2O0LA

Human spermidine synthase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
274
Chain Sequence
IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of spermidine synthases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Spermidine synthase
total genus 89
structure length 274
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 2o0lA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o0lA02
5FQNA 5DX0A 1NBIA 4DMGA 1IXKA 3NVKI 2PX4A 3EPPA 1ZG3A 3LX6A 1AQIA 3MTEA 1JG3A 3NTVA 4H0NA 3HVKA 4OQDA 4X41A 4V0RA 2VDVE 3GNLA 3O4FA 5EKUA 2BM9A 2PVCA 2G8NA 3LKDA 4PYKA 2O0LA 5CCBA 2ZLBA 2QRVA 3MCZA 3DLCA 3OFJA 4OQEA 1FBNA 2YUIA 5HOQA 5K0CA 3G2PA 2FHPA 3DTNA 3M70A 4CKCA 2HR1A 2PLWA 4U7PB 4C08A 1RJEA 2YVLA 2NXJA 4FGZA 3ELYA 3ORHA 3LKZA 1I4WA 1JQEA 1VPTA 3BKWA 3THRA 4DCMA 2AS0A 5LQNA 4LWPA 2ZBQA 2EX4A 3R0QA 3X0DA 3ELWA 1ZQ9A 2GH1A 3CVOA 5KVAA 3FPEA 4DF3A 5E8JA 3B3GA 1O9HA 3EGIA 4GBED 1KPIA 3A4TA 2P1DA 2IGTA 2HMYB 2IFTA 2XYRA 4PONA 2WA1A 3AXSA 5EPEA 3G89A 3U81A 2I7CA 5GIOE 2VDUE 4MIKA 1YFLA 5EMKA 4FSXA 3THSA 5EG5A 3C6MA 1Y8CA 4RTKA 5DX8A 2ZVJA 4LWOA 5K0FA 5FWAA 5GWXA 1M0EA 1DCTA 3KR0A 4PNEA 1N7IA 2Y1XA 3G8AA 4E30A 1RI4A 4NECA 2B25A 4C4AA 1VP9A 3EEOA 5LQUA 2JHPA 2PXXA 2P35A 5DX1A 2PY6A 3D2LA 4E31A 2YXDA 2P41A 3R9XB 3MB5A 5EZQA 4E2ZA 2ZZMA 2OKCA 3OZSA 3BZBA 1DL5A 2GLUA 3TOSA 4GOLD 1X1DA 2FK7A 2H00A 4RTNA 3KQSA 4E33A 3MERA 2EFJA 1F38A 2YXLA 3FZGA 3SGLA 3EVAA 3BWMA 3BWYA 3PX2A 5T6BA 2EJUA 1ZGAA 2GAFA 1JQ3A 2IBSA 5P8WA 5CD1A 1D2CA 3G2OA 2AOXA 1SVUA 2ERCA 1M6YA 3AXTA 4FP9A 4QDJA 5FCDA 4C07A 5C9ZA 4BP3A 1KIAA 2UYOA 3VSEA 2O07A 5ERGB 5LQJA 4O29A 4M7RA 4Z2YA 3R6TA 3BKXA 2JHCA 1NBHA 4YUXA 3LDFA 2H1RA 3P9KA 1G55A 5H02A 4E70A 3BWCA 1VL5A 1VLMA 4ISCA 1AV6A 3KKZA 2P3LA 5FA5A 4AZTA 10MHA 3FTFA 3SSNA 4RYLA 1INLA 1NKVA 1NW8A 1YZ3A 3P2EA 3Q7EA 4GOMD 4BLVA 2C7PA 5EIWA 4AZWA 2OBFA 3P97A 1MHTA 4OX9Y 4OBXA 4AX8A 5EHIA 2B2CA 2IDKA 2VZ9A 2Z6UA 4P7KA 1B42A 2P40A 4RVHA 5K03A 4XUDA 3TQSA 2Z6AA 2AOTB 5EKXA 5DM4A 5MHTA 3PLAE 2CKDA 2ZTHA 2PT9A 3KQWA 4FT2A 4IKPA 5B1SA 1EG2A 4PYMA 5DLYA 1NW5A 3PT9A 5LQKA 2OPBA 2G1PA 2EJTA 2PBFA 2G70A 2IH5A 4IV8A 4PYQA 3DMHA 4E32A 2IH4A 2JG3A 2K4MA 3BT7A 2XVMA 3LECA 1H1DA 3FRIA 3REOA 7MHTA 3FUUA 3M6XA 3EVDA 4C06A 3VYWA 2FYTA 1SQGA 2ESRA 3ELDA 1EIZA 4EMSA 4YMHA 2B3TA 1OR8A 3KR9A 5EEHA 1MJFA 1Z3CA 4A6DA 3OU2A 3CBGA 4F84A 5K0JA 4V0QA 1WXXA 5DSTA 4Y30A 5CCXA 3BUSA 5EVJA 1QAQA 3C3YA 2QM3A 1F3LA 3KPJA 5HEKA 3UJ9A 2JHAA 3EMDA 2C7QA 4HTFB 3B89A 5DXJA 2PWYA 4QTUB 3KQPA 4QPPA 1YB2A 1XDZA 4RWZA 3ID6C 4HGYA 3DUWA 5IKMA 4XUCA 5DTQA 1JR4A 2AR0A 2QRVB 2O57A 2IBTA 4PINA 2ZULA 4EKGA 4G56A 5FHRA 3F4KA 4QTTB 1ORIA 3RODA 3OU7A 4RTMA 4WVLA 4Y2HA 1O54A 2NXNA 3P2KA 5FUBA 2ONZA 3EVCA 2HV9A 2KW5A 3KQVA 4KRGA 3SSMA 1JSXA 3TLJA 3ER8A 3GU3A 3FUVA 4X61A 4DQ0A 5BW5A 1IM8A 3HCEA 3KQYA 5T64A 4AUKA 5DPMA 4P58A 4F86A 3HM2A 4CKBA 1SKMA 2FRXA 1JG4A 1EQAA 1ZKDA 3FRHA 3LPMA 4B17A 1JTFA 1KPGA 2OYRA 4PYNA 2IIPA 4R6XA 4YV1A 4RV9A 3MHTA 2B9EA 4KIFA 3GWZA 1KXZA 3P9IA 1P39A 4HGZA 3TR6A 4BP1A 2BM8A 3WSTA 4P7JA 2IH2A 2HWKA 2BR4A 3HVHA 3L8DA 3P8ZA 4ATNA 1X1AA 2WA2A 3SX0A 5DRTA 2ZWVA 4GQBA 3V97A 4CKEA 2R6ZA 1RJGA 1ZHFA 2ZIGA 4YUWA 3PVCA 1RJFA 5E1BA 4HTFA 4ZTBA 4C05A 2BR3A 2AOVA 5GINE 1PRYA 2IPXA 3UJAA 2VDWA 5LQAA 5LQRA 4DCGA 3EVZA 3TFWA 3HCAA 1R18A 2O06A 3PFHA 3MAGA 4EKIA 1I1NA 2GS9A 3DULA 3FPHA 2ZSUA 3BXOA 3EGEA 2ZFUA 3EVBA 1R74A 5DM2A 3KPYA 2UZ4A 1NE2A 4QQNA 1ZGJA 5GP1A 3UFBA 1D2GA 4RTPA 3T7SA 5LR6A 4DZRA 3LSTA 2PX2A 2R3SA 5C0OE 2P3QA 1NW3A 3MTIA 4CXMA 3SMQA 5E1MA 2ZZKA 3NVMB 5E9JA 1L3BA 5FTWA 3SSOA 2PKWA 3QOXA 3HP7A 4BY9E 5CVEA 4HH4A 3FPFA 2OY0A 3PS9A 4ER6A 3CCFA 3LBYA 3KPWA 4M38A 1WZNA 5CVUA 5K0NA 4C03A 3ER9A 5K0LA 2BR5A 3T7RA 3P9CA 3A25A 4X60A 3ERCA 3OU6A 1G8AA 2JH9A 3OE4A 3PX3A 3GCZA 2ZZNA 1R8XA 3FTCA 3ELUA 4MQ4A 1X1BA 3C3PA 1XCLA 2CL5A 3EVEA 3CKKA 3KQTA 1VBFA 4R6WA 3OZTA 3TM4A 2IDJA 3O7WA 3UJ8A 4EVIA 1XVAA 4GUAA 2QYOA 3M6WA 5EZSA 4CTJA 4X63A 3DXZA 2XVAA 5F2KA 3DMFA 2AOUB 4DKJA 5EMMA 3UJ6A 3GJYA 4ER7A 1SUIA 5D1NA 3RW9A 3UJ7A 3FPGA 1FP2A 4PGGA 3B3FA 4HSGA 2OB2A 4KDRA 3P71T 2HTEA 5EEGA 4ER3A 2NXEA 4RSRA 3TKAA 3KPVA 3LCVB 5EQJB 3LGAA 3GRYA 5CVVA 3M6UA 5LQCA 5ICGA 3E7PA 2BH2A 2VS1A 3TM5A 2PV0A 3CJTA 4YUZA 4FZVA 4HC4A 1QANA 5EMLA 2UYCA 3EMBA 4HRAA 4YMGA 2C7OA 1P1CA 4PCLA 4PIPA 3M6VA 2AOTA 4POOA 5K0EA 2YTZA 2ZBRA 1UFKA 3UJDA 3G5TA 4A6EA 1HNNA 1VP3A 3HVJA 3NW9A 5HFJA 2FCAA 2ZCJA 4GC5A 5K01A 1L1EA 4PGHA 4PYIA 5K05A 3DR5A 3E8SA 3S68A 1G60A 3FYCA 3GO4A 2ZWAA 3JWJA 1YFJA 3HCCA 5FA8A 3UWPA 2ZIEA 3DH0A 4YV2A 3MGGA 3JWHA 2P7HA 4OA5A 1XDSA 4L7VA 3TMAA 5K8VA 4RTOA 1BHJA 1TW2A 2AVNA 1TPYA 5CIYA 2PX8A 5KQRA 4P7GA 1XJ5A 4EQZA 5DTMA 1R8YA 2NXCA 1P1BA 3AWIA 3DMGA 2I6GA 4YUVA 2OB1A 2ADMA 1BOOA 2LD4A 3FUWA 4QVKA 5E1DA 3KR2A 4LECA 2EG5A 3K6RA 1XXLA 2AVDA 1QZZA 1RI2A 1BC5A 3PFGA 5JR3A 4MHTA 5D1HA 1M6EX 3CJQA 1RI1A 3EGVA 2YQZA 5DRYA 3FTEA 4C04A 5BP7A 1X19A 3UZUA 3UA3A 3JWIA 5DWQA 3SVZA 2PXAA 2ONYA 3HCBA 1YF3A 2NNWB 4KIGA 3H2BA 5E9QA 4RVDA 5F2NA 3GRUA 4RVGA 3BWBA 5C1IA 2ZIFA 3VC2A 5HIKA 1NT2A 5IH3A 3UBTA 3LBFA 4QQKA 3GDHA 1T43A 2N47A 3IEIA 5GOZA 3G2QA 5KS2A 3HTXA 2DPMA 3JWGA 3CJRA 5K09A 3LCUA 3T7TA 3B5IA 1HMYA 1X1CA 3EVGA 4GC9A 3IV6A 4PWYA 5K0GA 1RJDA 5BXYA 4FSDA 2CMGA 1NV9A 5HIIA 5ICEA 1WG8A 1RI3A 2YX1A 2H11A 5DT2A 2AN5A 4DA4A 2PSSA 1PJZA 3OFKA 3AJDA 2G71A 1JG2A 3HEMA 4P7FA 3HA7A 4QDKA 5K0BA 3G88A 5DSXA 3CGGA 3R3HA 1FPQA 4MWZA 4BLUA 1QAMA 3KR1A 1N2XA 3GIWA 4BLWA 3GRZA 3I53A 2ZW9A 3FUXA 2A14A 3O31A 4KDCA 3UJCA 3PTAA 2UYQA 3HVIA 1V39A 3HCDA 4PIMA 2ZBPA 3I58A 4YUYA 4XUEA 2I9KA 2PX5A 2QE6A 2AOWA 2G72A 1D2HA 4KW7A 4EK9A 3DOUA 1ORHA 4RVFA 4FT4A 2C7RA 2I62A 3A27A 3VC1A 2O05A 1SQFA 3KQMA 2AN4A 4OBWA 1L3IA 1YUBA 3ME5A 1YZHA 4CTKA 2FPOA 1G6Q1 2NYUA 3CC8A 3NWBA 3P2IA 4DM3A 4M36A 3IYLW 5CVDA 5EC8A 4K6MA 4RX1A 3SM3A 3KQOA 1KPHA 1L3CA 4FR0A 1TW3A 2Y1WA 4E2YA 4GOOD 3FPJA 3I64A 1EJ0A 2PXCA 2YR0A 3FYDA 1KR5A 4AZVA 1N7JA 2AOUA 5G02A 4R8RA 3UA4A 1I9GA 1XDUA 1AF7A 2GA9A 3UJBA 5ICCA 2E5WA 1EAMA 1P91A 3E23A 2JH8A 3QOWA 4PYLA 4RTQA 4E2XA 3NWEA 1G8SA 3V8VA 3I9FA 2PJDA 1JG1A 3HNRA 1Q0TA 2PT6A 1UWVA 1AQJA 1NW7A 1JSZA 3NJRA 2P3OA 2XYQA 4RTRA 5KQSA 5HZMA 2OXTA 4XCXA 4AZSA 1VE3A 1VQ1A 2V7EA 3G8BA 2V74B 3GXOA 3OE5A 4R05A 1UIRA 3AY0A 5LSAA 5CM2Z 2NP6A 1VIDA 4PCAA 5FWDA 4IWNA 1DUSA 1SG9A 1WY7A 3GRVA 3B7PA 2P7IA 4U7TB 4QPNA 2CWWA 1FJXA 2YXEA 1XTPA 2P8JA 1QYRA 2CMHA 4F85A 4YV0A 2XYVA 3B3JA 3RIEA 5EGSA 5T67A 2F8LA 3MCTA 3A7DA 3QV2A 4R8SA 5EMJA 5U4XA 3HCFA 3TKYA 4ER5A 2VP3A 2Z6QA 3FTDA 3DXXA 2FK8A 3GRRA 3T0IA 2BZGA 5HIJA 3BGIA 3P9NA 3OPNA 3A26A 4X1OA 3C6KA 5F2OA 5FHQA 3EEYA 3R24A 9MHTA 2DULA 3LDGA 3GGDA 4GEKA 4HG2A 1KHHA 4CWAA 4ER0A 2GB4A 1R6AA 1FP1D 3BGVA 4MTLA 3TRKA 5GIPE 3DXYA 3LL7A 5EIFA 5EOVA 1EJ6A 2ORED 4JXJA 3C0KA 3NDIA 5FQOA 4RTJA 4PYJA 3OZRA 4M37A 5E8RA 2NP7A 5KYGA 2AZTA 2XBMA 4LG1A 5BW4A 3G5LA 3SR4A 3NMUF 5M5BA 2OO3A 2OZVA 2PGXA 1IY9A 1KYWA 2IP2A 3KHKA 4WXHA 4OA8A 3MQ2A 5CVJA 5HIMA 5DM0A 3HA3A 3M4XA 2UYHA 1NW6A 3IHTA 3ANXA 1XCJA 1SUSA 4KWCA 1WS6A 3KU1A 3PB3A 1KYZA 2QY6A 1KP9A 5HILA 2HNKA 4UOEA 1R00A 3A7EA 4GF5A 5FADA 3OCJA 4QVGA 1U2ZA 3EVFA 3KQQA 1WXWA 2Q41A 5EHGA 8MHTA 2PWPA 3DLIA 3E05A 3FUTA 1NV8A 3G7UA 5CUQA 5GM2A 2AN3A 5JUWA 2JJQA 4FS8A 5DTRA 3I5UA 3Q87B 3K0BA 3BGDA 4IV0A 5FULA 5E1OA 3SXJA 1G38A 1Q0SA 1QAOA 1JTEA 5E2AA 3TPZA 4E2WA 4RTSA 5DXAA 1O9GA 3G2MA 5E9WA 5DM1A 3HA5A 3LCCA 1RI5A 1BKYA 2B78A 2GPYA 1L9KA 3LHDA 4GOND 4PYOA 3NDJA 4KVZA 5E2BA 5ICFA 2WK1A 3M33A 3LDUA 5GM1A 1JQDA 3KPUA 4RTLA 3DP7A
chains in the Genus database with same CATH superfamily
3W5DA 4K40A 4PO9A 1HZJA 1VGQA 3RTAA 3SC2B 4LJ9A 1DNPA 3IMKA 2FQQA 2Q3MA 3P0HA 2E87A 3MTEA 4IO0A 4LZPA 5CX4A 3HVKA 3HNPA 3SCZA 1R9NA 1Z88A 2Q6TA 3E27A 3I4FA 1QVAA 1Q19A 3A11A 2XMGA 4NNOA 2G08A 1KEPA 4O1MA 5MN4A 2ZIAA 3FHCB 3VOAA 1ONPA 2IEAA 2HHAA 1W36D 3PXEA 1NVXQ 2P6UA 2NZWA 2VF8A 1SOWA 4BGDA 1O95A 4UUOA 4MDFA 3WLIA 3RAFC 4CGZA 1KMHB 4PS1A 4HDMA 2YVLA 3OA0A 4X9XA 2RHLA 3EF1A 4M89A 5ITZA 1FE8A 1U2DA 3PYMA 4RHCA 3FFXA 3W5HA 2PPVA 2ZBQA 3CVOA 4KREA 1FLVA 2TSYB 3LNCA 3N8KA 4MW6A 3OJFA 4IJMA 2OT3B 4A26A 1TYAE 4LY9A 4UTPA 2PTHA 4IS2A 2F1JA 3V8MA 3VSDA 3U1TA 4CKZA 5IXJA 5L7YA 4M7WA 1SRRA 5T3YA 5AJVB 2HLDA 2XMSA 2E4XA 3DZCA 5C31A 5A7FA 4PY2A 1BD3A 2NQTA 4OHMA 1H66A 2NO6A 4UOQA 3ZDQA 3T9DA 4F7WA 5K7SA 2IOYA 5B3JC 3RYFB 3NBZC 1N7IA 1RRVA 1WULS 2B25A 3BTOA 3BHMA 4Y7CA 3L40A 5IVPA 2KSQA 1S3GA 5EJEA 3KDAA 4H9KA 1S2NA 5A05A 5HGXA 4KQHA 1UK7A 2FMHA 2A2ZA 4FPXA 4GM1A 2PK3A 3VU3A 1UF9A 3ILSA 1V1MA 1F06A 5IDYA 4Q47A 3RLIA 1JEEA 4D5GA 3H11B 5HKKD 5I4CA 4BE7B 5LMZA 1DADA 5I4IA 2O19A 2HSDA 6GPBA 1I24A 2QMYA 2W2MA 3UOWA 3VBCA 1Q1BA 3QKUA 1W85A 1V4VA 3LHSA 4B85A 2I8AA 3MINB 2VTBB 2VOEA 3DZIA 3UWOA 1E2HA 4Q7KA 5TGDA 1JQ3A 2H48A 2FMKA 4HDKB 1NGSA 3I3SR 3RAJA 1SVUA 2ERCA 3AXTA 4TLLB 2QR5A 5KJCA 1NIJA 1ZY2A 3CWCA 3GPIA 3GNQA 3H4IA 4B9AA 2QENA 1A4RA 1LPBB 3I83A 3VGJA 4EIWA 4YGXB 5C32A 1D6NA 2JHCA 4YRLA 4PHCA 3ESAA 5H02A 5HKKA 5M29A 1NJ6A 1AV6A 3WTBA 3LUKA 4Z2AA 2WU3A 1QCDA 4TL8A 1QBKC 3U7JA 4EJ2A 4XVHA 3P9ZA 4XVQA 4FCWA 3QMPA 1FFAA 4TQUS 1VPEA 4JSYA 3ETHA 3OC6A 4AJJA 3HK2A 1C29B 3P97A 5BN5B 4OBXA 4WK4B 2FWMX 1RWPA 4CI0B 3GGJA 5K3BA 1U0TA 2DFDA 4DYDA 4XYLA 6CHYA 4HX9A 2VDOB 1FYFA 4CMCA 2AEEA 2JFNA 2QTLA 4OXNA 4JCCA 4QDTA 3NGXA 4OB6A 3RBVA 4EVSA 4A7PA 3GRAA 4OAOA 4RUKA 4S0XA 2FPRA 5E6SA 2UU9B 2BI7A 2JS7A 2XDWA 2CF6A 2GARA 4OIMA 5DIFA 2X76A 4O4HA 4Q7LA 4W8GA 2FU5C 3JQ7A 4IWYA 2NO7A 2FPGA 4L5BA 3ST7A 4AJ1A 1Z12A 3M6XA 1KEVA 2C31A 2FFBA 1U7TA 3VYWA 3X43A 3OZ7A 4R9VA 3BRWD 2BDUA 1CUCA 1K8RA 3KR9A 1A97A 4PSUA 4BLSA 1ONOA 4E07A 2F1RA 4L28A 2ZPTX 4UPDA 1ZVQA 5EYPB 1Y5IA 5J5AA 4IG9A 1A5BB 3ZI0A 1TD1A 4Y0NA 2OOSA 4D81A 3MJSA 4C4SA 2IEBA 2GD2A 5HEKA 3EUWA 5DCYA 4Z7OB 1G98A 3WE7A 1YA8A 1U9IC 1YRAA 3QBVA 4C0QC 1O08A 1YI0A 3KQPA 4QPPA 1PNRA 4F5DA 1KIFA 1S01A 1P2GA 2EC5A 2YJ5A 4RWZA 3EPJA 4HFMA 1MIHA 4X44A 5C8DA 4DKXA 1SKAA 3AERA 3WMEA 1B8OA 1FNDA 1TQDA 2WTBA 1PJ8A 1IOVA 1MTZA 1MORA 2J9XB 2P9QA 1KE1A 2JLWA 4JIGA 4ZI7F 1R3DA 2ODWA 4OHXA 1DWOA 3KKOA 4RETA 1G8YA 4PE5B 3ZU3A 1GCOA 2NXNA 2HCJB 4RAOA 4B80A 3OBIA 1B73A 3EVCA 3PFWO 1MNQA 2A3NA 4NENA 3PX7A 1MC8A 3CNHA 3ER8A 2IPLA 4ECAA 4FI3C 2CKMA 4DQ0A 3PITA 3FYSA 4MVCA 3VXKA 4DV4B 1GZUA 1LZKA 5DPMA 1ZZEA 3D3EA 4GHWA 2OV6A 4PF1A 2XQFA 1X86B 2GHIA 4EPXA 4EOGA 2V6IA 1T9BA 1HF3A 2VDKB 2XE6A 1WB4A 2ZXFA 4R84A 1ESEA 5AESA 3WA7A 2YJ6A 5F5NA 2HEIA 4AP6A 2R2GA 2YJ3A 2Q1YA 3NKLA 3MHTA 4DAEA 3K30A 3FOCA 4L2IA 2HWYA 4MMXB 5NLLA 3ZOKA 4M0PA 3V7UA 4XWOA 5DNVA 1NOIA 5AW6A 3D81A 4B33A 3TZHA 2PTGA 4JEUA 5GZ3A 2HQBA 2GLTA 2PL3A 3BFXA 3CURA 3IVAA 1HQCA 2C5FA 1V7CA 5K3FA 3OAAA 4CKEA 4HMPA 3U60B 1RQRA 2Q9AA 2AT1A 1RJGA 2HMTA 3I39X 3GAFA 3KYCB 3GJ6A 3MCWA 3RFXA 4B3HA 3SHTA 3V4VB 1C50A 4YRSA 1EG7A 4JX8A 3TFWA 3GOHA 1N0VC 1JKIA 4KG7A 3NTQA 4BJ3A 1ZNZA 3FF1A 4U7JA 3T5GA 2RCNA 3DULA 4LDZA 1OFGA 3CA8A 3WL7A 4YWHA 3HBNA 3P9PA 2RAPA 2VYVA 4AN0A 2PGNA 5KZMB 3AF5A 1ZGZA 5TPWA 1D07A 1W5SA 3M4NA 2J9FA 1HDRA 3X1XA 4QM6A 4FE4A 1MO3A 4R1UA 4U00A 4Y2VA 4B6QA 2XTZA 3I05A 1MFZA 4KH0A 3RSCA 1SHTX 3SBOA 4B3JA 4DLPA 4JJ7A 5LUAA 3QLEA 2JJ2D 3MMXA 2VHCA 1XLTA 2OILA 4D9NA 4ZI2A 1DI0A 3K9FC 1V45E 1MRZA 3KJIA 1EFCA 3ZCTA 1M34E 3JZMA 1O58A 4X93A 1E1CA 2NVUA 2O7RA 2BTQB 2WP0A 3RC3A 3JZDA 1B8NA 3IBYA 4C0HA 1Y48E 2Q28A 3BDIA 3ZE8A 1H2YA 2UXDB 1KYYA 1QCCA 2A0XA 2BHLA 4FYMA 1JLLA 3AUYA 2QT0A 5B57C 2XUPA 4LHZA 1DKLA 3BSYA 5KVVA 1K7EB 4NJEB 5CGZA 3MINA 3PX3A 3R9XA 3AFHA 3W8NA 4ZV4A 1I0IA 1RWQA 2YYAA 3C3PA 3KQTA 1UOQA 3I6IA 1T0PA 1PJTA 4YS6A 3P45A 2P6RA 2D4AA 3HBJA 4D3SA 1G19A 2HWWA 1GV0A 1HE2A 1SBIA 1MOQA 1S8NA 1YNOA 2XVYA 3AQ4A 1JDUA 3K0AB 2V6GA 2AEMA 2GCNA 3DKPA 3IV7A 3KLOA 5CDFE 2XXJA 4UKDA 3ND6A 4UTVA 3DF9A 1GAEO 3OO1A 1GL7A 2XWBF 5DYYA 1F7VA 1NF8A 2NZVG 4REQB 4LY3A 1BYIA 1P60A 1S2DA 1SNYA 4I4TA 1IZ0A 3M6UA 3TPFA 2VNJA 1Q92A 1MKYA 5F51A 3BWXA 3AF6A 3L1IA 3RKSA 2ATVA 1U1CA 1I2ZA 2YZ2A 3QXXA 5A62A 1BRTA 1FW6A 3WK7A 2NG1A 1VP3A 4MVJI 1WW3A 1C2TA 5AUNB 5JT1A 1PD1A 5JDCC 3CLKA 4DR3B 4DEVA 3A8TA 4KZKA 2LW7A 3PEEA 4XQ0A 4YRTA 1E3IA 4XB1A 2IS4A 4UM8B 1CF4A 5JS6A 4JJ4A 4RPCA 3S7TA 5BMVF 3TDMA 1A1VA 1ZMRA 4K05A 4DNPA 3CT4A 3TJMA 4XLZA 5M3BA 3MWLA 4Z8YA 3WFZA 1CQXA 2DOKA 2WICA 3MGGA 4HB4A 2AN1A 4P54A 4YDSA 4F71A 4XKJA 3JAKB 1BHJA 1SEVA 1TW2A 2B7LA 2GJ8A 3ICWA 1C4XA 5LP6A 1CEQA 2GN6A 4H4EA 5EXPA 4EG7A 4DPKA 4DLXA 1N2CE 4EQ6A 3ROZA 1O97D 2H2HA 1KSGA 1PNTA 3KR2A 4GYKA 3NBUA 1RYDA 1DC5A 1X1RA 2H16A 1ABEA 2OWEA 2R5FA 2ZDHA 3F9IA 2G04A 1VCNA 1G64A 2JRCA 5T41A 2G82A 2NZUG 3SM9A 4D3YA 1E3WB 4CNQA 1MH1A 3KTAB 2RFLA 2D5AA 4EITA 2HHCA 1TO2E 3A1EA 4EKEA 4TOIA 3U7QA 4CV0A 5ELXA 3ILXA 4FFSA 1IXYA 4YQFA 4V0ME 1ADBA 1OXBB 1NR7A 3EXHB 4RCYA 1K89A 3DT8A 2OHVA 4P5EA 3HBMA 1T43A 3SR0A 4EZEA 2Y6VA 4FB5A 5KMGB 1N32B 2RG7A 4LOKA 3R8CA 2WUGA 4ZYWA 1Z39A 3C3KA 1NJGA 2WTUA 2RC5A 1JKJA 4RESA 1XPOA 4C76A 1Y34E 2BHNA 2RJOA 2M6LA 3A3KA 1R6BX 3H4MA 1XCOA 3JQAD 3QVJA 1Z6PA 4F98A 3QHAA 4P4GA 2HLNA 4RMGA 3T3GA 2IV3A 4BP9A 3DE5X 2QP3A 2SKCA 4D6XA 1XWFA 3M5DA 1I6MA 4FKZA 4UFOA 5DYTA 3DE0X 3E5HA 1GTL1 4WNYA 2AXNA 2Q5JA 4FHEA 2V0GA 2A5GA 4RL4A 4TVSA 3DL0A 3DDSA 3R4CA 3H05A 3PGA1 3COYA 4AF6A 1NYRA 3HBLA 2R4QA 2C9OA 5ADHA 4GP9A 1K4YA 4TKUA 3LY9A 3ZHUA 1MB2A 4YAGA 1MU0A 2OC9A 1DFGA 2BBOA 2UYQA 1FS5A 3CEHA 3H2SA 2I1QA 2FVXA 3FOBA 4EJSA 1RABA 4M0LA 1D2HA 1LTQA 1KTVA 4UXIA 4CKYA 2ATCA 4WFIA 2J5QA 2WE8A 4FR2A 4U2DA 1W0JA 1O0SA 1QZXA 2GK7A 2JL1A 2NZ8A 2XMPA 2QVCA 1UAYA 3JYLA 3MTBA 1IN8A 5HQJA 4CDNA 1DRUA 4KWHA 5B1EA 1NPYA 4DR1B 3LK6A 4OEHA 2BFFA 3C6BA 5JWOA 2I2CA 1CUUA 1YC2A 1K5PA 4P4LA 2XI4A 1RLOA 1G20E 2R2AA 2ACEA 4H7PA 3ABZA 3C8UA 4I8XA 4KQ1A 1KY2A 1X80B 1ZLXA 3BHIA 1EFLA 2X41A 3EFOA 1VYHA 2X5OA 5CA1A 5K6TA 1BDBA 4QICA 3UA4A 3D2CA 1PFVA 4GR4A 3WWPA 5HX7A 4HDNA 4ARCA 5A4FS 2YYSA 1JL3A 1Y3HA 3OSZA 5CB6A 4CIYA 5IT9A 3NWEA 5JQGF 2I03A 2ZJAA 3A1UA 3BN3A 2WFLA 3U13A 4ZYVA 5FAKA 2WDZA 2DWCA 2W0MA 3IP5A 2HBYA 4KXWA 1BXGA 5A2QA 3PGMA 2QTGA 2CHVA 3DBOB 1L7MA 3B6JA 1AZLA 4NBTA 3OE5A 4TLCA 3T06B 3JY6A 3I61A 2JFUA 4KE6A 4R1QA 2VSOA 3AY0A 1UBHS 4TYYA 4Q3EA 4DC9A 1H93A 4CF5A 4IP0A 2RAUA 1GKUB 3ZW9A 4LOIA 4QJ4A 4XYGA 5U1PA 3A6JA 3PUKA 4F1JA 5CVTA 3TFOA 3CUVA 3BD6A 3QENA 1T9CA 3EC2A 1GUAA 3PQ2A 3RIEA 5GVRA 3PSHA 1KI1A 3GDOA 1OX4A 4UUAA 3S5UA 1P2VA 3GZJA 4H7FA 4XJTA 3FVRA 3PC2A 3TO5A 4QFDA 2H2DA 3RV3A 2VOJA 3GCDA 3VYSB 2FK8A 4TLAA 1E7SA 3OM9A 1E2EA 1P7ZA 3VKVA 1N0IA 3TAUA 2JD2A 3MFQA 1CQIB 2BCGY 2ZM6B 2J5KA 2XNKA 1N5JA 4PG5A 1YR8A 2ATXA 5JCJA 5B6JA 4RPKA 4C7BA 5IC6A 4JDUA 2MYPA 5K8UA 2MYTA 4KITB 1XYGA 3L77A 3TUIC 3WYBA 2A0WA 1AM4D 3HB1A 3KAPA 5JMOA 2R8PA 2I5PO 3IQGX 4URUR 2M6SA 2X7HA 3MD0A 4IXDA 4NCNA 3H5IA 4OUKX 4PYJA 4CT0A 2QBYB 3IAHA 1CE8A 3TOVA 3ZE2B 1R12A 1NLZA 1TTPB 4P84A 3OLCX 1YL5A 4NF2A 4JZYA 1CUIA 1U3CA 3R40A 2P6OA 3A4IA 2X4IA 1K2WA 4GGPA 2GZ1A 6LDHA 2FSHA 1L5NA 2HA2A 2UYHA 1C4KA 1XNGA 1YZFA 2XWJI 3CU5A 5JU6A 4QU9A 1KH1A 3KAJA 2DXIA 4MW4A 2QVBA 1DHTA 1EFTA 1AU9A 2HNKA 3FCOA 1DCFA 2ILTA 2HSJA 2OXFA 4LW8A 3K6SA 1KJQA 5BN3B 4J0GA 1GPDG 4AZ3A 3QM1A 5AKYA 2G0AA 1OBHA 3KLBA 3R6WA 4J16A 2CVOA 1Y8ZA 5IS2A 3FPKA 1GARA 2ZB3A 1B41A 1I2MA 2Y67A 3R6GA 3VR4D 2A9JA 5AI5A 1SIUA 1KXJA 4PZ0A 4W1RA 3FCAA 3EDRA 1LDYA 4YFYA 3TOZA 3D6VA 3C3DA 3EFBA 4MP3A 5JQGA 4RTLA 2JCSA 1R27A 2BL4A 1HORA 4G8CA 4JI0B 2PSJA 4H0NA 2W7TA 3I9KA 4EATA 4D4GA 1QRUA 2E5LB 4C7KA 1FNMA 5BUSA 5A9TA 4D45A 1ZINA 2REQB 1DO0A 3E9YA 4CCWA 2O0LA 5EZ6B 3TCKA 2XE7A 2CUKA 1AK1A 3E03A 3EAQA 4E5NA 3RT7A 2FXVA 1QH0A 4O02B 4MJ3A 1NQXA 4XQ9A 3RFTA 3SYMA 4GXTA 1MC5A 1F2VA 1WUKS 3OZFA 5LCXA 1HXHA 4EAAA 3U7FB 4PCVA 4TLEA 3V8EA 4MTCA 2ZUSA 5KEIA 1OSNA 2EKZA 1QB7A 4BUZA 3H5WA 5AKEA 4TYPA 3ELWA 1NBMD 4LCJA 2F3UA 3FPEA 1HEYA 1NM5C 4MS4A 3SE0A 1KMMA 3HP1A 4IF6A 1PN3A 2PEZA 2A33A 3GLHE 2X0JA 1MQ8B 2IS1A 2XQJA 1DIGA 3CISA 2VT3A 4NG5A 3HBFA 1L5LA 3OZIA 1VMIA 3AXSA 1WETA 4UNSA 4QOGA 1E62A 4JT9A 1IWPB 3TKLA 1VA5A 1KYTA 2G3YA 2JARA 2Q29A 4I6EA 4B75A 4MGKR 1TJYA 2BFPA 3D7NA 5B2EA 4Y6LA 5BQ3A 2XIJA 4O1HA 1ZO8A 5IK2A 1EHYA 5DX8A 5K0FA 2I2BA 4FB4A 4TWZA 4AXXA 2E6UX 1NQWA 2VRBA 3UATA 4QYSA 2I65A 1QYXA 2QZZA 2ZS7A 3J7TA 1Y7LA 4FNOA 4R7TA 1T8WA 3PIIA 4GX0A 4LHSA 4KQEA 4M9QA 4P4SB 1KVQA 2H52A 3G49A 4FGUA 4M9XA 1ICEA 2WJHA 3DO6A 1UK9A 5HS6A 3ROPA 2N42A 1OGYA 2XCIA 2FKAA 1QH1A 3MT7A 1ONNA 4G8DA 5HJ2A 1SN7A 2UZ1B 4AG6A 3WGVA 1O5OA 3JR7A 3TOSA 4DGSA 3IXQA 3IEVA 1GPYA 4MK4A 1XD2B 2WG1A 4WADA 2TMKA 4JUAA 1OHHD 3FZGA 1TQ4A 3QW4B 5ER6A 3BWYA 1XNHA 4FD3A 4I4LA 1EUDB 4PFSA 5YASA 1WZEA 1XZNA 3KWMA 2IBSA 1HRDA 4P08A 4P81A 2VPWA 421PA 1E9RA 3U4GA 4QDJA 2BUCA 1GZDA 1ZUWA 1NQUA 2ZRQA 4MO2A 5ERGB 1QM5A 4WHMA 2GYYA 4K6KA 3BG5A 3BEOA 3TQFA 2JGRA 4AUNA 3LDFA 5FX2A 1R5BA 4UNIA 1Z2NX 1YKSA 2Y9MB 4L4ZA 2E21A 4OQNA 1KMQA 2E85A 1GKIA 2XXBA 4MINA 5ERXA 1Q95A 4NE9A 3UUWA 1YQTA 4BNXA 1QKKA 1VFNA 4GYJA 4MUEA 4BDSA 4KMRA 3BHJA 1PFQA 2VJBA 3ZXYA 4NK4A 3CLSC 3HGMA 4RQTA 4D8YA 5K03A 3KZNA 4XD7A 1XC7A 1Z26A 4UFNA 1LVGA 1GRVA 1G5IA 3HKCA 4BVHA 1Z37A 5EQTA 3B1ZA 4LGVA 1PL8A 1Y1SA 1CD5A 3FXAA 3IOYA 4GM0A 1NW5A 4PYMA 2I1WA 4ANFA 3K2BA 5HE9A 3DMHA 1ZK4A 2BKEA 4N65A 3DOHA 5IBPA 4ZO8A 4D9EA 5HUHA 4IIXA 1DXQA 1NOKA 2HV8A 3N3BC 3VI3B 4XVUA 1KQGA 2OHOA 4RXUA 2DC1A 4JBNA 2QTWB 2I91A 2QM8A 4WX2B 3ELDA 4E3WA 1GQRA 3JYOA 4I4TF 4JXXA 2L2QA 1NUHA 1YDEA 4GWGA 4MYTA 4QODA 3OU2A 4S1TA 4OO3A 4X1IA 1NVWQ 1UJMA 1VG9B 3OJ0A 4WK2B 3ZQ4A 1OLXA 3BUSA 3QHQA 2F1HA 3DLAA 5HF8A 5KYKA 3SS9X 3TBHA 3ZQKA 1TF5A 3IBFA 1OH7A 4Z4EA 3UJ9A 2Q1TA 3M4ZA 2DPHA 5BXQC 3VNVA 3VR1A 1HUQA 1T2UA 1HV8A 1T26A 1G6OA 1AKEA 3QLVA 4TSFA 3DLBA 3R9WA 1N6KA 3IMFA 2PE5A 1YI8A 1VHQA 2HRRA 1J7KA 5DTQA 2C2OA 4XEHA 4URFA 3K94A 4OHZA 2ZULA 5FNVB 1U3DA 4JLVA 1RWOA 4ZQCB 2Y1DA 4JR2A 3KTDA 2RKWA 3PXAA 3PQDA 1HQKA 3IEKA 1TQHA 1DKPA 3ZLUA 3GEPA 2X9QA 4OYLA 2YN4A 3RUFA 2WFMA 4WL0A 4AP9A 3LXXA 2ZK7A 3QQPA 3QSYA 2Y93A 2MOKA 2Q7DA 3PNLA 4TV8B 3UW3A 2WKWA 1TL7C 1UM9B 4RD2A 1XV5A 1VCMA 5TE9A 2XX3A 4K3UA 2WJJA 2C8LA 3DTVB 3KO8A 3LPMA 4EHLA 4YRMA 3O8CA 3LUDA 2I6FA 3RSOA 2OP0A 4AC9A 1XMVA 2ZI4A 2J09A 4QJBA 4JC8A 3D3KA 2DM6A 3GWZA 1KXZA 1T2DA 1Z08A 5CH3A 5B2ZA 2WJ3A 3TQTA 5ES4B 5KTKA 1Z7WA 2R44A 4W5HA 1E61A 1U5CA 3WSTA 1PTKA 4ZZIA 4OI1A 5JS7A 2ODEA 3N5CA 1AMUA 1PT8A 1S2LA 2CVHA 2WP8J 3DBRB 3A4MA 3PI7A 3RVPA 4W82A 2M6KA 1NJ8A 2CNLA 3ESRA 3LPDA 5CG1A 4CU2A 3N58A 2XD9A 2SNIE 4D6YA 1ZVVA 3Q7PA 2IXAA 4GNKA 4WFJA 4YJHB 5FUVA 1EFDN 4DDVA 4C3ZA 3FDJA 5B7NA 5KNDH 1XEFA 3B2EA 2M1XA 3KB1A 5AJTA 3TZEA 3ZHXA 4F4DA 4PC7A 5DM2A 1Z5ZA 1EGVB 2QKYA 5IEJA 4XFJA 2IYAA 3GRPA 1IZ7A 3TRFA 2BSQA 1MJGA 9LDTA 3ZOZA 2PZMA 1JAZA 2DY1A 1EU1A 2FLWA 1N57A 3DV9A 1P5RA 2GVZC 1QCZA 4HYEA 2YS6A 4KR3A 4HV4A 2ZEJA 3IDQA 1V96A 4CXMA 4ZOCA 1WHTB 3BD8A 1UQRA 3NVMB 3A1TA 5FBLB 3N76A 4FVTA 3QOXA 3C6YA 1WXQA 1E2QA 1H2WA 1Q57A 2JEZA 2Y77A 2N3ZA 3U4QB 1J5XA 3OQIB 5K0NA 221PA 4B4UA 5JAOA 4X8OA 1VPLA 4FHGA 1QMGA 1DT5A 4IY1A 4L15A 3FPLA 4PAWA 4Q1BA 2QQEA 3RWOA 4BO5A 1ENPA 1GZVA 3EUEA 1I4LD 4R1OA 4X60A 4IRMA 1K68A 1NVGA 5L3SB 3V2UA 3D4BA 3HG7A 2GTIA 3CNOA 1XHEA 3H0KA 2WUEA 3PKIA 1LY1A 4TUYA 3VNRA 4CG2A 4DV5B 2CDCA 1KJJA 3MFYA 5FO0A 4F12A 1ISRA 4CMEC 3EIOA 3T7AA 4YCJA 3MRTA 1TDJA 1LGYA 3I04A 2XMRA 1J0CA 4HNHA 2D2VA 1BEUB 3ZW7A 3NH6A 5BSTA 4HN9A 2XUQA 3U40A 1SUIA 1YHYA 2EFDB 1HG0A 1P45A 3Q3JB 1M73E 2Z2XA 1X3SA 2X8JA 3CZMA 3BRSA 4EY4A 2FLVA 3RSQA 1QK3A 2NXEA 3BQMB 1ZOLA 4QBFA 3H97A 4Y2YA 3NXKA 3N2KB 4JU8A 4XSHA 1C3OB 3TM5A 4WOPA 1RXVA 1UCFA 4GZ5A 5DBFA 4OP2A 2B69A 4EGQA 5D86A 2YKGA 1ADYA 1YC5A 2HBRA 3EMBA 1BW9B 1C41A 2AUNA 2CZCA 1GGEA 1HEUA 4PCLA 4EARA 4POOA 3SDBA 3SQWA 3QLJA 5ED4A 1VHLA 3ASZA 5LP6C 4YQEA 5E2IA 1XZDA 2AC7A 4MYSA 3W1VA 2P5TB 1KO5A 1U8AA 3PGVA 4JUIA 3GD7A 4FDMA 2UZIR 1JPJA 3OEWA 1LPOA 2EF0A 1NNI1 1W88B 3RVSA 4XGNA 4DMUB 1A2BA 2CBZA 2O2YA 3CZCA 3OECA 1SOUA 3GP8A 4HWTA 4QWMA 1D2NA 4AECA 4DN6A 5K45A 4LRYA 3IT1A 2HPAA 2BKLA 4FJ1A 4OHFA 4IMJB 1VIYA 3VTFA 4DXHA 5FUMA 4NARA 4C9BA 1Y9EA 3SQOA 4BLQA 5L51A 1OREA 1TFUA 1OLXB 2JFZA 3WL4A 4D8XA 4AZ0B 5KOJA 2MSEB 1H65A 1OFTA 3FFTA 2OB1A 4DBLC 4QVKA 1YS9A 1SZPA 4QPZA 5TDHA 1JQLB 4N0QA 4ROSA 2PZJA 4H1UA 1DRVA 2OA0A 1T6NA 3CJQA 1GP2A 3ETNA 1XJCA 3TINA 2VQSA 4FBGA 3UAXA 4YAJA 1X19A 2G6BA 1F20A 2ECOA 2IZ1A 2X58A 2UZAA 1JE1A 2CNKA 2D13A 3SVZA 1ZISA 1IJFA 1YF3A 2PWBA 3ESYA 2ZJ4A 4QGGA 3VVCA 2XUZA 3PC7A 3R9KA 4CM9D 1RWXA 3FMOB 5KCMA 3ZCVA 4QQKA 2O0MA 5JSKA 2GCOA 1A82A 1Q44A 3RT9A 1RXEA 5BY2A 5AVSA 4EMTA 4EDHA 3VISA 4Y6GB 5LXTB 1WA5A 3GBPA 3VMMA 4ETIA 4QOEA 3GAMA 1RPTA 2G83A 2VJKA 3PTLA 4WNAB 4R0VA 3KKKA 4C5CA 4EHIA 1Y3BE 1QOQB 1FQWA 2IUYA 1OGJA 4R2WA 8OHMA 1ZP6A 3E5RA 1QFJA 3UCEA 3GJ8A 1IXSB 4MGHA 5DT2A 2AN5A 4NZOA 4L0DA 2QRLA 1P4HA 4BPBA 2E6KA 3DYIA 4JH0A 1FPQA 5EXDA 3PDJA 3Q0EA 4CCYA 1QVVA 2NTYC 4OGGA 4TX1A 3IURA 3UFXB 1VSUA 3FUXA 3L02A 2A14A 3NAZA 4OJTA 1B3BA 4MI6A 4OHKA 1I7NA 2XB8A 1JA9A 3BD7A 1IHXA 4PIMA 4ZOLB 2G1JA 2OMEA 3RUIA 2QE6A 2AOWA 1Z3IX 1EB8A 2B8WA 4JI8B 2W8ZA 2WTAA 2WT8A 2HN9A 3UMRA 1R8JA 1NVUQ 4G1UC 3S40A 4CFZA 4EG8A 2F3RA 4L02A 1KZGB 5TIIA 2B4AA 1C9KA 2PMEA 3DV0B 3NTOA 2DHRA 2P2SA 2VPXA 1X13A 2KE5A 2NUBA 3MWDB 4QXMA 5G40A 5KAMA 3DHEA 4K6MA 2C0PA 4NMXB 2QAIA 4S05A 5FOTA 4DVGA 1GRCA 3GUCA 4PPFA 3BF8A 3FWKA 3IVGA 3FPJA 1EJ0A 4QTYA 1D1TA 1W4BA 2HRZA 2GAOA 1ACLA 1KDZA 3ZZ1A 4MA5A 1LX6A 1WHTA 1ZA1A 4OXQA 3EXHC 4LZWA 5TB5A 1U0BB 1WPRA 3RCBA 5KBYA 2V5AA 5M34A 3VZDA 3VR2A 3DQQA 4CVNA 2IL1A 3FZQA 4AQDA 5THXA 1JDNA 1PR1A 2PJDA 3HNRA 4RABA 4IQ0A 5CTAA 3OUZA 3IPAA 3BFJA 3ML1A 1G6KA 3FDFA 4JA2A 1BQ3A 1NW7A 2GN9A 1D6SA 1RPNA 2P3OA 5CH8A 3ZH2A 4CDGA 4LQ4A 5JNTA 3BWVA 4W5QA 4XCXA 1PX0A 3U0BA 1TM1E 1VQ1A 3JQFC 3AOGA 2VYCA 3GXOA 3K4HA 3EA4A 3TQRA 1Y1RA 5DTEA 2CXHA 1P81A 3VYUB 4EY6A 3QE2A 3ZLVA 2O8BA 1ORVA 3RS5A 5A4AA 2ZIVB 5ALUA 2WU1A 3AILA 1U8UA 3Q41A 4QPNA 3MYYA 3PXGA 3MRSA 3EWNA 2CMHA 1UJ2A 4BLOA 3L7IA 2XYVA 1HE4A 2RAFA 1YV9A 3BORA 3MZ0A 1T15A 4C4YA 3GUZA 3MCTA 2YIDA 3N87A 2C9ZA 2G76A 2GCPA 2JAXA 3AL2A 3N0XA 2OHIA 1LS6A 3W2GA 4B87A 4UQOA 3BQNB 3DAFA 2HU8A 1S6YA 2WU8A 1BHO1 1BW9A 2WV9A 2YMMA 4OQPA 3EWAA 3V80A 3TIFA 2BJWA 3VHQA 1D2MA 4BC1A 5NULA 3EY4A 4DCTA 2JGAA 2R5WA 2E4VA 1XRLA 2QRPA 2II6A 3KBOA 3LLSA 4E5DA 4ZU1X 1IB6A 3OLYA 4KCGA 5EOVA 1EJ6A 3BSSA 4E6PA 4UTXA 2AZ4A 2VJNA 2NTNA 3AR6A 1U0OC 4EGJA 1UMBA 4TXLA 5DB4A 2H2AA 4JWTA 2HU5A 1TTTA 2OO3A 3LT4A 2GYVA 2IZ5A 3TLZA 3HA3A 1SURA 3WRYC 1PIWA 4EYSA 3ZFRA 1E3QA 5AWFC 3ZX4A 2I1VB 1GN9A 2YNMD 4N3CA 4JYZA 3TTVA 4P4TA 2QYTA 1DAKA 4JI7B 2PIAA 3LT2A 3UV7A 4CLRA 3SS8A 1JHQA 2DRIA 2C7GA 1KF0A 3TNFA 1NV8A 4TKVA 3VYTB 4FS8A 4D82A 1OB5A 1I80A 4GMGA 3T54A 4YR9A 3Q87B 3OOSA 4FHZA 2NU9B 1KJIA 2P9BA 1E6WA 1GG5A 1TIKA 2SKDA 2CYBA 4H7JA 4DLKA 1DAFA 2Q5FA 2R7MA 2BELA 3F49S 2G07A 3S1LA 1Z8HA 4LJ8A 1J00A 4DABA 2C3UA 3R3YA 2X86A 2HDHA 3FMVA 4W5NA 2A0KA 1XVTA 2C9CA 1K06A 3FH0A 3HA5A 3LCCA 3QPUA 1THZA 4PYOA 4YMUA 3ZLJA 1RWKA 3NTXA 1QU2A 1FP6A 2OQIA 2ZATA 3VU0A 2ROQA 4EX7A 1CUBA 4UZEA 5GM1A 5EHZA 2J0EA 1X2BA 1YOVA 4KE8A 1IEQA 1L4NA 2OBNA 4FFMA 3QF7A 4Z3OA 3J81k 5DYNA 2GK4A 4B2LA 5IJXA 2HHJA 1EP1B 3SG0A 4V0RA 5JHHB 5DU2A 3GNLA 5HQ3A 3JZIA 1BXZA 4OGFA 2DFNA 3Q4GA 1U04A 2G8NA 1Q17A 4CV3A 1WKBA 4EHNA 1FXUA 2XUOA 3AW8A 4PYKA 1WZ2A 1W59A 4F4CA 4DBLE 2PRZA 4KGVA 2IT1A 5MGNA 1E0DA 3DLPX 1CS0A 1NAIA 4DA9A 4DQUA 1T6YA 1ICIA 2FHPA 3DTNA 4J1SA 3H75A 2K2QB 1T2NA 5C37A 3BILA 1NN5A 2X3UA 1M33A 1Q14A 2DE0X 1B23P 3BKWA 4U2CA 1TO1E 2HUNA 2Z56A 3QIAA 5LC1A 4A2CA 3DE3X 5I4KA 2AA3A 5G4LA 3HUUA 1X92A 2WJAA 1QIDA 4FFLA 1FDSA 3HXPA 3LFUA 5ALTA 2H7YA 5LOVB 1ZN7A 3UCXA 4MWGA 2Q49A 2FWIA 2I8LA 1XD9A 3DQPA 3MAJA 4FYVA 4PRYA 4QPDA 2H59A 2HKIA 2QTBA 1XCMA 3VJKA 5BR1A 4M22A 2DMRA 4WBNA 2Y66A 3RG8A 3AJ9A 3OO0A 4K28A 3D3WA 3RU2A 1XMOB 4LAFA 1QGAA 2W6PA 1P2TA 5TQVA 5MN6A 4JJ8A 4NBUA 1GCGA 4G0NA 1M1XB 4P5PA 2PGOA 4BGUA 4LRWA 5FWAA 2RHOA 4IEFB 5ARDA 4ZK2A 2EATA 2NZYA 4LQCA 3D59A 5ETJA 5EUMA 1QKIA 3WL3A 2D0DA 1YQGA 1V3UA 3N2GB 1QOZA 2E4ZA 4FKMA 5GONB 5LQUA 4KWIA 1IBRA 2AMJA 3WP0A 2ZPAA 5FKJA 2N75A 3EB9A 3LAWA 4X1KB 4EYOA 3PHGA 3R9XB 2JC3A 4B6EA 2F67A 2GJ9A 1PDVA 5I9SA 4F92B 3Q9NA 3FA2A 1KEUA 3RWMB 1WRBA 2FK7A 3CM0A 4IDOA 4DUGA 4LJRA 4WXRA 5AUOB 4MB0A 1UMKA 1CQPA 2DF8A 2YXLA 2EL9A 4IHJB 4DMRA 3HM9A 2OAGA 2Q2VA 3OPYI 3DTYA 1U7OA 4HLUA 3EF3A 1VJCA 1JALA 3NHZA 4H7DA 1OYOA 1QTRA 4O4JA 4DM4A 2JAHA 2PLAA 4O29A 4AT1A 1CT9A 2CLLB 4KACA 3R6TA 3KSRA 2QK4A 1T5HX 2Q3JA 5DHRA 1QTQA 2PUGA 2E1PA 1DX6A 1KYQA 2CZQA 1BIFA 5IEBA 4RYLA 4YONB 3Q7EA 3PI6A 4YNBA 5EWLA 4JJ6A 5F3RA 1R0BA 1JZQA 5L3ZA 4IMRA 2XRYA 5B4VA 1P5ZB 2OGTA 3B36A 3BCSA 4KQGA 1MHTA 1J20A 2B2CA 1EWYA 2A1IA 3IIKA 1HDZA 5A0TA 1XQYA 1ULBA 4XUDA 4DG9A 2AOTB 2YWRA 2OD9A 3BL8A 2CKDA 3KXKA 4DA8A 1O94C 5G1PA 2H3EA 4JR1A 3B9PA 4QYMA 2LCQA 5FPPA 2K7FA 4MYDA 2O7NA 3TUJC 2XY4A 2PBFA 3N8NA 4M1TA 1SXGA 1K2VN 3ANMA 3JAKA 4LI3X 1OB2A 4ZT3A 4WNIA 4L75A 5EP4A 1IZ8A 4O2LA 1LRKA 5IXYA 3LUFA 4XOIA 4J76A 4YP9A 1YIDA 1MP0A 4K9DA 2B2XA 3DF7A 4IUCS 2K6GA 2Z08A 2BEWA 1U2QA 1C4OA 3C3AA 1Q2UA 3DHWC 3O9ZA 1OR8A 4QPJC 1GQQA 2OE2A 4C4PA 5IVKA 4C88A 3RJ9A 4DSZA 4LHXA 5JY6A 3CBGA 3ORSA 3AEQA 3S2IA 3EMKA 3SOZA 3NI2A 5JYEA 3DO5A 5HKOA 1MB3A 4KYUA 1DJPA 4RK4A 2GA8A 2JHAA 1DIRA 1U2GA 3CLVA 3U7QB 4YHHB 3NBQA 1GTRA 1OFUX 1P1IA 1X9IA 3DCNA 3JYQA 1EXWA 2V5UA 4NBNA 4OKIA 1BMTA 1ZH2A 1OLUA 1ZIDA 1Q7CA 3EIWA 5JD6A 3U62A 1NXOA 2I8CA 1Y3DE 2I71A 2XCOA 5BVHA 4RKYA 4RHFA 4KN8A 5CFQA 2QLMA 4L9WA 3RODA 1ULZA 2E55A 3OZUA 1HT0A 4U2BA 3WYEA 3TLBA 5PGMA 4Q4HA 2KW5A 1M8PA 4MJLA 4KHZA 1AIPA 4MWCA 3SSMA 3CVYA 3IQIX 4GYYA 5BW5A 4K7JA 1MN6A 1YJXA 1SHZA 4ZVQA 4YCBA 1VL8A 5FBKA 1A9OA 1JG4A 1Y5LA 1GITA 1ZKDA 3TTXA 2FR0A 4HY3A 4BBZA 4OH7A 2OKGA 1AD2A 4DLZA 4CLEA 4J7CA 4S2EA 3U39A 1A8HA 5K3FB 2YJZA 2VDMB 1W1WA 2QU8A 4L6IA 2HWUA 4NMMA 3WWCA 3T7IA 3PEYA 3VFDA 4D74A 2I4IA 3ELBA 3FIUA 1N33B 2IH2A 1T5SA 3PFNA 1RZVA 2PO5A 2VP0A 2BGNA 4I2NA 4Y8VA 1CLEA 2TMDA 1R1DA 5TF4A 3BULA 4OUDB 3ZTWA 5TQJA 1UOEA 4C05A 1EFPB 2P2NA 3DCYA 2D7CA 5ALIA 5F3DA 2J9FB 1WMFA 3NP9A 1XLVA 2IXGA 4BNHA 4E14A 3PUIA 2VXOA 1LVHA 1CNFA 3KFLA 1I1NA 2QMOA 1T2CA 4MVXA 3ZY5A 1T5IA 2CNOA 5HBRA 1VBKA 1E96A 2ID8A 1SB9A 4IM7A 4M21A 1PJRA 2GJ4A 3M9XA 5J5CA 2FPIA 3ANLA 3CXRA 1NZFA 2DERA 2EWWA 3GLTA 2XJ9A 2PSFA 5CNJA 3UKJA 5CRIA 1APBA 2VBCA 1ND6A 1Q0UA 3TLMA 3M81A 2NVWA 1MDFA 5CEEA 4MARA 5INTA 4DYVA 4ITVA 1NW3A 4PTYA 4RVUA 1LF5A 1YDMA 3A4YA 1CU1A 1SC4A 4S2UA 3ISJA 1U0FA 5E3HA 2AUTA 3AM3A 4EB0A 1JNXX 4NJEA 4LE0A 4BY9E 2LDBA 4IDAA 1KAOA 5IZCA 4OQZA 3LBYA 3LZ6A 4HNSA 3E81A 1E79A 1GG2A 1ORDA 2VRNA 4C03A 2WWHA 1Q3HA 4F4JA 4ZRDA 1RQNA 1WXDA 2BMEA 3B9RA 4RKEA 4V0KA 2HAEA 3CW2A 3EUFA 5SICE 5IT4A 3E1SA 1E60A 3O38A 1X8KA 2R751 4IHJA 4D9KA 5KNDA 5ITVA 1F8FA 3K0AA 1K9SA 1UDXA 2DFKB 1YCFA 4F2WA 3O7WA 621PA 3PHJA 3ZDRA 1P7WA 1KETA 3CZQA 2UV8A 1YRLA 2BMWA 1CDZA 3QI2A 3NR2A 4E09A 1GA1A 3ZV6A 2GCIA 1VA4A 3OHMA 3UJ6A 1QS0A 4ER7A 5FYDA 2R9VA 1KO1A 3AUUA 1C5KA 3EH1A 3ETJA 1KQNA 3BRWA 3WWZA 5A03A 1IK6A 4ZOBA 3PVSA 4M99A 3NQ41 4JGGA 3V4OA 4ZPJA 5EWLB 4GGMX 1DC6A 3P26A 4G1VA 3OC0A 2W00A 3RVKA 2XHEA 3IRVA 1E98A 3W6PA 2AIRA 4M1MA 2DSNA 5K4AA 4CQNA 2PU7A 2AEJA 2ZRDA 3MUEA 4G89A 2AOTA 2OUKA 2WSSD 3I0NA 3NIBA 1ZM3A 3OCXA 4ITUA 4LVUA 4OP3A 5E4FA 4BGVA 5E6RA 1HR0B 3GFVA 2FG5A 4JL5A 5AKJA 3NHLA 3I30X 4ENSA 4PSDA 1XD8A 1IDOA 1L4FA 3PDIB 2GASA 1RPAA 3C7DB 5CYGA 3U9SA 2ZT8A 1DTEA 2QPLA 3D1LA 3MWEB 3PQ6A 5K4HA 4LX0A 4UD2A 2PUEA 3A6DA 2VH2A 1PVDA 1NUAA 4NH4A 5AK0A 4B0PA 2JGMA 3I2HA 3L0ZA 1KY3A 3F46A 4L7VA 2OM6A 4OFXA 3WKAA 5I7VA 5BN3A 5EIHA 2C2ZA 1AA6A 1F14A 4PPNA 2QAGC 1N5KA 1YZLA 4P7GA 1ULAA 2VUHB 1IC6A 2WHPA 2Y6UA 2HF8A 1AS2A 4MKZA 4PQEA 2BF4A 5TR9A 3U4MA 2D0IA 4OL0A 4D8TA 4Y2RA 2JLVA 3KZVA 1E4OA 5LZ7A 2CDRA 3ZLBA 5JR3A 1IRIA 2QTNA 3AIOA 3VU9B 5FEMA 2WMYA 3LDHA 3AR7A 2C78A 1GNQA 2OYCA 4QJ3A 3IO3A 4MI3A 2FN9A 3EXHA 3CUYA 1JEAA 4DPMA 2UUOA 1RHMA 3U17A 3O4RA 1IWBB 4FYKA 3RVDA 4YUAA 1USGA 2HXYA 4QULA 4DGQA 5KYXB 2NW6A 1LV7A 2GESA 1DC4A 2YFHA 1YB5A 1E63A 1PR0A 2IHJA 2Z09A 2SICE 3R7BA 1JKJB 5SY9A 5C1IA 3RC1A 3C74A 1QRAA 1JVSA 1SXJA 2BEUB 1RHRA 1TTQB 2FP4A 3LYUA 1E7MA 3PE6A 4ND2A 4UBKA 3TGLA 4PLTA 4HNRA 4EA7A 1FJ2A 4UU8A 3C5WP 3T3PB 4G4JA 1EK0A 2Q5EA 3F98A 3FNRA 1CDDA 1DG3A 1PR4A 2UKDA 2Z0MA 5K1ZA 3EVGA 2X77A 3WAGA 1NV9A 1TZJA 4ZI3A 4A0SA 4AMBA 2JFPA 3BCUA 4TT3D 1MA0A 3K72B 4Q00A 3AR5A 3MRVA 2XT9A 4FNAA 4BDTA 1LBEA 4YEDA 2EEPA 1JG2A 4KDFA 4EI8A 1SXJD 4EHHA 5DSXA 2LUOA 1JI0A 1W8IA 3EGDA 1BMFA 2C9MA 3E9CA 4RIGA 2JASA 3ILHA 3S3TA 1Z5PA 4YPFA 3UH0A 3QWBA 4I8DA 4QRHA 5G0WA 5HTKA 4B3CA 4EMBA 5KOIA 3GLIE 4MVJA 2AKYA 3QUBA 4MI1A 1GG8A 4QFBA 2PU5A 1JTVA 2GHQA 4E5YA 4YP6A 3EX7C 3SIRA 3ICVA 1R10A 3PNOA 1UPFA 3S2SA 2CMFA 1EA7A 3LG2A 3WWEA 4FE7A 1NDUA 5H3LA 1YZHA 1IUPA 3EXFA 3FFAA 4WOBA 1GFZA 2WJVA 3ISVA 4DM3A 3MELA 5J1TB 4ZJYA 2IZOA 1K75A 3MG9A 5KVCA 5BWCA 3VAAA 4RPJA 2PZ8A 3NHPA 3TJZA 1CW2B 3QP9A 4MKGA 1PJQA 4RY0A 5FD8A 2IP1A 1Z7GA 4YRDA 1RADA 3AEXA 2C82A 5JE8A 1N7JA 4GKAA 5KREA 2AH5A 2V98A 5IC4A 3T94A 3VO1A 3BGSA 3L7AA 2PG3A 4RVOA 5H83A 1OE0A 2QZ4A 1QGOA 2BKXA 1VC2A 2FWNA 4IKEA 1WEKA 2HT1A 4FFBA 4DPLA 2DHDA 3R5HA 2QW0X 1UINA 1O95C 2FCRA 1J25A 3E58A 4ALLA 4KO1S 3IRUA 3K1AA 4MW2A 3EWSA 4XQEA 4ZHSA 3LBHA 3ZCSA 5FWYA 3PUJA 3A04A 1FUYB 4TRMA 1FS4A 1YZKA 4BJ6A 1N5DA 1E4YA 3BWDD 4B82A 4EF5A 1KTIA 1AURA 4IVNA 1BMQA 4MWBA 1L6RA 5BMOA 2AE1A 3AINA 3WO0A 5LA6A 2JGKA 4BIIA 3PXCX 5C7IO 1DZ3A 2KBFA 5J4LA 5TS3A 3QKRB 2AZDA 3OKFA 3RYCB 4KR2A 2G63A 1G2PA 1AUXA 2AEFA 2QB5A 3TX2A 3HSSA 2EP7A 4Z9FA 1N34B 2BZ0A 3TNLA 1T8RA 3A7DA 2HB6A 3IAS6 4JYAB 4CCSA 2CMDA 1K5GA 3FSJX 1IPHA 2QQGA 3PV0A 4MDYA 1DS6A 5KJ1A 4PC6A 1Z4MA 3C45A 2RHDA 1C1DB 2DECA 3PBKA 5KPJA 1HGXA 1ZNYA 4IGEA 2X2EA 3W04A 3CCCA 4QATA 5F2OA 5FFFA 4TV9B 1CJSA 3C5CA 3KQUA 5DGXA 1F48A 1G8MA 1LK7A 2GF2A 2HA7A 3NBAA 4BVBA 4ZTUB 3VPBA 1W2WB 4EL0A 2J4CA 3O4JA 5CDFA 1QONA 3V1TC 3PU6A 5FQOA 3NDIA 2G4CA 4G5SA 3GJ4A 3IVMA 3H5TA 3BH6A 4BAGA 3PF8A 3U2QA 1EXDA 2EW1A 2C00A 1FFHA 1FSFA 5C8XA 4C7OB 4HLCA 3C5HA 5FJIA 1RRKA 1MJNA 1XJWA 3MQ2A 3QBJA 4BNDB 3R3UA 3RS2A 3TVDA 4MRNA 2HA0A 1WS6A 4UPVA 1RYFA 3NHKA 2ID7A 2P67A 3GVHA 2I6SA 5IAJA 4ZMRA 4CUZA 4R8LA 1ZD8A 5KJEA 2JFBA 4DG5A 4Z1MD 1LU9A 4RK0A 3RSFA 2ZYHA 3I01M 3E48A 1IAQA 3QEJA 2H1LA 3DLHA 1TKAA 4OLFA 1I6LA 1NP3A 1PEDA 1JBKA 4QBKA 5ECYA 4BMZA 2BBTA 4L95C 2IF0A 4R9NA 5DN9A 2H65A 1E7WA 1OXXK 2GPNA 5TARA 3TPZA 1ODSA 4FHCA 4URZR 3TQIA 1ZHOA 4EX6A 1YKFA 4TLMB 3ZQUA 1Q5PA 3GLFE 1RAIA 3H7AA 4BQEA 2DFPA 2ZI9A 1I4OA 2ERYA 3F8WA 5DGTA 1UKBA 4WFQA 4KLZA 4GL2A 4RA6B 1F2TB 2PZLA 1Q16A 2R84A 4F93B 3C24A 2G9QA 3DZKA 3ZDFA 3TGWA 3WHIA 2J7PD 5IBRA 3I9V1 4K1LA 3KHUA 4IL5A 2HHLA 3RU7A 3THWB 1OOEA 2PRSA 2YUTA 3F9CA 1WCV1 3N75A 1CY2A 3P20A 3C97A 1TPZA 4NV0A 1E64A 1FFWA 2WHEA 4WKBA 1QPZA 5JNLA 5DNCA 2POQX 3VNUA 3P27A 2XQGA 1MJHA 1ZJJA 5F3WB 2H1VA 1HH4A 2YUIA 3OQ1A 4TTRA 4GPTA 1BKDR 4MQBA 3GDFA 1V11B 3Q5EA 3Q7SA 3QPAA 3U56A 3K0FA 4B3FX 1E77A 1VKRA 2IXEA 2Q9BA 4AWBA 1CZRA 3SQNA 3AZQA 5DP2A 4L78A 1NBOA 5JALA 3HXQA 3GT0A 1DRWA 3MSXA 4PRLA 2V7WA 1QKJA 3GI1A 3RASA 5CG2A 1IUKA 3M4JA 3VPSA 1O6BA 1E2KA 4HEA6 4Q4AA 3EGIA 2VQ6A 5BNWA 1M2NA 2JIOA 3SVLA 3E35A 3RIHA 3MC1A 4KO2S 2IGBA 1BJKA 2WPNA 4J0JA 2XRMA 1FZQA 4UQLA 2PRJA 1E59A 4I5EA 4BRWA 3U81A 4B3XA 5JCZA 5GIOE 1OTHA 1WL8A 1C81A 2WF8A 4RIIA 5KYUB 4V3BA 3UXEA 4RTKA 4PQGA 4O3FA 1FSZA 4QG3A 1YUMA 4LWOA 4KNYA 3TG2A 3WGUA 3OLVA 1CB7A 4IPTA 4QTXA 4PNEA 3K70B 3EJWA 3EEOA 3OF3A 2NSHA 1ITZA 2IEIA 3WYAA 2HW8A 4BASA 1U0NA 2X40A 2ZI7A 3PWTA 4DIOA 4F3TA 5HF5A 1U8EA 5D2CA 2YXDA 2X7JA 1JJ7A 2QN9A 1KFCB 3OZSA 3JRWA 3D4IA 5EI5A 4CT4B 4HWOA 5B1IA 1SH7A 5L7TA 3N2ZB 4B8YA 5CITA 2C5GA 4RD3A 4BB6A 4Z51A 2VPTA 2EFJA 5JI3E 1XF1A 1G16A 1T3GA 1MDBA 1QQ6A 3MEQA 4A9AA 2FSSA 2UDPA 2GFHA 2OXRA 5CD1A 1QV9A 4ZT6A 4C07A 5IG2A 3TF5A 1DBRA 5DBOA 4FWIB 3A1FA 4JUDX 1OZ0A 3FLBA 4FEEA 1DBIA 4LDRA 4LN1A 2JFVA 4Q34A 4Z2YA 5AVVA 1M76A 1VB5A 4FXOA 4FMCB 4TRNA 1ENOA 5HF9A 4KFTA 1LS1A 1VLMA 2Z3VA 2DZDA 1YU6A 3LPAA 2INGX 2HSEA 4D92A 4ZHQB 1EUCA 3RC2A 3VKFA 3WDLA 3AOEA 1VI6A 3CLUD 2P79A 1GKKA 2KX7A 1KAHA 1ZJ4A 4FXPA 2CVPA 4XD2A 4H1WA 4ZPXA 1GUDA 5A9SB 4TGLA 2WMOB 2HY7A 1Y9ZA 3E70C 3PUVA 1CIVA 4ZVSA 1B42A 4K6OA 1G5HA 4OI4A 3JD0A 4D9JA 5B1HA 2MR6A 4WCFA 2NAPA 3DFIA 2CD9A 4ZDKA 2I7DA 3U4AA 4X64B 1N2OA 4N7RA 4W1PA 2OPBA 2OZPA 4ZOEA 3U3DA 4K2AA 3IIMA 1CUVA 3OT5A 1CRQA 2I66A 4YROA 2K4MA 2A35A 2GRJA 2CXRA 2XRFA 2YYZA 4PAQA 1XNRB 3TD6A 3OIUA 4WXEA 7MHTA 5F52A 2PH1A 4ZJUA 3S1AA 1T13A 1Z2AA 5CT6A 3K31A 2DT8A 2B3TA 2JKYA 3TAHA 3FSEA 4A0QA 3LP6A 3KKQA 4FYIA 1LDMA 1UEXC 4J0CA 4F84A 1E4EA 2UUAB 1KGDA 2OG1A 3ZCQA 4QUAA 4E5MA 1Q84A 1Z47A 1JEYB 3RV4A 4H0CA 4FDAA 3EGXA 1V9SA 3ODPA 4QNNA 1TECE 1Z8NA 2AMYA 4INZA 4E22A 4UE6A 4URVR 1RYYA 2Z58A 3AKZA 4QKQA 4A8HA 4P0QB 3ID6C 5FNVF 2DG2A 4DMMA 4XUCA 1QP4A 2AR0A 1U1DA 1L8LA 4TUYF 4UULA 4B7UA 5LXTA 5KX5B 1H4SA 3HXTA 3KOZA 4AG3A 1RD4A 2O1EA 1YTLA 3KHSA 5AHKA 1GPJA 3JD3A 1PEYA 3RF7A 4WVLA 4Y2HA 4RTMA 4F56A 5HUQA 2VEDA 1PUJA 5BSGA 3KQVA 4Y98A 2W6JA 1FW8A 4ZVVA 1MTOA 1XRNA 3RIYA 1PEAA 1OAOC 1SHKA 2ZR8A 3DOEA 3AM5A 3EASA 4P3KA 4B09A 1J56A 3U7EB 1LC3A 2YRXA 7MDHA 1D6MA 1EQAA 3D6FA 4XXHA 5DWDA 3VOSA 4RO0A 4CCYB 1T36A 4EG5A 2Q5IA 4ALIA 4C7VA 3GT4A 5KU7A 4NWIA 1WUTA 3NM5A 2V4UA 3OJCA 4KLAA 2QPTA 3ORYA 4KTTE 2QZ9A 2B7BA 4NPCA 3L8DA 3D6MA 5FLYA 3MF4A 1M54A 2WWRA 1PSWA 3PP8A 5FB3A 3YASA 2LNDA 1AZWA 4GP6A 4Q82A 3BFVA 2AOVA 2QDXA 2IPXA 1GFSA 3UAYA 2QSJA 3ADOA 1OC4A 4RW0A 4GPIB 2DH5A 2W6OA 3P19A 1XJQA 4EKIA 4NZPA 2AC2A 4QUHA 1DVRA 3RTBA 3SEFA 3IOMA 1ND5A 1P17A 5IP5A 2I9PA 3VAYA 4AJIA 5EJFA 3G2KA 4PC2A 1KC1A 4KBFA 4QE3A 1F0NA 5LFAA 4HS4A 4IDPA 1OBOA 3SWWA 2K7ZA 1AHNA 1WLSA 3O4GA 4GH5A 2QOEA 4PC3A 3B52X 4FYWA 1H0HA 4REOA 2Z2YA 3T7SA 2CLCX 4LSZA 4BVLA 2R3SA 5DMXA 2X0IA 4DCNA 2W98A 1KRXA 1KWGA 2B82A 1Z13A 1OZAA 4LSGA 5FTWA 1RM5A 1SVOA 1FLDA 3K9HA 2OHHA 4G81A 1SIOA 3AQIA 4H77A 4ZAGA 2ZYVX 1QHYA 4UTNA 1D7AA 3CCFA 4XTCS 9LDBA 4MS3A 5B1DA 1OAAA 5EXEA 3BAZA 1KH3A 2IY8A 4FOTA 3OQHA 3DL7A 5K0LA 2GM9A 1LRJA 4RMIA 3P9CA 3KVNA 2QV0A 4J49A 1FFXA 1E9DA 5DYIA 4V0LA 1U7DA 1QF6A 2CHEA 2P11A 3CTPA 4IS3A 5TNXA 3WA6A 2JIZD 3CKKA 4XYMA 4RGQA 1R0YA 1I0ZA 1KQ3A 3OZTA 2O54A 2OD7A 2J3IA 1Y5NA 1XQ9A 4HLNA 1Q2XA 3DEYX 2CBXA 2QUBA 2XVAA 3DXZA 3GWGA 4LRSB 4X63A 4DEXA 5FOWA 5BOSB 1BD4A 2N1MA 3KEFA 4YTEA 3KD3A 2FEMA 2QJTA 4GSLA 4CM3A 4DQKA 1T9KA 4G41A 4HBZA 2VR1A 3GBSA 4HXYA 3OPVA 2OB2A 4MRMB 1OMOA 4RF4A 5AHXA 2VVTA 5JMTA 1UAGA 4ER3A 4Q1AA 4QD3A 1N6NA 1L5FA 1H05A 2JIRA 2Q3FA 4MVJP 5T5QA 1JDVA 1AUPA 1N0HA 1P9WA 3PC8A 5CVVA 3QLUA 5CLFA 3OSUA 5IBQA 2ZUEA 3UK2A 1DQYA 1ESDA 2BFCB 3KC2A 5CLLA 4C89A 4CKWB 4HRAA 1O95D 1C80A 3DKKA 4K9SA 4BNLA 4QPCA 4JLWA 1W88A 4LF7B 1FMFA 1GDDA 1GEEA 4DLVA 1HTTA 1CF2O 3HVJA 4WN9B 3VR4A 1T1SA 3W05A 2ZCJA 1FX0A 4DHEA 1T0JB 3DOJA 2I3ZA 3C16C 5A6SB 5BYAA 2Z5FA 1R7RA 1LKZA 1U9JA 3AB8A 3GLGB 2H29A 2F43A 3B20A 3LIIA 3UWPA 2NU6B 3D4LA 3MBOA 1EYZA 2R96A 1A27A 1XF9A 3S1AB 3LNTA 4YV2A 1SBNE 1ZXLA 4GRDA 2H7VA 3VOTA 2CNDA 1XDSA 4BLTA 4RTOA 2PL9A 1F8YA 2FZ4A 1UBCA 1GPLA 5DTMA 1EWKA 3U37A 4BNUA 1N75A 1TZMA 4HNAA 1P1BA 2GDJA 1RRGA 1NULA 3S28A 4RZQA 2WIAA 3GELA 4I3FA 2I1LA 3SFZA 1IHUA 2QX7A 3ND8A 4KBGA 4B2YA 5AJXA 4OATA 2BMVA 3PIRA 4URYR 1GG9A 1J06A 1RXSA 3PFGA 4JOBA 1V3TA 4XJXA 4MHTA 5A2GA 2J41A 3PUYA 2VHWA 5EINA 5FPTA 4MR7B 4X62B 1GL9B 4G5FA 3A31A 5DRYA 4EJ6A 2ZT7A 2PR7A 4AJHA 3QJ5A 4EM6A 4HI0E 3I52A 3RFUA 1OFUA 1FOEB 1KFEB 5JS2A 4RA9A 3IXMA 2X6RA 4KLCA 1Y3IA 2ZSJA 3JRNA 3S99A 4BFVA 1I3OA 5B7GA 2C8KA 3WYNA 3JQ6A 1X7YA 1IG0A 3CRZA 1YQUA 2IV7A 4JYCA 1E0SA 2QN3A 3GDHA 1JKMA 3NDBB 1L1FA 5GOZA 5ALXA 3L6UA 1QDUA 4JI4B 4N47A 1EVYA 4MDHA 4WEOA 2GBLA 3ZWXA 3T7TA 2AFHA 1HMYA 3PIDA 1I2BA 1DTSA 1MFPA 2LIVA 3QVXA 2CMGA 2YN0A 4FSDA 5D6NA 5ICEA 1JW9B 4L85A 1UXJA 4MA4A 4RPLA 4YJ3A 5BNZA 1C1YA 1TKRA 3IPXA 2B1QA 1PS8A 3SHWA 2PUFA 5FBVB 1GPKA 3FVVA 3JS5A 4DA4A 3R3XA 5B64A 1ESNA 5K0BA 2IKQA 2W2LA 4PLGA 1SU6A 4CMIB 1CUJA 4FLEA 2D1TA 4G37A 3PUWA 2VA8A 4B3DA 1CVRA 3H65A 3DE4X 3UGTA 4EJFA 4CG3A 3O31A 1T6BY 2XOKA 3HO6A 3GH3A 4L16A 4TWBA 2VN8A 3UJCA 3V2HA 1RWVA 4N8DA 4RY9A 5C51B 2I3DA 3PTAA 3WIVA 4GLLA 3DV0A 3SF0A 1HETA 4YRCA 3ZNNA 5LKRA 3GB9A 4L4YA 4WK0B 1CEEA 4JUCA 3UB4A 1P4RA 2AE2A 2ZE7A 2QA5A 4ZXPA 4FIZA 5A4KA 3H83A 3GHYA 3UK1A 2HJWA 2B1JA 1XZPA 3L7JA 4B71A 4EG1A 3NEYA 2H7CA 4Y6RA 3A14A 3BBPA 1TUBB 3I34X 1AC5A 3M6MD 2NYUA 4YH1A 3IYLW 5TEWA 3S2YA 3ZV4A 2CLDX 3VDRA 1L3CA 2DBRA 4H2DA 4YB8A 2BGIA 4MS1A 3A37A 3UTDA 1ADFA 3R5KA 1FLNA 4C4RA 2PXCA 2BONA 5IJZA 4MUIA 1RZRD 3AG5A 2AQHA 1NOJA 4DRXB 1KKUA 2GA9A 1VL0A 4MW1A 4X8MA 1WOYA 2AJBA 4DC1A 1D03A 2C83A 1MQSA 2J45A 2FQXA 1SC9A 2IYQA 2L69A 3IDFA 2XGJA 3RO7A 3K5WA 1JJVA 4KMOA 4MVJH 3RF6A 5TJHA 3ZHVA 1KY5A 1MIOA 1U0GA 3H1AA 1EMDA 3PNBA 1NHWA 2XYQA 2J7KA 1W73A 1FDOA 1I01A 2P5YA 4K9OA 4M0EA 3GGOA 2IXDA 1TQ8A 4DLTA 5IJWA 3M3PA 4IIJA 5A4JA 4NJMA 2R85A 3IKVA 3WGNA 1XDBA 2AFIB 4K8RB 1GGKA 4OGKA 5TQ0B 4D4HA 3VU8A 2PKXA 2XXAB 1VIDA 1Z28A 2G09A 2Y71A 2Y4NA 1LBHA 1RKVA 3CWZA 2VH5R 3OT1B 4L73A 4X71A 3WNVA 1DJNA 4IHQA 2JJ2A 4LFBB 2ZIXB 5LZ9A 1LX7A 1GLNA 1VXOA 4BNTA 5BYJA 2ODBA 4LDPA 2F8SA 4LHEA 4UM7A 2KJQA 2WTNA 1NJ5A 3NEPX 3B3AA 4NAUA 3KEQA 4RM3A 5EMJA 3SY8A 3VTKA 4YRKA 1EX6A 3IALA 4HL6A 4ZC1A 5CA0B 5C8VA 2C1ZA 5HP4A 1OI4A 1RIFA 2QLNA 4N6NA 1O8CA 4UEOA 1IHDA 4XIIA 4YRAA 4DB2A 4GZMA 4LVOA 2B20A 3RDPA 4J7XA 3OQVA 4AVYA 1E0KA 1H8HA 2ZAGA 4L1KA 3OAAD 2WM8A 4ZZ1A 1FX0B 2JJ8A 4KGXA 4BCCA 3BJEA 3G23A 1T10A 5JC8A 2I80A 5EMNA 5BYBA 1E6UA 4ZODA 3AR3A 1WQ1R 2A57A 2CEKA 4YCDA 4P9NA 5KYGA 1WF3A 4G0OA 2G9VA 4MGYR 1A71A 1YR9A 2OZVA 1K98A 2YQ4A 2P9GA 3PE4A 1XMJA 4HVAA 4G01B 4MVJG 4KXFB 3ZHBA 2H31A 1DAOA 2JZNA 2Q21A 4A92A 4BLRA 1XDDA 4N76A 3G9UA 4TKVB 2DR0A 2ZPUA 1TVMA 1YB1A 3L93A 3PB3A 4PEVA 4Y9SA 1KP9A 3RBZA 4M88A 5DI3B 3A7EA 2DBYA 2HK7A 1CJCA 3P94A 4ND8B 3WGLA 4DMCA 2HJVA 4RPHA 2Q41A 4J4TA 1WPXA 1VE5A 3FMFA 5ALEA 1FMTA 3EBLA 5ENDA 4BKRA 4RS3A 2VJLA 4H6WA 5ECGC 5DTRA 3HS3A 1VM6A 4N7BA 1QTNA 4OMDA 4QXQA 5JJBA 2ZXUA 3AUJB 1IN6A 1NXVA 1F51E 1P9NA 3R7LA 4WZAA 3ICOA 4C1BA 4U5QA 2A6PA 2O23A 4UTRA 4P53A 1G38A 1W5BA 5K6RA 3CF6R 1WB6A 4OOFA 2ZJ1A 4D3ZA 1IONA 1X7YB 4FD2A 4CMAA 1YOVB 2CLHB 3VZSA 4GOND 2XT0A 4XRRA 2VJAA 3BB4A 3RS8A 3KS9A 4Q37A 1YRQA 2CC2A 3P4YA 3ZFNA 1WSWA 4R1PA 4BKPA 2OYSA 3AHCA 4XDYA 4B5KA 5HQ3B 4X6YA 2V3CC 3T5AA 1F1JA 3GUUA 4ALKA 2LDXA 1ILEA 1LI4A 5C1DA 3A28A 2YY7A 2R7KA 1EM6A 3EQ8A 5AQEA 4MQ5A 2ZANA 4A8PA 3H9GA 3JTEA 2XCSB 2A9PA 4XARA 1EX9A 3DMYA 2OCPA 3IA2A 3CNNA 3A2KA 4WZBE 3LKDA 3AKCA 2XT6A 1GAXA 1OZFA 1PG5A 1VPVA 5BWLA 2NSYA 4YR7A 3QIVA 4CIBA 3MMZA 2KPOA 4QFCA 4D79A 4KH1A 2B6HA 3AESB 3E0XA 1WNFA 3PJDA 5K6AC 5KNBA 3G2PA 3I1YA 2HK6A 1NF2A 1X77A 5BSWA 2QP4A 3HEBA 5FPSA 5LOVA 1YQQA 4Q7EA 2ACWA 1R8QA 4KUEA 1OFVA 2IWHA 2COUA 3R0QA 2GH1A 5CLIA 2AJLI 4Q9JA 4RIHA 2REOA 5L6MB 3AFGA 1P2SA 1VMEA 3CBQA 4A2PA 1L8XA 5FV4A 1XNQB 2FSUA 4WOCA 1HT1E 1TNDA 2HGZA 3HGTA 1TUBA 4O4LB 1Z6GA 2XYRA 2IXBA 2GEKA 3W8FA 3KD2A 5EPEA 2DQKA 2R4TA 4NIMA 1Z7EA 5DKFA 4PXAA 3H1TA 4L5JA 2EZUA 1Q1QA 3T3EA 1MABB 3W2TA 1XA4A 1Y8CA 4IGIA 1U8FO 2AFIE 3QK7A 5CHEA 1M0EA 4XRGA 2ZUDA 2FW7A 3B70A 2GBGA 3L0CA 5BSRA 4C4AA 3OFND 4P86A 4AIIA 3QYFA 4LXUA 2PXXA 1WJGA 5I6DA 1OZHA 4EBBA 5CXSA 1RQLA 5HXAA 1R2QA 4E31A 2PIDA 3MB5A 1H9AA 2QZPA 2C57A 3S44A 4BVKA 3HY3A 2TMGA 4L22A 3ENVA 1AVTA 1FEZA 5EIBC 1N36B 1CS4C 3EW7A 4UATA 5IUJC 6REQA 1DRJA 3O95A 1M34A 4BMVA 2B92A 3IP7A 5CMLA 4GS5A 4BXOB 3EXG2 4DV1B 2Z8YA 3MGBA 3R0VA 1G7TA 3D3JA 3CX4A 5AI0A 4LEIA 1F17A 3KOWA 2HJ9A 1Y4ZA 2FPKA 5CP8A 5HRUA 3B6ZA 4FLFA 4XR9A 3TYXA 2ZIXA 1BGXT 3N3AC 3ZZMA 3EDMA 1E66A 4I46A 3UWDA 2YMQA 4IJ5A 3P9KA 2OGWA 3JQAA 5E3IA 1UKCA 5FIUA 1H2RS 2HBQA 4ARZA 1VLJA 4W6QA 2RI1A 2YWHA 5LZ5A 4GOMD 1Z5WA 3WRVA 5I9LA 4G85A 5B4UA 1E2JA 1KO7A 5BR7A 1X7DA 1YNSA 5SY6A 3C70A 1LW6E 3ONEA 5HMMA 4OTZA 4DDHA 4EYGA 3FOFC 1YQDA 1X8XA 4XAQA 4RFSA 1ABBA 5BMVA 4TMYA 3T9FA 4DY6A 2PKQO 4MV7A 2XQIA 5AM3A 1ZCAA 3MWEA 3JALA 3J81A 2IE0A 4HQ0A 3CNBA 5CT9A 5HGJA 3VO8A 3QVSA 4NMLA 4YJ2B 1K7YA 2IHYA 3GT3A 4XE5A 4ZI5A 3SJUA 1ORTA 3K15A 5LQKA 1F5NA 1H85A 3O8RA 2BEWB 5HR5A 1DEXA 2EDAA 2FRDA 3PXUA 2XECA 5KSYA 1AMNA 1QGED 2IPAB 4IJVA 1A9XA 1F6DA 3H3JA 2KBEA 5F33A 3MGAA 2W6QA 3KKMA 4N40A 5CBPA 7ABPA 2CYCA 1SBCA 1W4LA 1FF9A 2ESRA 3RS4A 3UYLA 1Q7RA 2BZSA 5G2OA 4WACA 5H9WA 3S8EA 1LTKA 2HQ1A 3R75A 4S35A 2WWYA 2PT7A 1VMDA 1VE6A 1D09A 1NP7A 3G2IA 5EVJA 4G23A 4PRKA 4NBSA 3GGPA 2VATA 2VJMB 3L1KA 1FRQA 3GLIB 3DVAA 3G0OA 4ZAVA 1RE1A 2C7QA 3PG5A 4JY7A 4PANA 4G2TA 3LU1A 1B16A 5E7MA 4ZYUA 3PLNA 2GRAA 3EY9A 2OV1A 4E21A 1MB0A 2XE4A 3ZCXA 1MVNA 5JNVA 1WEHA 2LKDA 4A0GA 1AS3A 1LD3A 3HACA 4AURA 5F35A 4CQLB 3G