 4ASVA 4H13B 2HPCA 1JO5A 1LTJA 3QH9A 2DW3A 2E75C 2XDJA 4EDFA 2OARA 2WSSH 1SQQJ 2KNCA 2YXRB 2ZYDA 2Z5IA 1EZVG 1L0LG 1R5LA 1PPJE 1IFPA 3S1KA 2OYIB 2FFDC 5DJUB 2I1JA 2YIUC 2WPVB 1SQPD 2RN0A 2K3RA 1ZLLA 1OMIA 2KYVA 1LTJC 2XKMA 3LIEA 1DIPA 3GHGB 1FS0E 4H44D 3GF3A 1RHZB 1IFDA 2OTJP 4B86A 2FXMA 1BDDA 3BVHA 3CCSP 1KN7A 3CXHE 2Y9ZA 3LW5H 1OVUA 3FXEA 1S72P 1L0ND 4EOTA 3RK3E 4AUWA 3VTPC 4PV1B 1IFIA 1ZOYC 3GHGA 1YITP 4JQ0D 2ZJSE 1M56D 1NTMK 2QJYB 1LWUB 2K9JB 4H0LD 1KD1Q 1S4XA 5L8RJ 2KSEA 3P32A 5AVXB 3TGUJ 2H89C 5AVVB 3H1KJ 2GM4A 4UB6H 2KUBA 2QEXP 1SQPE 2ITAA 1GL2A 4I7ZB 1NKZB 1YQ3C 2A45G 3M9QA 2WMMA 3TSIA 4HB1A 1GMJA 3WUUA 3PLNA 2P67A 4BXLA 3VYIA 1LWUA 2K9JA 2NZ2A 1SQQK 3SFEC 3I56P 4N3YB 3CLQA 3AE9C 5KAIE 1RY3A 1NTME 3RK2B 1PZQA 2ZVNB 2OYHB 3L75G 3AE8C 1BE3G 3TF5A 3AEFC 1GL2C 5K5GB 2V7QH 1FZBA 1L0LJ 3BRTB 4KJMA 4PV1C 4W7ZA 1KILD 3Q5PA 3P8MC
chains in the Genus database with same CATH topology
1VF5D 2H88C 2QJPC 5KKZC 1KMIZ 2WSEJ 1EXJA 1VF5B 1WMKA 3RK3E 2G3AA 1S5LX 3AEEC 2MKVA 4PV1B 1JB0J 1PIXA 1ZOYC 1RQUA 3Q5RA 4GDOA 1MKMA 2D2CD 3R4YA 1HF9A 4R4LA 1YQ4C 4H13D 5KLIC 2D2CB 3T97B 4H13B 4H0LD 3GF7A 2YMKA 1U57A 5L8RJ 4H0LB 1FDOA 1KQFB 1TU3F 1RQVA 4YTPC 4OGQC 2E74C 1OW8A 2E75C 2H89C 1PL5A 4U7JA 1OW7A 4XFJA 2WSCJ 1IK7A 3EWKA 4PV1D 1Q90D 1KORA 3AE2C 3AEAC 2JP3A 5M1BA 4TT3H 3D70A 1ZRTE 4H44C 2E75D 4I7ZB 2V7QJ 1YQ3C 1S1CX 2E75B 1ZP0C 1R8EA 2FXPA 3D71A 4Z1MH 1UIXA 3ABVC 1GMJA 1OW6A 2WQYC 3LW5J 1DD4A 3IN6A 1NYHA 3AE4C 4H44B 1NGMB 3G9RA 3SFDC 2E76C 2YIUC 1K05A 2QIWA 2WPVB 2J5UA 1EXIA 4IL6X 2NZ2A 4RKUJ 3O6QA 4KT0J 3SFEC 1OMIA 1VF5C 1PV3A 1FDIA 2G8YA 3AE9C 3D6ZA 4OGQD 1AJYA 2E74D 4Y28J 3C8VA 3AE5C 3AEBC 1ZMEC 2WSFJ 3FGAD 4OGQB 2E74B 2E76D 2FYNC 3AE7C 2JO1A 2ZT9C 3H25A 1KQGB 2E76B 1DIPA 3B71A 3AECC 3GLMA 3RL0g 3AE6C 2O01J 2D2CC 1KILE 3Q2YA 2QJYC 2QSIA 4H44D 1DD3A 1KTMA 4H13C 4R4MA 3AE8C 2BEQD 3GF3A 1HJ0A 4H0LC 1VL2A 2QJKC 3AEFC 2BEZF 1Y9BA 3Q1MA 2ZT9D 2OQQA 3GMAA 2ZT9B 1K04A 2K9YA 3Q3DA 3AEDC 2FBWC 4YXDC 3AE1C 2P10A 4PV1C 3Q5SA 3IAOA 3S9OA 3AE3C 3AEGC 3Q5PA 4I7ZC 3D6YA 2IDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJP C;  2QJY C;  2QSI A;  5KKZ C;  2WSE J;  4H44 B;  1VF5 B;  2WSC J;  1Q90 D;  1S5L X;  2QJK C;  2YIU C;  2QIW A;  2WPV B;  4PV1 B;  4IL6 X;  1JB0 J;  4RKU J;  1ZRT E;  4KT0 J;  2ZT9 B;  2K9Y A;  4I7Z B;  4Y28 J;  5KLI C;  3C8V A;  2D2C B;  2WSF J;  2E75 B;  4OGQ B;  2E74 B;  2FYN C;  4H13 B;  5L8R J;  2E76 B;  4H0L B;  3LW5 J;  2O01 J; 
#chains in the Genus database with same CATH topology
 1D7M A;  1NWQ A;  2XND H;  2WSE J;  1NTZ J;  1LWU C;  4ZKP A;  3V4Q A;  5KTB A;  3U1A A;  1S5L H;  4C7N B;  3WMM 0;  3V2P A;  5E79 E;  2OYH A;  1SQQ E;  1XTC C;  5KLV G;  2YKP A;  1YIJ P;  1GW4 A;  1M57 D;  4YTP C;  1NVO A;  1SQV D;  3L72 G;  1JCD A;  1BGY D;  1Q90 D;  1Q86 Q;  3H1J J;  3CWB D;  2J59 M;  2OYO A;  1YBK A;  3KZI E;  5GTI E;  1N7S B;  2FXO A;  4EYY Q;  1BCC J;  2LR2 A;  3CC4 P;  4C7N A;  2AXT H;  5AW7 B;  1VQ8 P;  1SQB G;  2OYH C;  1VF5 C;  4ASW A;  4JF7 A;  3MD0 A;  3S4R A;  2I8D A;  2E74 B;  1PGJ A;  2YKQ A;  3B71 A;  1VQK P;  1KIL E;  5H2F H;  2K37 A;  2WSC H;  4KHX A;  1G2C B;  2XV5 A;  1A02 F;  2Q1K A;  1H89 A;  4U3F G;  1LP1 B;  3ITK A;  4O9B A;  1GZL A;  2G3A A;  3A7O A;  1FJK A;  1BGY E;  1MZ9 A;  1FZG A;  2W6B A;  4ZNC A;  1L0L K;  2D2C B;  1IFN A;  2Y0C A;  2YMK A;  3CX5 H;  4L73 A;  1G2C A;  2CK3 H;  4MN4 C;  1NTZ K;  1NJI Q;  1HTL C;  3CME P;  1JY2 N;  5CJ4 A;  4JYC A;  5APW A;  3HE5 A;  2NPS D;  5AVR B;  4W7Y A;  1ZN5 A;  5APY A;  2KZI A;  3IN6 A;  1FZE A;  1NYH A;  2HLO A;  1SS1 A;  2P58 A;  1VQO P;  1KFM A;  3CXH H;  1K05 A;  1FAV A;  4RKU J;  2G8Y A;  2QM7 A;  4HH2 A;  1FDM A;  1NTM G;  2WSF J;  5KLV J;  2O1J A;  1SVF A;  1EZV E;  1L0L E;  1KTM A;  3L72 J;  3B5N B;  3P8C D;  1KC8 Q;  2BEZ F;  1H0T A;  3L71 D;  2KZJ A;  4K3A A;  1BSN A;  3IFM A;  1YJW P;  5KJ7 D;  4YXW H;  1U7J A;  4WBA A;  2PFX A;  2JWA A;  3V2Q A;  1QL2 A;  2KI7 B;  1ZR4 A;  2Z5H A;  2E43 A;  3B5N A;  1IC2 A;  1FDO A;  2W90 A;  1EDK A;  1TU3 F;  1OW8 A;  4XFJ A;  3JSV C;  3L75 D;  5CHX A;  5KAI H;  1BE3 D;  2YKO A;  1AQT A;  1HWT C;  4JYB A;  1EQ7 A;  1FZC B;  4U3F J;  2QG4 A;  2Q7C A;  2L91 A;  3U1C A;  2N9Y B;  1S9K D;  1QGK B;  1NGM B;  1ZV8 A;  2V4H A;  1NTK J;  1EXI A;  1YJ9 P;  2A06 D;  2IZ1 A;  3B5N C;  1URQ B;  4C7R A;  1LGH B;  2MJZ A;  1SFC B;  4L76 A;  5CCH A;  1NU1 J;  3RL0 g;  3TK1 A;  2O01 J;  1PGQ A;  3G71 P;  3G3Z A;  2H43 A;  5E79 H;  2E5Y A;  2ZT9 D;  2N1T D;  2SPZ A;  4WY4 D;  2O1K A;  1PPJ D;  1L4A D;  2P10 A;  2W8Z A;  2YIU B;  4QMA A;  2PGD A;  3CX5 D;  4XE5 B;  3KZI H;  3TGU G;  1ZW0 A;  3FX0 A;  1URQ A;  3H1K G;  1SFC A;  3L75 E;  3SSU A;  1BE3 E;  1DH3 A;  1X8Y A;  2RMZ A;  1MKM A;  1N8R Q;  3C9I A;  1SQB D;  3L73 G;  3NMD A;  1AVY A;  3RBZ A;  3M9H A;  3W67 A;  1LTA C;  4OGQ C;  4DOJ A;  2JEE A;  2KS1 B;  1IK7 A;  1IZN B;  3CXH D;  1MV8 A;  2E75 D;  5EFW B;  1S1C X;  3CXH I;  3VP9 A;  1KYO H;  1Y47 A;  3NXS A;  1VDF A;  3V6I A;  2ZFC A;  1URQ C;  3RK3 D;  5KLV E;  4H44 B;  1FU1 A;  1SFC C;  4IL6 X;  3L72 E;  1T2K D;  4KT0 J;  1M8O B;  1FDI A;  1EDL A;  2KS1 A;  1OFC X;  2O01 N;  1OVV A;  3L74 J;  1OZH A;  1NTZ G;  3CX5 E;  1W2E A;  2KIK A;  3JC2 2;  1NTK K;  2M3B A;  2OTK E;  4I1L A;  3RGU A;  2W27 A;  4EI2 A;  5AW5 B;  3Q5S A;  2ZYG A;  3IAO A;  1SQB E;  2YNY A;  3H1L J;  1GU5 A;  1NU1 K;  2C0W A;  2KK7 A;  1HGV A;  2KSJ A;  2MKV A;  3H1J G;  1L2P A;  1RE4 A;  4H13 D;  3L35 A;  1NTM D;  1BCC G;  5B5E E;  1GW3 A;  1KQF B;  4U3F E;  1LT9 A;  3VMZ A;  3WUV A;  1GL2 B;  3BCC J;  2Q3I A;  2FY8 A;  1PP9 G;  1KOR A;  3AEA C;  2R5D A;  1NHL A;  2WPR A;  3M91 A;  3V4W A;  4H44 C;  5DJT B;  1R8E A;  1RF1 B;  2WQY C;  2XU6 A;  1JY2 P;  2WSE H;  1J1D B;  3AE4 C;  5AW0 B;  3HE4 A;  3N4X A;  1NU1 E;  5AVQ B;  1E79 H;  1RE4 C;  1SQQ D;  3L73 J;  3AE5 C;  1FZA A;  1NAY A;  2R5B A;  2Q9I A;  1LT9 C;  3H25 A;  2BCC J;  4R4M A;  3MIW A;  3CPW O;  4H0L C;  3BAS A;  1RF1 A;  3HD7 D;  4I2L C;  2P2U A;  1R5S A;  3AE1 C;  3PH0 A;  1K73 Q;  2KOG A;  4L74 A;  3H1H G;  5CMZ A;  2LXB A;  3H1I J;  4GOD A;  1VF5 B;  3PRJ A;  3E7K A;  1SQX J;  3FWL A;  1JCC A;  3C1L A;  3GF7 A;  4JBZ A;  4YPC A;  1U57 A;  3E1I A;  2B88 A;  2NRG A;  3A3Y B;  1HH0 A;  2B87 A;  1KYO D;  3TYY A;  3PTZ A;  3PHL A;  1RF1 C;  1KYO I;  3OAK A;  2JP3 A;  4TT3 H;  1J2J B;  1J1D C;  3K5B A;  1GTW A;  3VMA A;  2OGU A;  2A45 H;  2IZ0 A;  5AVW B;  1YTZ I;  3I55 P;  3EQ2 A;  1KQL A;  1Q7Y Q;  1ZR2 A;  1K8A Q;  1YYC A;  3SFD C;  1JY3 N;  3TGU D;  2J5U A;  3L74 E;  3H1K D;  5AVY B;  1VQP P;  4HJG H;  3BAT A;  2FYU J;  5AW3 B;  5AVU B;  4CPG A;  2ZYA A;  3RK2 D;  3JCU E;  2E76 B;  3AE6 C;  1AA0 A;  3Q2Y A;  2YXQ B;  1DD3 A;  1KZU B;  1PP9 J;  3H1L E;  4XA4 A;  1SP4 A;  2H8P D;  3H32 A;  4A7P A;  4IFM A;  2JKV A;  1K04 A;  1NOH A;  3Q3D A;  3FXD A;  2HFE D;  1GK4 A;  1N2D C;  4RO0 A;  3CCE P;  5AW1 B;  2WIT A;  1VQ5 P;  1X79 B;  2PAJ A;  3B4S A;  3AEE C;  1KYO E;  1PIX A;  3HUS A;  3Q5R A;  3SWK A;  2WSF H;  1EZV D;  1L0L D;  2R3S A;  1EZV I;  2M8R A;  3L70 J;  3CMA P;  1RQV A;  1H8A A;  1Y8A A;  4TLF A;  1T8Z A;  3HE5 B;  4D6T J;  5KLI B;  3VOP A;  1NTZ D;  1NTK G;  2KP8 A;  1WT6 A;  4IL6 H;  2WTY A;  3TGU E;  1P84 H;  1SQX K;  2J58 A;  3CC7 P;  1N7S D;  3H1K E;  3MP7 B;  5CCG A;  2IYP A;  2FXP A;  1HUC A;  3L73 E;  1NU1 G;  2Z4E A;  3H1H J;  2RKL A;  1NAF A;  4N6J A;  3TNU B;  2WZ7 A;  1IO4 A;  3HUS C;  2E76 C;  3CCJ P;  2BCC E;  2PP6 A;  2NPS A;  3H1J D;  1PV3 A;  2C0X A;  2E74 D;  4OH8 B;  3AEB C;  2ZAE B;  1H0T B;  3O8Z A;  5B66 E;  2ZXX A;  3GLM A;  1BCC D;  3OW2 O;  3I5C A;  1GDT A;  1S2E A;  3Q1M A;  2OQQ A;  1VQ6 P;  2W6A A;  4JPZ B;  5B5E H;  5CCG C;  3M9B A;  4OVN F;  2FYU K;  3TNU A;  1MFT A;  3OJA B;  1SQX E;  3S9O A;  2QJK B;  2N9B A;  3D6Y A;  5BU5 A;  3OA7 A;  3R2P A;  3KQG A;  2AEM A;  3CCV P;  2KB7 P;  2NPS C;  2Q5U A;  3H6P A;  5C39 A;  3L4F A;  5KJ7 A;  1LJ2 A;  5TJH A;  1NTZ E;  2D2C D;  5KLI C;  1JMB A;  2R32 A;  3MUD A;  2M3E A;  5AW2 B;  2A45 I;  2IPP A;  5CBO A;  1N7L A;  3QWO C;  3AE2 C;  1JEK A;  1CI6 B;  2Q6Q A;  3F89 A;  2CPB A;  1KB9 H;  2JJL A;  1J1E B;  4DJG A;  3H1J E;  1BSH A;  1QL1 A;  2IX7 C;  2FYU E;  1W5C E;  3L74 G;  1HJB A;  1BCC E;  1S3J A;  3KPE A;  1JY2 O;  5KJ7 C;  3MHV A;  1DX7 A;  1N73 A;  2Y0E A;  1FBM A;  1PP9 E;  3ZDM A;  3MUD C;  4WY4 B;  1YJN P;  4EIJ A;  3RL0 D;  1OVR A;  4OGQ B;  3N7N A;  3KXD A;  1CI6 A;  3H1L G;  3B5N D;  3RBX A;  2AEF A;  3MZW B;  2VRS A;  2QJK C;  1Y9B A;  1PGO A;  2QM8 A;  4GIF A;  2H7H A;  3FWN A;  1VQL P;  1Z56 A;  1Q81 Q;  3G4S P;  5KLV D;  1G1J A;  1MUU A;  1WMK A;  1N73 C;  3BCC G;  4WY4 A;  1A02 J;  1S5L X;  3L72 D;  1EDI A;  3EFF K;  4GDO A;  4PD4 E;  1IK9 A;  1P84 D;  3O6Q B;  5AW6 B;  3SWF A;  1KFN A;  1J1E C;  4DZO A;  1SQP J;  3RK3 B;  5CCH D;  3CX5 I;  3H1H E;  3JCU H;  4BWN A;  1FJP A;  2O3J A;  4WY4 C;  3GG2 A;  1CZQ A;  1AFO A;  1Q2N A;  2BCC G;  3CWB G;  2YO2 A;  4N78 E;  2K88 A;  1NO4 A;  1FOS E;  3O6Q A;  1VQ9 P;  1URQ D;  3D6Z A;  1SFC D;  1EC5 A;  1L0N J;  4U3F D;  2AEJ A;  3H1I G;  1HJ0 A;  1JNM A;  5AVT B;  4LGD E;  1AV1 A;  1NTK D;  1SQX G;  4DCK A;  4IL6 E;  1MFZ A;  1P84 E;  1KMI Z;  1NU1 D;  1EXJ A;  2WPQ A;  1LT9 B;  3V5B A;  1NKN A;  3R4Y A;  3RK3 C;  5KKZ B;  1GU4 A;  3T97 B;  1M1J A;  1KB9 D;  3A0B E;  1T2K C;  4H0L B;  2IFM A;  2YO3 A;  1KB9 I;  2QA4 P;  3CCR P;  1PL5 A;  4U7J A;  3II6 A;  1OIP A;  3EWK A;  3A2A A;  1PGP A;  1QEX A;  5B66 H;  1IFM A;  2WWW A;  2FYU G;  3HE4 B;  2P7J A;  4Y99 B;  1T3J A;  2XZR A;  1LNQ A;  1JTH B;  3G9R A;  1SQP K;  4HYT B;  3T97 A;  4ZMD A;  3P7K A;  2GUS A;  3HD7 B;  2OYI A;  1M1J C;  1NTK E;  1ZME C;  2ZVO B;  1Q82 Q;  4AYC A;  1QLE D;  3HRN A;  1GD2 E;  4H13 C;  3U59 A;  5GTH E;  5APX A;  4W80 A;  4RJT A;  3PP5 A;  4NPD A;  3AED C;  2Y9Y A;  1YI2 P;  1JTH A;  3AE3 C;  1SQV J;  1RE3 A;  1X9V A;  3AEG C;  4LC1 A;  3CCM P;  1L0N K;  1KIL B;  1QX8 A;  3L70 G;  1BGY J;  2H88 C;  5KKZ C;  1KB9 E;  1USD A;  2L5G B;  3WUT A;  3CWB J;  3HD7 A;  3L74 D;  2KXP B;  3L71 G;  3LID A;  4D6T G;  3UIA A;  1JB0 J;  4WWI A;  2YMY A;  1M1K Q;  2OYI C;  2IBZ G;  2B87 B;  3G6E P;  2E5T A;  1T6A A;  1YQ4 C;  1GK6 A;  1CSB A;  3HTK B;  1GL2 D;  3M0A A;  1QVF O;  5KAF E;  1VQ7 P;  3H1L D;  3SWY A;  4PV1 D;  4Y99 C;  1FOS F;  3GHG C;  1M90 Q;  3L37 A;  3A0H E;  1KIL A;  1RH5 B;  5APT A;  5AW9 B;  1RE3 C;  1VQN P;  2CPS A;  1ZP0 C;  2WT7 B;  1KQS O;  4Z1M H;  5APU A;  1UIX A;  5AW8 B;  2UWJ E;  1OW6 A;  3LW5 J;  3HD7 C;  2QRX A;  1SLQ A;  1DD4 A;  5TIS E;  1E5W A;  2JR8 A;  1L0N E;  3BCC D;  3HTK A;  3WU2 H;  4RES B;  4OWF A;  4Y28 J;  1VQM P;  5APQ A;  3FGA D;  3H32 B;  2Y0D A;  4PJ0 E;  2GA1 A;  2QJY C;  3IF4 A;  2BEQ D;  4PD4 H;  2A06 G;  2M5A B;  2M0B A;  4C46 A;  1KIL C;  1XTG B;  2WT7 A;  1VQ4 P;  4UB8 E;  1LTI C;  4YXD C;  2E42 A;  1N86 A;  2LXC B;  3L73 D;  3HUS B;  2IYO A;  4I7Z C;  2IDB A;  1VF5 D;  2BCC D;  1RQU A;  2FYZ A;  1PPJ G;  3TDK A;  4IFF A;  4GKG A;  2C9N Y;  4IFD K;  4M3L A;  2M5A A;  1SQV K;  2P1J A;  2IFN A;  3RK2 C;  3H1I D;  5CBN A;  3BCC E;  1LT1 A;  1HVV A;  2V7Q J;  1SQX D;  4HKZ H;  1OX3 A;  3GW6 A;  2NPS B;  3CD6 P;  1FC2 C;  1YTZ T;  3USS A;  3L71 J;  1N7S A;  1ZRT D;  2QIW A;  3BRV B;  1HBW A;  4GOE A;  3C8V A;  4NPF X;  3IR9 A;  2E76 D;  3B8E B;  1LTB C;  3VP8 A;  3M0D A;  2QE7 H;  3AEC C;  3A5T A;  1JY3 O;  2W83 C;  1M7L A;  1SQV E;  1LTG C;  4K35 A;  3F5H A;  1JUN A;  2K9Y A;  3A0B H;  3CWB E;  3VMX A;  4I6M C;  1CW5 A;  4BRY B;  2FYU D;  2OTL P;  3L75 J;  5CCG D;  1N7S C;  1BE3 J;  2R3C A;  1SQP G;  1HGZ A;  1LP1 A;  2AXC A;  1WRG A;  1PP9 D;  3H1I E;  1HF9 A;  2QJP B;  3M0D C;  1RF0 A;  3CCQ P;  2E74 C;  2JWD A;  2WSC J;  2XNX A;  4BRY A;  5APV A;  3D70 A;  1USE A;  1ZRT E;  1T3U A;  4LLH A;  2HYN A;  4L75 A;  3RL0 B;  5GTH H;  3D71 A;  1AVO A;  1N73 B;  1L0N G;  1DEE G;  2O01 H;  3KDP B;  3PJS K;  1U7M A;  3L70 D;  2FKW B;  3M06 A;  3CCL P;  2HOD B;  3MGN A;  4D6T D;  4PD4 D;  2WPS A;  2JDI H;  4PD4 I;  2IBZ D;  3E1R A;  1RF0 C;  4UB6 E;  3AE7 C;  2IBZ I;  2JO1 A;  2W6J H;  2D2C C;  3V2N A;  3VN0 A;  5BVZ A;  3CC2 P;  3H1H D;  1SQQ G;  2FYN B;  1SQB J;  2ZT9 B;  1QVG O;  2HR3 A;  1LTS C;  2FBW C;  3W68 A;  5BU8 B;  5KAF H;  2N1T B;  1W2B O;  2HOD A;  1L4A B;  2ZXE B;  4NPE A;  2QJP C;  3A0H H;  4N78 D;  1FE6 A;  2GUV A;  4WVZ A;  4WB4 A;  3CL3 D;  1EDJ A;  4GT1 A;  3EFG A;  3VMY A;  4R4L A;  5TIS H;  4AQR D;  5AW4 B;  2QVA A;  3WU2 E;  5AVS B;  3V2R A;  1NH4 A;  1OW7 A;  3RL0 C;  2N1T A;  3L70 E;  2K1A A;  2WVR A;  1X22 A;  3CI9 A;  5M1B A;  3P8C E;  1L4A A;  4PJ0 H;  3L71 E;  2POH A;  4D6T E;  2E75 B;  1S5L E;  1YHQ P;  2KLV A;  2Q3E A;  1ZXG A;  2IBZ E;  1H88 A;  3ABV C;  3NTN A;  1P84 I;  4UB8 H;  1FZC A;  1PFI A;  4OGQ D;  1K9M Q;  1AJY A;  1JMM A;  1UII A;  2HG5 D;  2BAS A;  2FYN C;  5KLV K;  1G1I A;  2FFD B;  3NFQ A;  2ZT9 C;  1KQG B;  1SQV G;  5AVZ B;  1LTT C;  1OXZ A;  4GOF A;  2N1T C;  2QSI A;  1BGY G;  5GTI H;  5CJ0 A;  1L4A C;  2HPC B;  1VL2 A;  2I1K A;  5APS A;  2KLU A;  1LTJ B;  3GMA A;  1JM0 A;  2AXT E;  1NTM J;  1JOC A;  3L36 A;  5CCH C;  1OWA A;  1DEB A;  4IOI H;  2LKM A;  2KNC B;  1IFJ A;  1JY3 P;  2C9L Y;  1AQ5 A;  4ZKU A;  1BDC A;  1KV4 A;  1FZC C;  2B9B A;  3MTU E;  4DT0 A;  1S9K E;  3KHU A;  2PRR A;  1VPC A;  1FZF A;  1M1J B;  2FFD A;  1SQB K;  5H2F E;  2A06 E;  1X0T A;  1IJD B;  2B89 A;  3KYQ A;  2R44 A;  3CCU P;  2RH0 A;  4ASV A;  4H13 B;  2HPC A;  1JO5 A;  1LTJ A;  3QH9 A;  2DW3 A;  2E75 C;  2XDJ A;  4EDF A;  2OAR A;  2WSS H;  1SQQ J;  2KNC A;  2YXR B;  2ZYD A;  2Z5I A;  1EZV G;  1L0L G;  1R5L A;  1PPJ E;  1IFP A;  3S1K A;  2OYI B;  2FFD C;  5DJU B;  2I1J A;  2YIU C;  2WPV B;  1SQP D;  2RN0 A;  2K3R A;  1ZLL A;  1OMI A;  2KYV A;  1LTJ C;  2XKM A;  3LIE A;  1DIP A;  3GHG B;  1FS0 E;  4H44 D;  3GF3 A;  1RHZ B;  1IFD A;  2OTJ P;  4B86 A;  2FXM A;  1BDD A;  3BVH A;  3CCS P;  1KN7 A;  3CXH E;  2Y9Z A;  3LW5 H;  1OVU A;  3FXE A;  1S72 P;  1L0N D;  4EOT A;  3RK3 E;  4AUW A;  3VTP C;  4PV1 B;  1IFI A;  1ZOY C;  3GHG A;  1YIT P;  4JQ0 D;  2ZJS E;  1M56 D;  1NTM K;  2QJY B;  1LWU B;  2K9J B;  4H0L D;  1KD1 Q;  1S4X A;  5L8R J;  2KSE A;  3P32 A;  5AVX B;  3TGU J;  2H89 C;  5AVV B;  3H1K J;  2GM4 A;  4UB6 H;  2KUB A;  2QEX P;  1SQP E;  2ITA A;  1GL2 A;  4I7Z B;  1NKZ B;  1YQ3 C;  2A45 G;  3M9Q A;  2WMM A;  3TSI A;  4HB1 A;  1GMJ A;  3WUU A;  3PLN A;  2P67 A;  4BXL A;  3VYI A;  1LWU A;  2K9J A;  2NZ2 A;  1SQQ K;  3SFE C;  3I56 P;  4N3Y B;  3CLQ A;  3AE9 C;  5KAI E;  1RY3 A;  1NTM E;  3RK2 B;  1PZQ A;  2ZVN B;  2OYH B;  3L75 G;  3AE8 C;  1BE3 G;  3TF5 A;  3AEF C;  1GL2 C;  5K5G B;  2V7Q H;  1FZB A;  1L0L J;  3BRT B;  4KJM A;  4PV1 C;  4W7Z A;  1KIL D;  3Q5P A;  3P8M C; 
#chains in the Genus database with same CATH homology
 1VF5 D;  2H88 C;  2QJP C;  5KKZ C;  1KMI Z;  2WSE J;  1EXJ A;  1VF5 B;  1WMK A;  3RK3 E;  2G3A A;  1S5L X;  3AEE C;  2MKV A;  4PV1 B;  1JB0 J;  1PIX A;  1ZOY C;  1RQU A;  3Q5R A;  4GDO A;  1MKM A;  2D2C D;  3R4Y A;  1HF9 A;  4R4L A;  1YQ4 C;  4H13 D;  5KLI C;  2D2C B;  3T97 B;  4H13 B;  4H0L D;  3GF7 A;  2YMK A;  1U57 A;  5L8R J;  4H0L B;  1FDO A;  1KQF B;  1TU3 F;  1RQV A;  4YTP C;  4OGQ C;  2E74 C;  1OW8 A;  2E75 C;  2H89 C;  1PL5 A;  4U7J A;  1OW7 A;  4XFJ A;  2WSC J;  1IK7 A;  3EWK A;  4PV1 D;  1Q90 D;  1KOR A;  3AE2 C;  3AEA C;  2JP3 A;  5M1B A;  4TT3 H;  3D70 A;  1ZRT E;  4H44 C;  2E75 D;  4I7Z B;  2V7Q J;  1YQ3 C;  1S1C X;  2E75 B;  1ZP0 C;  1R8E A;  2FXP A;  3D71 A;  4Z1M H;  1UIX A;  3ABV C;  1GMJ A;  1OW6 A;  2WQY C;  3LW5 J;  1DD4 A;  3IN6 A;  1NYH A;  3AE4 C;  4H44 B;  1NGM B;  3G9R A;  3SFD C;  2E76 C;  2YIU C;  1K05 A;  2QIW A;  2WPV B;  2J5U A;  1EXI A;  4IL6 X;  2NZ2 A;  4RKU J;  3O6Q A;  4KT0 J;  3SFE C;  1OMI A;  1VF5 C;  1PV3 A;  1FDI A;  2G8Y A;  3AE9 C;  3D6Z A;  4OGQ D;  1AJY A;  2E74 D;  4Y28 J;  3C8V A;  3AE5 C;  3AEB C;  1ZME C;  2WSF J;  3FGA D;  4OGQ B;  2E74 B;  2E76 D;  2FYN C;  3AE7 C;  2JO1 A;  2ZT9 C;  3H25 A;  1KQG B;  2E76 B;  1DIP A;  3B71 A;  3AEC C;  3GLM A;  3RL0 g;  3AE6 C;  2O01 J;  2D2C C;  1KIL E;  3Q2Y A;  2QJY C;  2QSI A;  4H44 D;  1DD3 A;  1KTM A;  4H13 C;  4R4M A;  3AE8 C;  2BEQ D;  3GF3 A;  1HJ0 A;  4H0L C;  1VL2 A;  2QJK C;  3AEF C;  2BEZ F;  1Y9B A;  3Q1M A;  2ZT9 D;  2OQQ A;  3GMA A;  2ZT9 B;  1K04 A;  2K9Y A;  3Q3D A;  3AED C;  2FBW C;  4YXD C;  3AE1 C;  2P10 A;  4PV1 C;  3Q5S A;  3IAO A;  3S9O A;  3AE3 C;  3AEG C;  3Q5P A;  4I7Z C;  3D6Y A;  2IDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...