2O01J

The structure of a plant photosystem i supercomplex at 3.4 angstrom resolution
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
42
structure length
42
Chain Sequence
b'MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
molecule tags Photosynthesis
publication title The structure of a plant photosystem I supercomplex at 3.4 A resolution.
pubmed doi rcsb
total genus 6
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2o01J01
2E74B 2ZT9B 2WSCJ 3LW5J 2WSEJ 4RKUJ 2E75B 2D2CB 2QJKC 5KKZC 2E76B 1VF5B 4H44B 2YIUC 2QJPC 2WPVB 1ZRTE 2O01J 4IL6X 4Y28J 2QSIA 5KLIC 2QIWA 3C8VA 4I7ZB 4KT0J 1Q90D 1JB0J 1S5LX 5L8RJ 2K9YA 4PV1B 4OGQB 2WSFJ 2FYNC 4H13B 2QJYC 4H0LB
chains in the Genus database with same CATH superfamily
1GK6A 5AVWB 4BRYA 3R4YA 1NWQA 3GHGA 1GL2B 1FJKA 1L4AC 1RE4C 2ZXEB 1VF5B 1OW7A 4YXWH 1JMBA 1KMIZ 4U3FG 1OX3A 1L0LD 1LTIC 1EDLA 1YYCA 2BCCD 2FBWC 3L74J 3CWBJ 1N8RQ 2BEZF 3KZIH 1M90Q 2QM8A 1LTGC 1LTTC 4K35A 1BGYD 5DJUB 3B8EB 2OYOA 3L72D 1KFNA 2HODB 5KLIC 1VQ9P 1ZP0C 1ZW0A 3BVHA 1QVFO 1PGQA 4YXDC 3PJSK 1XTCC 1OZHA 5AVSB 1JMMA 1JOCA 1JY2N 1RQUA 2BCCE 3Q5PA 1L0LE 1QL2A 2IDBA 1PPJD 2KNCB 4PV1D 4TLFA 5DJTB 3RGUA 4ZNCA 3TSIA 3CPWO 2A06G 2LR2A 1RE4A 1SQBG 2O01H 1MZ9A 3V2RA 2KS1A 2BEQD 2ZT9D 2KOGA 5KJ7D 3RBXA 3U1CA 1LTBC 2K88A 1VPCA 3H1KG 1BE3G 1DX7A 1PGPA 1NTKD 1SQVD 2KK7A 2OYHC 1G1JA 2A06E 3BATA 2B88A 3FWLA 1CZQA 3PTZA 1ZR2A 3H1IJ 2QJPC 3MTUE 4JBZA 5KKZB 3GG2A 5TISH 3GF3A 3RK3D 2Q7CA 1HJ0A 1ZN5A 1SQQD 3L70E 3CCMP 1VQMP 2XNXA 2XKMA 1A02J 3HE5A 1LWUC 3L70D 3TK1A 1N86A 1FJPA 2KSJA 3H1KJ 3HUSA 2AEJA 2Z5IA 3P32A 3F5HA 1KZUB 3A0BE 4L73A 1Q90D 3SFDC 2KIKA 4OWFA 3VOPA 1BSHA 1SQXK 5APVA 3CMEP 3RL0D 1GMJA 2XNDH 2YNYA 1MUUA 1AVYA 1P84E 1SFCD 4IFMA 4DJGA 2P2UA 2PFXA 4HKZH 4HYTB 1S3JA 3VN0A 3A5TA 2HODA 1R5LA 5KLVJ 1S2EA 3S4RA 1VL2A 4R4LA 1VQPP 3LW5J 3H25A 1H89A 2QG4A 4JYCA 1T8ZA 4LLHA 3RK2D 2N1TD 1VQ5P 2KNCA 1LWUB 1X9VA 1W2EA 4B86A 1NU1E 4I7ZC 2K3RA 2FXOA 2E5TA 2H88C 1U7MA 1CI6B 3AE5C 1M1JC 3E1IA 3HTKA 3HD7D 3C1LA 3HD7A 3M9QA 2NPSC 1EZVI 1N73C 2POHA 3AEBC 1MKMA 1CW5A 3EFFK 3L73J 2WPRA 4EDFA 1YHQP 5CCHA 3O6QB 4H13D 5APUA 1HGVA 4BWNA 1LT9B 2CPSA 4WY4C 5AW9B 4AQRD 5BU8B 4OGQB 2YXRB 2JR8A 2HG5D 2ZAEB 3WUVA 2WT7B 1S9KD 5CJ4A 5H2FH 1H8AA 2XV5A 3GW6A 3H1HD 4HH2A 4YPCA 1X0TA 2CPBA 1OVUA 2P1JA 2KZIA 5CBNA 4GOEA 3WUUA 1HF9A 1NU1J 3ZDMA 4L76A 1GZLA 3NTNA 3V2NA 3VYIA 5APQA 1FZGA 2WSEH 1VQ8P 2WSEJ 3L70G 2E75B 1SQPK 5KKZC 1KFMA 1KB9D 1RQVA 2L91A 2FFDB 1M1JB 2E76D 1LP1B 1NTME 2Q3EA 1AVOA 5CMZA 3MUDA 5CCGA 5AVZB 3OW2O 4W80A 1KILC 1NTZD 1G2CA 2E75C 3E7KA 1HWTC 3VP9A 1JO5A 3L36A 3CC4P 4JPZB 1E5WA 1R8EA 3H1HG 3H1KD 1URQA 5C39A 2YKPA 4U3FJ 5CCHD 1PP9J 2QA4P 3H1ID 1KD1Q 3L72E 3RL0g 5KJ7A 1MV8A 1Y9BA 1PPJG 3BCCD 2GM4A 2I1JA 1S72P 1JY3P 1VQ6P 2JP3A 3V4WA 1N73B 1URQD 3EFGA 4I1LA 3H6PA 2OARA 2YMYA 3TNUB 1L0NE 3MP7B 1JM0A 2WT7A 2QM7A 1NKZB 2QJPB 1VQ4P 3D6YA 4Y28J 3S9OA 4UB6E 1RF0C 4UB8E 3KYQA 3H1JD 4GIFA 2IX7C 2Y0DA 3B5NC 2YKQA 1KQSO 2FYNB 3SWFA 1OMIA 2OTKE 2VRSA 3G4SP 2R3CA 1J1DC 1SQBK 2WSSH 2YO3A 2NPSA 3BCCG 4C7NA 1J2JB 1QGKB 1W5CE 1KORA 4Y99B 4W7ZA 5GTHH 2UWJE 1L0LJ 2PRRA 1JTHA 3AE3C 3PLNA 3L75J 1NTMG 2A45G 4JF7A 4WBAA 4TT3H 2FXMA 3TGUG 2FYUJ 1JY2P 1FZCB 4L75A 1SP4A 2YXQB 2QJKC 3TYYA 1NTMK 1KILD 3GLMA 1SQVJ 3H32B 1QX8A 2YO2A 3BRTB 1JY2O 3R2PA 4H44D 3RK2B 4BXLA 1Q7YQ 1H0TB 3AE8C 2IFMA 1BE3E 1U7JA 2B87B 3H1KE 1EDIA 4EIJA 1KQFB 1L4AA 3L71E 3A0HH 4IL6X 1NTMJ 2E76C 1ZR4A 4ZMDA 1SQXG 1IFJA 1M8OB 1BE3D 1YTZT 2W6BA 3V4QA 2Y9YA 3TGUD 1KYOH 1GL2A 1FZBA 1GTWA 5AVYB 5CBOA 1IK7A 1EXIA 1KILE 1NTKK 3TNUA 2E74C 1JY3O 1SQXE 1FZAA 2OYIA 1NTMD 1U57A 4K3AA 5B66H 1R5SA 2O3JA 3CX5I 3CCEP 3L37A 3CCLP 1M56D 2R5BA 3Q3DA 1ZMEC 3RBZA 1X22A 2QJYC 2SPZA 2ITAA 3AEGC 4U3FE 1USDA 3Q1MA 4IL6E 1VQOP 1BDCA 3Q5SA 2GUVA 1G2CB 2KZJA 2FYUD 3CWBE 4HJGH 2JDIH 4RJTA 1L0NK 1N7SC 1VDFA 3HUSC 1T3JA 3WUTA 1PP9D 1YQ3C 1NU1K 1SVFA 4GT1A 1EC5A 3M06A 4OVNF 4U3FD 4Z1MH 2O1KA 1N7SD 2BCCG 3AECC 3EWKA 3A2AA 2N1TC 2QIWA 3PP5A 2R5DA 4WY4A 2OYIC 3BCCE 1NU1G 1L0ND 1K04A 3C8VA 1S5LH 4Y99C 2GA1A 1Y8AA 1OWAA 1SQBE 3GF7A 1L2PA 3IR9A 2R32A 1UIIA 5AW8B 2KB7P 1J1EC 1NYHA 2J59M 3TGUE 1VQKP 2XDJA 5AW7B 3SWKA 2Y9ZA 1KB9H 1YBKA 3M91A 5CJ0A 1FZEA 1M7LA 1SQPG 2E74D 3VMYA 3AEDC 1RE3A 1HVVA 2J58A 1TU3F 2WSCJ 3FX0A 1DEEG 2M5AB 1ZXGA 3E1RA 5E79E 1LP1A 2D2CB 2M3EA 2J5UA 1JCDA 3AE4C 1SQPE 3H1HJ 3II6A 2CK3H 4GOFA 2RH0A 4UB8H 3S1KA 5KLIB 2H8PD 1Q81Q 4PD4D 1JCCA 3BRVB 2RKLA 1FE6A 3MIWA 3TDKA 1K8AQ 4I6MC 1GW4A 4H44C 2N9BA 5AVQB 3CL3D 2FFDC 2KYVA 3FGAD 1FOSF 3M0DC 3CMAP 3A3YB 3AE1C 3L75E 1N7LA 2P7JA 3P8CE 5KJ7C 1NGMB 2B89A 3O6QA 2XU6A 1K9MQ 1FBMA 2WSFJ 2ZYGA 3I5CA 4WB4A 5KLVE 2FYNC 5BU5A 2HFED 2HYNA 3OA7A 1D7MA 4PV1C 1M57D 3JC22 1NJIQ 1S4XA 2PGDA 2ZFCA 2Z5HA 1EZVD 3H1LD 1LT9C 4M3LA 1JUNA 3CCRP 2WSCH 3B5ND 5EFWB 5APXA 3RK3B 5KTBA 2Z4EA 4YTPC 1Q82Q 2LKMA 2E43A 3NFQA 4MN4C 1NU1D 1RF0A 2C0XA 2N1TB 2QEXP 1HJBA 2FFDA 2C9LY 1OFCX 1W2BO 1KQLA 2B87A 2R3SA 1GU4A 1QLED 3B71A 3L4FA 2I1KA 1X8YA 1GDTA 3IFMA 1URQC 1NKNA 2YIUB 2Q5UA 2KS1B 3HD7B 3MD0A 3H1IE 4I2LC 5B5EE 1YI2P 1PFIA 5TISE 1RF1C 1RHZB 1J1EB 1M1JA 3M9HA 5KAFH 3CI9A 1OVRA 3CCQP 1UIXA 2AXTH 3H1IG 2OTLP 5B5EH 1NHLA 1KTMA 3V2QA 5CCHC 1FS0E 1WT6A 1LJ2A 2IYOA 2IYPA 3OJAB 4N6JA 1P84D 5KAFE 1DIPA 1NTKJ 3Q5RA 1CI6A 2JO1A 1BDDA 1P84H 1NAYA 2JKVA 3OAKA 2E75D 4PD4I 3W67A 4DCKA 5KLVD 3L71J 3PHLA 1LTAC 2LXCB 3P8CD 1ZRTE 1GL2D 2WVRA 2Q3IA 1PGJA 1BSNA 1P84I 1SQVE 3CX5E 3H1HE 3HUSB 1Z56A 3JCUE 4IOIH 1N7SB 1NTKG 2QJKB 1ZOYC 1ZRTD 2A45H 2PP6A 5AW0B 1BE3J 3FWNA 3TGUJ 3V5BA 2L5GB 2NZ2A 5KLVG 1JB0J 2QE7H 1T6AA 1RF1B 3L71G 1NH4A 2HR3A 3CD6P 4PD4E 1PL5A 3UIAA 1KC8Q 1NTKE 3AE9C 2WTYA 1FDMA 1PPJE 5AW5B 4H0LC 2RN0A 3WU2E 2K37A 1S5LE 1G1IA 3P8MC 1VQNP 1LTJA 2FYZA 1IFPA 4XFJA 1ZV8A 2P67A 3PRJA 1MFZA 1SS1A 4WY4D 5AW6B 5AVVB 2MKVA 4H13C 1HTLC 1L0NG 2E74B 2W6AA 5K5GB 1M1KQ 2H89C 3EQ2A 3K5BA 1BCCJ 3VTPC 1A02F 5H2FE 1GK4A 3TF5A 3L73G 5CCGC 4WVZA 1BGYG 2NPSD 1KYOI 2C9NY 3G9RA 2YIUC 1PZQA 3HD7C 1LT9A 4RO0A 2WPSA 2PAJA 3JSVC 4IL6H 1IC2A 2IBZG 1RY3A 2O01J 2K1AA 1BGYE 4XE5B 2BASA 3B4SA 4LGDE 3RK2C 3MHVA 2IFNA 2KI7B 3USSA 3Q2YA 1FZCA 1IFDA 4D6TE 1EZVG 2N9YB 5GTHE 5L8RJ 2K9YA 1LWUA 3KHUA 4PV1B 2B9BA 2P10A 1QL1A 1FDIA 2KP8A 3HE5B 4DZOA 2E42A 1SFCC 3CC7P 3A0BH 2FYUE 3HE4B 3CWBD 5APSA 2WMMA 2BCCJ 3FXEA 3L74D 2ZT9B 3PH0A 2W6JH 3SSUA 3VMZA 1IFMA 1NO4A 1PV3A 2WZ7A 3RL0C 1AA0A 1H88A 3GHGB 4AYCA 3L35A 3GMAA 1FU1A 4GKGA 4EOTA 1X79B 1BCCD 5AVXB 3L75D 3T97B 5BVZA 3KDPB 3H32A 3AEAC 1OIPA 3CXHD 2N1TA 1KILA 3ITKA 2OQQA 4N78E 3G71P 3LIEA 4D6TJ 1LTSC 4KJMA 1CSBA 3B5NA 3CXHH 4KHXA 3RK3C 2E5YA 4GODA 1FC2C 2P58A 5TJHA 3VMXA 1N7SA 2D2CC 1NTZJ 4I7ZB 4JYBA 4KT0J 1HGZA 1SQPD 1GW3A 1EQ7A 3D71A 1S5LX 3A0HE 4L74A 2ZT9C 3M0AA 3QH9A 2JWDA 4RESB 3H1JJ 2R44A 1RE3C 2KLUA 3IN6A 1AFOA 1FDOA 2ZVNB 2O1JA 3CWBG 4H13B 4AUWA 1H0TA 4WY4B 4ASWA 3FXDA 2AXTE 3F89A 4ZKPA 2KXPB 1T2KD 1NAFA 2O01N 2K9JA 3NXSA 3KZIE 4LC1A 3U59A 1LTJC 2IBZE 2M0BA 4BRYB 1RH5B 2OYIB 1T3UA 5APWA 5CHXA 4ASVA 1PP9G 2WPVB 1JY3N 3H1JG 2ZYAA 1KYOE 3HRNA 3B5NB 3BCCJ 3I55P 4C7NB 1EZVE 2LXBA 3H1LE 2OYHA 1YITP 1HUCA 3CCVP 1DH3A 1WMKA 2V7QJ 3IF4A 3L73D 1SQBJ 1PIXA 3V6IA 1L0LG 1JTHB 1PP9E 3ABVC 1L4AD 1XTGB 3AEFC 3H1JE 4DOJA 1FOSE 2AEFA 2M5AA 4N3YB 4C46A 3H1LG 2FYUG 1YIJP 4PJ0H 1T2KC 1NVOA 4EI2A 1DD4A 1L0LK 2JWAA 2YMKA 2G3AA 4WWIA 2QJYB 3RL0B 3WU2H 2Q6QA 4OGQD 1YJNP 2H43A 1VQ7P 1YJWP 2FYUK 2M3BA 2M8RA 2AEMA 2W27A 2WWWA 4H0LB 2QRXA 1SQXJ 2NRGA 3H1LJ 1SFCA 3BASA 1SQXD 3L71D 1IFIA 3N4XA 3CLQA 3MUDC 4GDOA 1USEA 4RKUJ 2HPCB 2D2CD 2E76B 3KPEA 2YKOA 4NPFX 2IZ0A 1N73A 3AE6C 4CPGA 5KAIE 2WSFH 5E79H 3CCUP 5KLVK 3L75G 5AVRB 4IFDK 1SQVK 1LGHB 4EYYQ 3NMDA 1IFNA 1IZNB 1GU5A 2V4HA 1HH0A 1AJYA 1KN7A 2FY8A 5KAIH 5AW2B 1EDKA 1BCCG 3U1AA 1SQVG 2GUSA 1SQBD 3KXDA 3IAOA 4OH8B 5AW1B 1JNMA 1AV1A 1E79H 1KQGB 4UB6H 1FAVA 3M9BA 4QMAA 1LTJB 2IZ1A 3D6ZA 2Q9IA 3M0DA 2OTJP 3GHGC 1PGOA 1OW8A 2KSEA 1EXJA 2FKWB 1J1DB 2WITA 1NOHA 4DT0A 4ZKUA 3HTKB 3G6EP 1SFCB 1WRGA 3AEEC 4U7JA 5GTIE 1YJ9P 3LW5H 2RMZA 4HB1A 3L72G 3D70A 1HBWA 3VMAA 1S9KE 5AW3B 3AE7C 1KYOD 1VF5D 5M1BA 3WMM0 2C0WA 4O9BA 1QVGO 4R4MA 1Y47A 1YQ4C 1JEKA 2W8ZA 5GTIH 1IK9A 1N2DC 2IPPA 2IBZD 2NPSB 3O8ZA 3V2PA 3I56P 1Q86Q 1VF5C 1LNQA 2QSIA 1L0NJ 2QVAA 1DD3A 1L4AB 2W90A 3N7NA 1SQPJ 2AXCA 3LIDA 5CCGD 1IO4A 2ZXXA 2HPCA 1AQTA 2G8YA 3L72J 1AQ5A 1BGYJ 3MZWB 2H7HA 4C7RA 3L70J 2W83C 2WPQA 2JJLA 5APYA 4A7PA 3MGNA 3KQGA 3SWYA 5APTA 1VQLP 2KLVA 4D6TG 1K73Q 1NTZK 2V7QH 4H0LD 5AVTB 1SQQJ 2ZVOB 1OW6A 2MJZA 2XZRA 2ZYDA 3P7KA 2DW3A 4XA4A 3CCSP 3T97A 1OVVA 2K9JB 1NTZG 4NPDA 3W68A 2IBZI 3CC2P 1KILB 3JCUH 1IJDB 4JQ0D 1FZFA 4H44B 2FXPA 1EDJA 1KB9I 1SQQK 2WQYC 1URQB 4N78D 3VP8A 1MFTA 4W7YA 3SFEC 1S1CX 1RF1A 1GL2C 1NTZE 3HE4A 3AE2C 1SLQA 4PJ0E 2OYHB 1BCCE 1SQQG 1GD2E 4NPEA 1K05A 2Q1KA 5B66E 1KV4A 3QWOC 1OXZA 2JEEA 1DEBA 2OGUA 3CX5D 3CXHE 3L74E 2A45I 1QEXA 3CXHI 1KB9E 1SQQE 1ZLLA 2HLOA 2Y0EA 2Y0CA 3CX5H 3RK3E 4IFFA 5AW4B 2ZJSE 1Q2NA 3C9IA 3CCJP 1FZCC 5AVUB 2I8DA 3A7OA 1YTZI 1LT1A 2A06D 3L74G 3L73E 2KUBA 4OGQC 4D6TD 4PD4H 3G3ZA
chains in the Genus database with same CATH topology
1Y9BA 3R4YA 4YTPC 2JP3A 1VF5B 1OW7A 1KMIZ 2WPVB 2FBWC 2BEZF 3B71A 1WMKA 2V7QJ 3D6YA 4Y28J 3S9OA 1PIXA 5KLIC 3ABVC 1ZP0C 3AEFC 4YXDC 1OMIA 1DD4A 2YMKA 1RQUA 2G3AA 3Q5PA 1UIXA 2IDBA 4OGQD 4PV1D 1KORA 4H0LB 3AE3C 2ZT9D 2BEQD 1DIPA 3Q5RA 4TT3H 2JO1A 4GDOA 4RKUJ 2QJKC 2E75D 3GLMA 2D2CD 2E76B 4H44D 2QJPC 3AE6C 3AE8C 3GF3A 1ZRTE 1HJ0A 1KQFB 4IL6X 2E76C 1ZOYC 3SFDC 2NZ2A 1EXIA 1AJYA 1Q90D 1IK7A 1JB0J 1KILE 2E74C 3IAOA 1PL5A 1KQGB 3AE9C 1GMJA 4H0LC 1U57A 3D6ZA 3Q3DA 1OW8A 1ZMEC 4XFJA 1EXJA 2QJYC 3AEGC 2MKVA 4H13C 2E74B 3Q1MA 1VL2A 4R4LA 2H89C 4U7JA 3AEEC 3LW5J 3H25A 3Q5SA 3D70A 3AE7C 3G9RA 1VF5D 2YIUC 5M1BA 4R4MA 4I7ZC 1YQ4C 1YQ3C 4Z1MH 2H88C 2O01J 3AE5C 1VF5C 2QSIA 3AECC 3EWKA 2QIWA 1DD3A 3Q2YA 3AEBC 1MKMA 1K04A 3C8VA 2G8YA 5L8RJ 3GF7A 4H13D 2K9YA 4PV1B 2P10A 4OGQB 1FDIA 1NYHA 4H0LD 2ZT9B 1KTMA 1HF9A 1PV3A 1OW6A 2E74D 3AEDC 3GMAA 2WSCJ 1TU3F 2WSEJ 2E75B 3T97B 2D2CB 5KKZC 1RQVA 4H44B 2FXPA 2J5UA 3AE4C 2E76D 2WQYC 3AEAC 2OQQA 3SFEC 1S1CX 3AE2C 4H44C 1K05A 2D2CC 2E75C 4I7ZB 3FGAD 4KT0J 3D71A 1R8EA 1S5LX 3AE1C 3RK3E 1NGMB 2ZT9C 3O6QA 2WSFJ 3IN6A 2FYNC 1FDOA 4H13B 4PV1C 3RL0g 4OGQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 B;  2ZT9 B;  2WSC J;  3LW5 J;  2WSE J;  4RKU J;  2E75 B;  2D2C B;  2QJK C;  5KKZ C;  2E76 B;  1VF5 B;  4H44 B;  2YIU C;  2QJP C;  2WPV B;  1ZRT E;  2O01 J;  4IL6 X;  4Y28 J;  2QSI A;  5KLI C;  2QIW A;  3C8V A;  4I7Z B;  4KT0 J;  1Q90 D;  1JB0 J;  1S5L X;  5L8R J;  2K9Y A;  4PV1 B;  4OGQ B;  2WSF J;  2FYN C;  4H13 B;  2QJY C;  4H0L B; 
#chains in the Genus database with same CATH topology
 1GK6 A;  5AVW B;  4BRY A;  3R4Y A;  1NWQ A;  3GHG A;  1GL2 B;  1FJK A;  1L4A C;  1RE4 C;  2ZXE B;  1VF5 B;  1OW7 A;  4YXW H;  1JMB A;  1KMI Z;  4U3F G;  1OX3 A;  1L0L D;  1LTI C;  1EDL A;  1YYC A;  2BCC D;  2FBW C;  3L74 J;  3CWB J;  1N8R Q;  2BEZ F;  3KZI H;  1M90 Q;  2QM8 A;  1LTG C;  1LTT C;  4K35 A;  1BGY D;  5DJU B;  3B8E B;  2OYO A;  3L72 D;  1KFN A;  2HOD B;  5KLI C;  1VQ9 P;  1ZP0 C;  1ZW0 A;  3BVH A;  1QVF O;  1PGQ A;  4YXD C;  3PJS K;  1XTC C;  1OZH A;  5AVS B;  1JMM A;  1JOC A;  1JY2 N;  1RQU A;  2BCC E;  3Q5P A;  1L0L E;  1QL2 A;  2IDB A;  1PPJ D;  2KNC B;  4PV1 D;  4TLF A;  5DJT B;  3RGU A;  4ZNC A;  3TSI A;  3CPW O;  2A06 G;  2LR2 A;  1RE4 A;  1SQB G;  2O01 H;  1MZ9 A;  3V2R A;  2KS1 A;  2BEQ D;  2ZT9 D;  2KOG A;  5KJ7 D;  3RBX A;  3U1C A;  1LTB C;  2K88 A;  1VPC A;  3H1K G;  1BE3 G;  1DX7 A;  1PGP A;  1NTK D;  1SQV D;  2KK7 A;  2OYH C;  1G1J A;  2A06 E;  3BAT A;  2B88 A;  3FWL A;  1CZQ A;  3PTZ A;  1ZR2 A;  3H1I J;  2QJP C;  3MTU E;  4JBZ A;  5KKZ B;  3GG2 A;  5TIS H;  3GF3 A;  3RK3 D;  2Q7C A;  1HJ0 A;  1ZN5 A;  1SQQ D;  3L70 E;  3CCM P;  1VQM P;  2XNX A;  2XKM A;  1A02 J;  3HE5 A;  1LWU C;  3L70 D;  3TK1 A;  1N86 A;  1FJP A;  2KSJ A;  3H1K J;  3HUS A;  2AEJ A;  2Z5I A;  3P32 A;  3F5H A;  1KZU B;  3A0B E;  4L73 A;  1Q90 D;  3SFD C;  2KIK A;  4OWF A;  3VOP A;  1BSH A;  1SQX K;  5APV A;  3CME P;  3RL0 D;  1GMJ A;  2XND H;  2YNY A;  1MUU A;  1AVY A;  1P84 E;  1SFC D;  4IFM A;  4DJG A;  2P2U A;  2PFX A;  4HKZ H;  4HYT B;  1S3J A;  3VN0 A;  3A5T A;  2HOD A;  1R5L A;  5KLV J;  1S2E A;  3S4R A;  1VL2 A;  4R4L A;  1VQP P;  3LW5 J;  3H25 A;  1H89 A;  2QG4 A;  4JYC A;  1T8Z A;  4LLH A;  3RK2 D;  2N1T D;  1VQ5 P;  2KNC A;  1LWU B;  1X9V A;  1W2E A;  4B86 A;  1NU1 E;  4I7Z C;  2K3R A;  2FXO A;  2E5T A;  2H88 C;  1U7M A;  1CI6 B;  3AE5 C;  1M1J C;  3E1I A;  3HTK A;  3HD7 D;  3C1L A;  3HD7 A;  3M9Q A;  2NPS C;  1EZV I;  1N73 C;  2POH A;  3AEB C;  1MKM A;  1CW5 A;  3EFF K;  3L73 J;  2WPR A;  4EDF A;  1YHQ P;  5CCH A;  3O6Q B;  4H13 D;  5APU A;  1HGV A;  4BWN A;  1LT9 B;  2CPS A;  4WY4 C;  5AW9 B;  4AQR D;  5BU8 B;  4OGQ B;  2YXR B;  2JR8 A;  2HG5 D;  2ZAE B;  3WUV A;  2WT7 B;  1S9K D;  5CJ4 A;  5H2F H;  1H8A A;  2XV5 A;  3GW6 A;  3H1H D;  4HH2 A;  4YPC A;  1X0T A;  2CPB A;  1OVU A;  2P1J A;  2KZI A;  5CBN A;  4GOE A;  3WUU A;  1HF9 A;  1NU1 J;  3ZDM A;  4L76 A;  1GZL A;  3NTN A;  3V2N A;  3VYI A;  5APQ A;  1FZG A;  2WSE H;  1VQ8 P;  2WSE J;  3L70 G;  2E75 B;  1SQP K;  5KKZ C;  1KFM A;  1KB9 D;  1RQV A;  2L91 A;  2FFD B;  1M1J B;  2E76 D;  1LP1 B;  1NTM E;  2Q3E A;  1AVO A;  5CMZ A;  3MUD A;  5CCG A;  5AVZ B;  3OW2 O;  4W80 A;  1KIL C;  1NTZ D;  1G2C A;  2E75 C;  3E7K A;  1HWT C;  3VP9 A;  1JO5 A;  3L36 A;  3CC4 P;  4JPZ B;  1E5W A;  1R8E A;  3H1H G;  3H1K D;  1URQ A;  5C39 A;  2YKP A;  4U3F J;  5CCH D;  1PP9 J;  2QA4 P;  3H1I D;  1KD1 Q;  3L72 E;  3RL0 g;  5KJ7 A;  1MV8 A;  1Y9B A;  1PPJ G;  3BCC D;  2GM4 A;  2I1J A;  1S72 P;  1JY3 P;  1VQ6 P;  2JP3 A;  3V4W A;  1N73 B;  1URQ D;  3EFG A;  4I1L A;  3H6P A;  2OAR A;  2YMY A;  3TNU B;  1L0N E;  3MP7 B;  1JM0 A;  2WT7 A;  2QM7 A;  1NKZ B;  2QJP B;  1VQ4 P;  3D6Y A;  4Y28 J;  3S9O A;  4UB6 E;  1RF0 C;  4UB8 E;  3KYQ A;  3H1J D;  4GIF A;  2IX7 C;  2Y0D A;  3B5N C;  2YKQ A;  1KQS O;  2FYN B;  3SWF A;  1OMI A;  2OTK E;  2VRS A;  3G4S P;  2R3C A;  1J1D C;  1SQB K;  2WSS H;  2YO3 A;  2NPS A;  3BCC G;  4C7N A;  1J2J B;  1QGK B;  1W5C E;  1KOR A;  4Y99 B;  4W7Z A;  5GTH H;  2UWJ E;  1L0L J;  2PRR A;  1JTH A;  3AE3 C;  3PLN A;  3L75 J;  1NTM G;  2A45 G;  4JF7 A;  4WBA A;  4TT3 H;  2FXM A;  3TGU G;  2FYU J;  1JY2 P;  1FZC B;  4L75 A;  1SP4 A;  2YXQ B;  2QJK C;  3TYY A;  1NTM K;  1KIL D;  3GLM A;  1SQV J;  3H32 B;  1QX8 A;  2YO2 A;  3BRT B;  1JY2 O;  3R2P A;  4H44 D;  3RK2 B;  4BXL A;  1Q7Y Q;  1H0T B;  3AE8 C;  2IFM A;  1BE3 E;  1U7J A;  2B87 B;  3H1K E;  1EDI A;  4EIJ A;  1KQF B;  1L4A A;  3L71 E;  3A0H H;  4IL6 X;  1NTM J;  2E76 C;  1ZR4 A;  4ZMD A;  1SQX G;  1IFJ A;  1M8O B;  1BE3 D;  1YTZ T;  2W6B A;  3V4Q A;  2Y9Y A;  3TGU D;  1KYO H;  1GL2 A;  1FZB A;  1GTW A;  5AVY B;  5CBO A;  1IK7 A;  1EXI A;  1KIL E;  1NTK K;  3TNU A;  2E74 C;  1JY3 O;  1SQX E;  1FZA A;  2OYI A;  1NTM D;  1U57 A;  4K3A A;  5B66 H;  1R5S A;  2O3J A;  3CX5 I;  3CCE P;  3L37 A;  3CCL P;  1M56 D;  2R5B A;  3Q3D A;  1ZME C;  3RBZ A;  1X22 A;  2QJY C;  2SPZ A;  2ITA A;  3AEG C;  4U3F E;  1USD A;  3Q1M A;  4IL6 E;  1VQO P;  1BDC A;  3Q5S A;  2GUV A;  1G2C B;  2KZJ A;  2FYU D;  3CWB E;  4HJG H;  2JDI H;  4RJT A;  1L0N K;  1N7S C;  1VDF A;  3HUS C;  1T3J A;  3WUT A;  1PP9 D;  1YQ3 C;  1NU1 K;  1SVF A;  4GT1 A;  1EC5 A;  3M06 A;  4OVN F;  4U3F D;  4Z1M H;  2O1K A;  1N7S D;  2BCC G;  3AEC C;  3EWK A;  3A2A A;  2N1T C;  2QIW A;  3PP5 A;  2R5D A;  4WY4 A;  2OYI C;  3BCC E;  1NU1 G;  1L0N D;  1K04 A;  3C8V A;  1S5L H;  4Y99 C;  2GA1 A;  1Y8A A;  1OWA A;  1SQB E;  3GF7 A;  1L2P A;  3IR9 A;  2R32 A;  1UII A;  5AW8 B;  2KB7 P;  1J1E C;  1NYH A;  2J59 M;  3TGU E;  1VQK P;  2XDJ A;  5AW7 B;  3SWK A;  2Y9Z A;  1KB9 H;  1YBK A;  3M91 A;  5CJ0 A;  1FZE A;  1M7L A;  1SQP G;  2E74 D;  3VMY A;  3AED C;  1RE3 A;  1HVV A;  2J58 A;  1TU3 F;  2WSC J;  3FX0 A;  1DEE G;  2M5A B;  1ZXG A;  3E1R A;  5E79 E;  1LP1 A;  2D2C B;  2M3E A;  2J5U A;  1JCD A;  3AE4 C;  1SQP E;  3H1H J;  3II6 A;  2CK3 H;  4GOF A;  2RH0 A;  4UB8 H;  3S1K A;  5KLI B;  2H8P D;  1Q81 Q;  4PD4 D;  1JCC A;  3BRV B;  2RKL A;  1FE6 A;  3MIW A;  3TDK A;  1K8A Q;  4I6M C;  1GW4 A;  4H44 C;  2N9B A;  5AVQ B;  3CL3 D;  2FFD C;  2KYV A;  3FGA D;  1FOS F;  3M0D C;  3CMA P;  3A3Y B;  3AE1 C;  3L75 E;  1N7L A;  2P7J A;  3P8C E;  5KJ7 C;  1NGM B;  2B89 A;  3O6Q A;  2XU6 A;  1K9M Q;  1FBM A;  2WSF J;  2ZYG A;  3I5C A;  4WB4 A;  5KLV E;  2FYN C;  5BU5 A;  2HFE D;  2HYN A;  3OA7 A;  1D7M A;  4PV1 C;  1M57 D;  3JC2 2;  1NJI Q;  1S4X A;  2PGD A;  2ZFC A;  2Z5H A;  1EZV D;  3H1L D;  1LT9 C;  4M3L A;  1JUN A;  3CCR P;  2WSC H;  3B5N D;  5EFW B;  5APX A;  3RK3 B;  5KTB A;  2Z4E A;  4YTP C;  1Q82 Q;  2LKM A;  2E43 A;  3NFQ A;  4MN4 C;  1NU1 D;  1RF0 A;  2C0X A;  2N1T B;  2QEX P;  1HJB A;  2FFD A;  2C9L Y;  1OFC X;  1W2B O;  1KQL A;  2B87 A;  2R3S A;  1GU4 A;  1QLE D;  3B71 A;  3L4F A;  2I1K A;  1X8Y A;  1GDT A;  3IFM A;  1URQ C;  1NKN A;  2YIU B;  2Q5U A;  2KS1 B;  3HD7 B;  3MD0 A;  3H1I E;  4I2L C;  5B5E E;  1YI2 P;  1PFI A;  5TIS E;  1RF1 C;  1RHZ B;  1J1E B;  1M1J A;  3M9H A;  5KAF H;  3CI9 A;  1OVR A;  3CCQ P;  1UIX A;  2AXT H;  3H1I G;  2OTL P;  5B5E H;  1NHL A;  1KTM A;  3V2Q A;  5CCH C;  1FS0 E;  1WT6 A;  1LJ2 A;  2IYO A;  2IYP A;  3OJA B;  4N6J A;  1P84 D;  5KAF E;  1DIP A;  1NTK J;  3Q5R A;  1CI6 A;  2JO1 A;  1BDD A;  1P84 H;  1NAY A;  2JKV A;  3OAK A;  2E75 D;  4PD4 I;  3W67 A;  4DCK A;  5KLV D;  3L71 J;  3PHL A;  1LTA C;  2LXC B;  3P8C D;  1ZRT E;  1GL2 D;  2WVR A;  2Q3I A;  1PGJ A;  1BSN A;  1P84 I;  1SQV E;  3CX5 E;  3H1H E;  3HUS B;  1Z56 A;  3JCU E;  4IOI H;  1N7S B;  1NTK G;  2QJK B;  1ZOY C;  1ZRT D;  2A45 H;  2PP6 A;  5AW0 B;  1BE3 J;  3FWN A;  3TGU J;  3V5B A;  2L5G B;  2NZ2 A;  5KLV G;  1JB0 J;  2QE7 H;  1T6A A;  1RF1 B;  3L71 G;  1NH4 A;  2HR3 A;  3CD6 P;  4PD4 E;  1PL5 A;  3UIA A;  1KC8 Q;  1NTK E;  3AE9 C;  2WTY A;  1FDM A;  1PPJ E;  5AW5 B;  4H0L C;  2RN0 A;  3WU2 E;  2K37 A;  1S5L E;  1G1I A;  3P8M C;  1VQN P;  1LTJ A;  2FYZ A;  1IFP A;  4XFJ A;  1ZV8 A;  2P67 A;  3PRJ A;  1MFZ A;  1SS1 A;  4WY4 D;  5AW6 B;  5AVV B;  2MKV A;  4H13 C;  1HTL C;  1L0N G;  2E74 B;  2W6A A;  5K5G B;  1M1K Q;  2H89 C;  3EQ2 A;  3K5B A;  1BCC J;  3VTP C;  1A02 F;  5H2F E;  1GK4 A;  3TF5 A;  3L73 G;  5CCG C;  4WVZ A;  1BGY G;  2NPS D;  1KYO I;  2C9N Y;  3G9R A;  2YIU C;  1PZQ A;  3HD7 C;  1LT9 A;  4RO0 A;  2WPS A;  2PAJ A;  3JSV C;  4IL6 H;  1IC2 A;  2IBZ G;  1RY3 A;  2O01 J;  2K1A A;  1BGY E;  4XE5 B;  2BAS A;  3B4S A;  4LGD E;  3RK2 C;  3MHV A;  2IFN A;  2KI7 B;  3USS A;  3Q2Y A;  1FZC A;  1IFD A;  4D6T E;  1EZV G;  2N9Y B;  5GTH E;  5L8R J;  2K9Y A;  1LWU A;  3KHU A;  4PV1 B;  2B9B A;  2P10 A;  1QL1 A;  1FDI A;  2KP8 A;  3HE5 B;  4DZO A;  2E42 A;  1SFC C;  3CC7 P;  3A0B H;  2FYU E;  3HE4 B;  3CWB D;  5APS A;  2WMM A;  2BCC J;  3FXE A;  3L74 D;  2ZT9 B;  3PH0 A;  2W6J H;  3SSU A;  3VMZ A;  1IFM A;  1NO4 A;  1PV3 A;  2WZ7 A;  3RL0 C;  1AA0 A;  1H88 A;  3GHG B;  4AYC A;  3L35 A;  3GMA A;  1FU1 A;  4GKG A;  4EOT A;  1X79 B;  1BCC D;  5AVX B;  3L75 D;  3T97 B;  5BVZ A;  3KDP B;  3H32 A;  3AEA C;  1OIP A;  3CXH D;  2N1T A;  1KIL A;  3ITK A;  2OQQ A;  4N78 E;  3G71 P;  3LIE A;  4D6T J;  1LTS C;  4KJM A;  1CSB A;  3B5N A;  3CXH H;  4KHX A;  3RK3 C;  2E5Y A;  4GOD A;  1FC2 C;  2P58 A;  5TJH A;  3VMX A;  1N7S A;  2D2C C;  1NTZ J;  4I7Z B;  4JYB A;  4KT0 J;  1HGZ A;  1SQP D;  1GW3 A;  1EQ7 A;  3D71 A;  1S5L X;  3A0H E;  4L74 A;  2ZT9 C;  3M0A A;  3QH9 A;  2JWD A;  4RES B;  3H1J J;  2R44 A;  1RE3 C;  2KLU A;  3IN6 A;  1AFO A;  1FDO A;  2ZVN B;  2O1J A;  3CWB G;  4H13 B;  4AUW A;  1H0T A;  4WY4 B;  4ASW A;  3FXD A;  2AXT E;  3F89 A;  4ZKP A;  2KXP B;  1T2K D;  1NAF A;  2O01 N;  2K9J A;  3NXS A;  3KZI E;  4LC1 A;  3U59 A;  1LTJ C;  2IBZ E;  2M0B A;  4BRY B;  1RH5 B;  2OYI B;  1T3U A;  5APW A;  5CHX A;  4ASV A;  1PP9 G;  2WPV B;  1JY3 N;  3H1J G;  2ZYA A;  1KYO E;  3HRN A;  3B5N B;  3BCC J;  3I55 P;  4C7N B;  1EZV E;  2LXB A;  3H1L E;  2OYH A;  1YIT P;  1HUC A;  3CCV P;  1DH3 A;  1WMK A;  2V7Q J;  3IF4 A;  3L73 D;  1SQB J;  1PIX A;  3V6I A;  1L0L G;  1JTH B;  1PP9 E;  3ABV C;  1L4A D;  1XTG B;  3AEF C;  3H1J E;  4DOJ A;  1FOS E;  2AEF A;  2M5A A;  4N3Y B;  4C46 A;  3H1L G;  2FYU G;  1YIJ P;  4PJ0 H;  1T2K C;  1NVO A;  4EI2 A;  1DD4 A;  1L0L K;  2JWA A;  2YMK A;  2G3A A;  4WWI A;  2QJY B;  3RL0 B;  3WU2 H;  2Q6Q A;  4OGQ D;  1YJN P;  2H43 A;  1VQ7 P;  1YJW P;  2FYU K;  2M3B A;  2M8R A;  2AEM A;  2W27 A;  2WWW A;  4H0L B;  2QRX A;  1SQX J;  2NRG A;  3H1L J;  1SFC A;  3BAS A;  1SQX D;  3L71 D;  1IFI A;  3N4X A;  3CLQ A;  3MUD C;  4GDO A;  1USE A;  4RKU J;  2HPC B;  2D2C D;  2E76 B;  3KPE A;  2YKO A;  4NPF X;  2IZ0 A;  1N73 A;  3AE6 C;  4CPG A;  5KAI E;  2WSF H;  5E79 H;  3CCU P;  5KLV K;  3L75 G;  5AVR B;  4IFD K;  1SQV K;  1LGH B;  4EYY Q;  3NMD A;  1IFN A;  1IZN B;  1GU5 A;  2V4H A;  1HH0 A;  1AJY A;  1KN7 A;  2FY8 A;  5KAI H;  5AW2 B;  1EDK A;  1BCC G;  3U1A A;  1SQV G;  2GUS A;  1SQB D;  3KXD A;  3IAO A;  4OH8 B;  5AW1 B;  1JNM A;  1AV1 A;  1E79 H;  1KQG B;  4UB6 H;  1FAV A;  3M9B A;  4QMA A;  1LTJ B;  2IZ1 A;  3D6Z A;  2Q9I A;  3M0D A;  2OTJ P;  3GHG C;  1PGO A;  1OW8 A;  2KSE A;  1EXJ A;  2FKW B;  1J1D B;  2WIT A;  1NOH A;  4DT0 A;  4ZKU A;  3HTK B;  3G6E P;  1SFC B;  1WRG A;  3AEE C;  4U7J A;  5GTI E;  1YJ9 P;  3LW5 H;  2RMZ A;  4HB1 A;  3L72 G;  3D70 A;  1HBW A;  3VMA A;  1S9K E;  5AW3 B;  3AE7 C;  1KYO D;  1VF5 D;  5M1B A;  3WMM 0;  2C0W A;  4O9B A;  1QVG O;  4R4M A;  1Y47 A;  1YQ4 C;  1JEK A;  2W8Z A;  5GTI H;  1IK9 A;  1N2D C;  2IPP A;  2IBZ D;  2NPS B;  3O8Z A;  3V2P A;  3I56 P;  1Q86 Q;  1VF5 C;  1LNQ A;  2QSI A;  1L0N J;  2QVA A;  1DD3 A;  1L4A B;  2W90 A;  3N7N A;  1SQP J;  2AXC A;  3LID A;  5CCG D;  1IO4 A;  2ZXX A;  2HPC A;  1AQT A;  2G8Y A;  3L72 J;  1AQ5 A;  1BGY J;  3MZW B;  2H7H A;  4C7R A;  3L70 J;  2W83 C;  2WPQ A;  2JJL A;  5APY A;  4A7P A;  3MGN A;  3KQG A;  3SWY A;  5APT A;  1VQL P;  2KLV A;  4D6T G;  1K73 Q;  1NTZ K;  2V7Q H;  4H0L D;  5AVT B;  1SQQ J;  2ZVO B;  1OW6 A;  2MJZ A;  2XZR A;  2ZYD A;  3P7K A;  2DW3 A;  4XA4 A;  3CCS P;  3T97 A;  1OVV A;  2K9J B;  1NTZ G;  4NPD A;  3W68 A;  2IBZ I;  3CC2 P;  1KIL B;  3JCU H;  1IJD B;  4JQ0 D;  1FZF A;  4H44 B;  2FXP A;  1EDJ A;  1KB9 I;  1SQQ K;  2WQY C;  1URQ B;  4N78 D;  3VP8 A;  1MFT A;  4W7Y A;  3SFE C;  1S1C X;  1RF1 A;  1GL2 C;  1NTZ E;  3HE4 A;  3AE2 C;  1SLQ A;  4PJ0 E;  2OYH B;  1BCC E;  1SQQ G;  1GD2 E;  4NPE A;  1K05 A;  2Q1K A;  5B66 E;  1KV4 A;  3QWO C;  1OXZ A;  2JEE A;  1DEB A;  2OGU A;  3CX5 D;  3CXH E;  3L74 E;  2A45 I;  1QEX A;  3CXH I;  1KB9 E;  1SQQ E;  1ZLL A;  2HLO A;  2Y0E A;  2Y0C A;  3CX5 H;  3RK3 E;  4IFF A;  5AW4 B;  2ZJS E;  1Q2N A;  3C9I A;  3CCJ P;  1FZC C;  5AVU B;  2I8D A;  3A7O A;  1YTZ I;  1LT1 A;  2A06 D;  3L74 G;  3L73 E;  2KUB A;  4OGQ C;  4D6T D;  4PD4 H;  3G3Z A; 
#chains in the Genus database with same CATH homology
 1Y9B A;  3R4Y A;  4YTP C;  2JP3 A;  1VF5 B;  1OW7 A;  1KMI Z;  2WPV B;  2FBW C;  2BEZ F;  3B71 A;  1WMK A;  2V7Q J;  3D6Y A;  4Y28 J;  3S9O A;  1PIX A;  5KLI C;  3ABV C;  1ZP0 C;  3AEF C;  4YXD C;  1OMI A;  1DD4 A;  2YMK A;  1RQU A;  2G3A A;  3Q5P A;  1UIX A;  2IDB A;  4OGQ D;  4PV1 D;  1KOR A;  4H0L B;  3AE3 C;  2ZT9 D;  2BEQ D;  1DIP A;  3Q5R A;  4TT3 H;  2JO1 A;  4GDO A;  4RKU J;  2QJK C;  2E75 D;  3GLM A;  2D2C D;  2E76 B;  4H44 D;  2QJP C;  3AE6 C;  3AE8 C;  3GF3 A;  1ZRT E;  1HJ0 A;  1KQF B;  4IL6 X;  2E76 C;  1ZOY C;  3SFD C;  2NZ2 A;  1EXI A;  1AJY A;  1Q90 D;  1IK7 A;  1JB0 J;  1KIL E;  2E74 C;  3IAO A;  1PL5 A;  1KQG B;  3AE9 C;  1GMJ A;  4H0L C;  1U57 A;  3D6Z A;  3Q3D A;  1OW8 A;  1ZME C;  4XFJ A;  1EXJ A;  2QJY C;  3AEG C;  2MKV A;  4H13 C;  2E74 B;  3Q1M A;  1VL2 A;  4R4L A;  2H89 C;  4U7J A;  3AEE C;  3LW5 J;  3H25 A;  3Q5S A;  3D70 A;  3AE7 C;  3G9R A;  1VF5 D;  2YIU C;  5M1B A;  4R4M A;  4I7Z C;  1YQ4 C;  1YQ3 C;  4Z1M H;  2H88 C;  2O01 J;  3AE5 C;  1VF5 C;  2QSI A;  3AEC C;  3EWK A;  2QIW A;  1DD3 A;  3Q2Y A;  3AEB C;  1MKM A;  1K04 A;  3C8V A;  2G8Y A;  5L8R J;  3GF7 A;  4H13 D;  2K9Y A;  4PV1 B;  2P10 A;  4OGQ B;  1FDI A;  1NYH A;  4H0L D;  2ZT9 B;  1KTM A;  1HF9 A;  1PV3 A;  1OW6 A;  2E74 D;  3AED C;  3GMA A;  2WSC J;  1TU3 F;  2WSE J;  2E75 B;  3T97 B;  2D2C B;  5KKZ C;  1RQV A;  4H44 B;  2FXP A;  2J5U A;  3AE4 C;  2E76 D;  2WQY C;  3AEA C;  2OQQ A;  3SFE C;  1S1C X;  3AE2 C;  4H44 C;  1K05 A;  2D2C C;  2E75 C;  4I7Z B;  3FGA D;  4KT0 J;  3D71 A;  1R8E A;  1S5L X;  3AE1 C;  3RK3 E;  1NGM B;  2ZT9 C;  3O6Q A;  2WSF J;  3IN6 A;  2FYN C;  1FDO A;  4H13 B;  4PV1 C;  3RL0 g;  4OGQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...