2O0LA

Human spermidine synthase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
274
Chain Sequence
b'IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase
publication title Structure and mechanism of spermidine synthases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 274
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 2o0lA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2o0lA02
1N2XA 5LQNA 3P9KA 1YUBA 3JWJA 3DOUA 3KR1A 2AVNA 2ONZA 1NW7A 1FP1D 3SM3A 1SUSA 5FQOA 4CTKA 1RI4A 4GC9A 3MTEA 3M6VA 2E5WA 3KQSA 5DRYA 2BZGA 2GS9A 2IP2A 4HTFA 5EKUA 4RVHA 3PFHA 2R3SA 2AOXA 2BM9A 5LQAA 2QRVA 2C7OA 2P41A 1FPQA 3DMGA 1NBIA 3LCCA 5HILA 3VC1A 3Q87B 5LR6A 2NP6A 5LSAA 3EVDA 4GOLD 4X61A 2XYVA 1BHJA 3LCUA 4RVFA 4XUDA 2FK8A 1JSZA 3B5IA 1JTEA 2EFJA 5G02A 3NMUF 4YUWA 4IV0A 3BKWA 4RVGA 3DP7A 4GQBA 2QYOA 4BLUA 4JXJA 1G8AA 4ER3A 4KWCA 4RTMA 1TPYA 4RV9A 4FZVA 1X1AA 2G1PA 2AVDA 5CVUA 2VDUE 1ZHFA 2H00A 3DMFA 2I7CA 1KHHA 2JHAA 3DXXA 4R05A 1KPHA 4DF3A 1AQJA 1M0EA 2Z6UA 1H1DA 1P39A 1XDZA 3P2EA 3C3YA 1NV9A 4P7GA 3RODA 1WS6A 3NVMB 5GP1A 3G8BA 3H2BA 5DM2A 4DCGA 3BT7A 3FUWA 5K0NA 3GXOA 4KVZA 4FGZA 1QANA 1WZNA 3PB3A 3HCBA 3HVKA 1EJ6A 4BP1A 2P3LA 2LD4A 4R8SA 5ICGA 1NBHA 4DA4A 2Z6AA 2F8LA 1NT2A 1ORIA 3GCZA 3ER8A 2PX2A 4C07A 3THRA 1ORHA 4QPPA 4X41A 3CJTA 2NXEA 4K6MA 3M4XA 4RTNA 2KW5A 2C7RA 2A14A 2CL5A 2NNWB 4P58A 5FWDA 3KU1A 5GM1A 1PJZA 3MB5A 9MHTA 2P35A 3CGGA 3KR0A 5GWXA 4EKIA 1FBNA 3EVGA 1M6YA 3SVZA 2OXTA 1WXXA 5KQSA 3B3JA 2VP3A 1RJGA 5DWQA 1HMYA 4WXHA 4U7PB 2AN4A 4V0RA 4RTSA 1U2ZA 4B17A 3TKAA 5K0FA 5LQKA 2ZULA 5F2OA 2HNKA 3VC2A 1KP9A 2O57A 3AWIA 3TM5A 4DQ0A 1NW5A 3UJ9A 3ELUA 5FTWA 1R8XA 3LKZA 5E1MA 2FHPA 3KKZA 1JG1A 2ZCJA 1N7JA 4QVKA 5E8JA 5EOVA 3BWYA 4M38A 1ZG3A 3GWZA 3M6WA 5FULA 1JTFA 5LQUA 2P8JA 2UYHA 5EMJA 2ADMA 1SQFA 1BC5A 3LGAA 1MJFA 3HCEA 3U81A 4OA5A 3UWPA 2V7EA 5E1DA 5ICCA 2FYTA 2ZIGA 1VLMA 2HV9A 1XDSA 3FTCA 5HEKA 2HR1A 2GH1A 1OR8A 5DXAA 3UJBA 2IDKA 2PX5A 1XCJA 4P7JA 4RTRA 3LDUA 5H02A 5K03A 2FK7A 4RTJA 2EX4A 4O29A 1D2GA 4YMHA 2PT6A 2O05A 3F4KA 3S68A 5E8RA 3SSNA 5EMKA 5EGSA 3UFBA 2OZVA 3KPYA 4DZRA 3FUVA 1Y8CA 4LWOA 2JJQA 4PWYA 5BXYA 2AN5A 4RTLA 2XBMA 2ORED 1X19A 1WXWA 1O9HA 3HM2A 5GIPE 1QZZA 3DULA 4KRGA 3LBYA 4E2YA 1G60A 2YTZA 2YXEA 3PX3A 3CCFA 4NECA 4ER7A 3RW9A 1G55A 3FUUA 4PCAA 1I4WA 3LCVB 2BR5A 4R8RA 4RX1A 5E2AA 4RSRA 4F86A 1T43A 3M33A 4A6EA 5HIMA 3O7WA 2OY0A 1KR5A 4HC4A 3G89A 3LECA 5BP7A 3P8ZA 1P1CA 3FRIA 5K05A 3HCCA 5IKMA 2B2CA 3C3PA 1VE3A 3DLCA 3QOXA 4X63A 3TFWA 2UZ4A 1EG2A 2YVLA 5E1BA 2IFTA 2XVAA 3I53A 7MHTA 3BXOA 4C06A 2AZTA 5FADA 3UBTA 2PSSA 4ZTBA 4YUXA 5EHGA 1IM8A 2GB4A 3JWIA 4OA8A 5DRTA 4BP3A 3NJRA 3AXSA 3OE5A 5C0OE 2DPMA 2PXAA 3RIEA 1WY7A 2Q41A 2B25A 4QVGA 5CVDA 5EEHA 1KXZA 3OE4A 5K0EA 3VYWA 3PT9A 1SKMA 1RI5A 3X0DA 1XTPA 1P1BA 4POOA 3OPNA 1YZHA 3LDGA 1X1CA 5K09A 5K01A 4DKJA 2Z6QA 4XUCA 4MWZA 2YXLA 4ISCA 3DTNA 3PS9A 4QDJA 1D2CA 5EZQA 3KHKA 5KQRA 1KPIA 3UJDA 3BGDA 5BW4A 1DUSA 3A7EA 4AZVA 3R24A 5LQJA 1SUIA 3NTVA 5GM2A 3HNRA 4GC5A 1G38A 4GBED 1L3CA 4E2WA 2CMGA 3AY0A 3KQWA 3PVCA 3P97A 2PWPA 1JSXA 3GDHA 4XUEA 3HCAA 4Y2HA 3TM4A 5F2KA 3O4FA 2UYQA 3DMHA 1PRYA 3M6XA 3NDIA 5EVJA 2PX4A 4P7FA 2R6ZA 5D1NA 3ELWA 4MTLA 3M70A 4BLWA 5EIFA 4F85A 1BKYA 3G5LA 3HP7A 5JR3A 4IV8A 2AS0A 4H0NA 5K0JA 1NW6A 3FZGA 4HTFB 4PYOA 2WA2A 2OKCA 1JR4A 1SVUA 2ZZMA 3EMBA 3MCTA 1NE2A 1M6EX 1VL5A 2QRVB 1D2HA 3CC8A 3FPHA 4CKBA 3KQTA 4HSGA 2IGTA 3OCJA 5ICFA 2AR0A 1QYRA 3FUXA 1XVAA 2H11A 2NXJA 3EVEA 4PGGA 4FR0A 5HIKA 3R9XB 2ZBQA 3MCZA 5CIYA 2ZIFA 3FYCA 5DT2A 1JG4A 4Z2YA 5T67A 3MTIA 4QQKA 1KPGA 4E30A 2AOUA 3FPGA 3HCFA 4XCXA 2IIPA 4CKCA 5FA5A 3FPJA 3GRVA 5DM1A 3T7SA 5HZMA 2VDWA 3L8DA 3IV6A 5CCBA 4E2ZA 2I9KA 3FUTA 1MHTA 2G71A 5E1OA 1P91A 3UA4A 1NV8A 3TOSA 3V8VA 4C05A 4UOEA 3D2LA 5MHTA 10MHA 3ER9A 3FPEA 3EGIA 3AJDA 4BY9E 2B78A 5IH3A 4ER5A 2V74B 4G56A 3OU6A 1QAOA 3SXJA 2YQZA 5E9QA 4AZWA 1ZQ9A 4CTJA 3AXTA 3NWBA 2VS1A 1YFLA 3EEYA 3O31A 3GO4A 3EVCA 1INLA 5KS2A 3SR4A 5K8VA 2ZZKA 3E7PA 1X1DA 3CKKA 2OPBA 3B89A 5M5BA 1AV6A 2P3OA 1R8YA 1YF3A 3DR5A 4HRAA 5CUQA 2EJUA 5EPEA 3KQOA 2Y1XA 3PFGA 4LG1A 4PONA 1I9GA 2FRXA 2JHPA 3G8AA 4FT4A 5GINE 1YZ3A 1G8SA 3LSTA 3DH0A 3QV2A 4RWZA 3BWBA 2I6GA 2QY6A 4Y30A 2ZW9A 3ORHA 2PWYA 4GF5A 5DM4A 5FHQA 3V97A 3WSTA 2GLUA 3M6UA 2GAFA 2ZLBA 3R3HA 3BGVA 4HH4A 4R6WA 3G2QA 3MAGA 4EQZA 2IH4A 5DLYA 3THSA 2JH8A 3NVKI 5EZSA 4MHTA 5DX0A 4DMGA 3EVZA 2UYCA 3HA7A 3LL7A 3GIWA 3HCDA 3DXYA 2P1DA 3BZBA 3UA3A 3GU3A 2C7PA 3UJCA 3KQMA 4ER0A 3EVBA 3OU2A 3EGEA 2AOTA 2YUIA 3A25A 3KPJA 4HGYA 4KIFA 3SGLA 1I1NA 5E9WA 3FYDA 2PXCA 3OZTA 4E31A 3LPMA 5FCDA 3K6RA 3T7TA 4PYJA 5LQRA 4AZSA 5T64A 2G72A 1L3BA 3B3FA 3HVJA 3KQVA 3FTEA 3NW9A 4X60A 3C6KA 3B3GA 3OFJA 4AUKA 3EMDA 2FPOA 2PXXA 4OBWA 5FQNA 3T7RA 3GRUA 5GIOE 2WK1A 2B9EA 3DXZA 4QPNA 5K0GA 2OO3A 5JUWA 2NXNA 2YR0A 5DPMA 3CJQA 3KPWA 5EEGA 1R74A 1DL5A 1SQGA 2OB2A 3OZSA 3KR2A 4M7RA 5HIIA 3UJ7A 2QE6A 2WA1A 3I5UA 4PYKA 3FTFA 2FCAA 4RTKA 5EMMA 2BM8A 3BWMA 2GA9A 5DXJA 5K0LA 3FRHA 3Q7EA 4PCLA 3TKYA 3UJAA 5DTMA 4M36A 1L1EA 5K0BA 4EMSA 3FPFA 5T6BA 3BUSA 1RI1A 5P8WA 4KDRA 2IH2A 5BW5A 2AN3A 3I9FA 2HTEA 1KYWA 5B1SA 4V0QA 1RI3A 1EJ0A 2N47A 1FJXA 1R18A 1JG2A 4QTUB 5F2NA 3P9CA 4FT2A 1O9GA 3A26A 3E8SA 2EG5A 2ZWAA 3ELYA 3ANXA 5KVAA 4DCMA 5EQJB 4X1OA 2ZFUA 4PGHA 2JH9A 4YUVA 4RTPA 2VDVE 3IHTA 3P2IA 5HFJA 3A4TA 2NP7A 4A6DA 1B42A 4E33A 1FP2A 1AQIA 4RTQA 1Q0SA 4GEKA 3E05A 2NXCA 4PYIA 4PYQA 5EG5A 2QM3A 3UJ6A 5K0CA 2PLWA 1JG3A 1L9KA 4PYNA 4OX9Y 2C7QA 4R6XA 4GOMD 4YMGA 5CVEA 3TR6A 1KIAA 2HWKA 3UZUA 5DTQA 3LBFA 3NDJA 2P3QA 3GRYA 5E2BA 1UFKA 2IBSA 5DSXA 2B3TA 3NWEA 5C1IA 2EJTA 3TRKA 1EIZA 2OYRA 1NW3A 1SG9A 3IEIA 3T0IA 5EC8A 2CWWA 3G88A 3P9NA 4GUAA 2PKWA 2O07A 3PTAA 1JQ3A 1QAMA 2JHCA 3SX0A 3TMAA 5DX8A 4BLVA 5ERGB 2ZSUA 5FA8A 3GJYA 8MHTA 3BGIA 3KQQA 2HMYB 2OBFA 2PGXA 3BKXA 4IWNA 2K4MA 1XJ5A 2ZTHA 4OQDA 3GRRA 4KW7A 2G8NA 3A27A 3OU7A 2ERCA 5FUBA 1O54A 5DX1A 4F84A 2ZIEA 3I58A 4FSDA 5DTRA 5EHIA 1IY9A 2O06A 4MQ4A 3EGVA 2BH2A 1X1BA 1JQEA 3SMQA 1EQAA 3E23A 1NKVA 1RJEA 1VBFA 4RYLA 2H1RA 1VPTA 2NYUA 3PLAE 3P71T 4PYMA 3R0QA 2P7HA 2UYOA 1KYZA 3G2OA 4MIKA 3FTDA 4U7TB 2CMHA 4GOOD 3HVIA 5CVJA 3PX2A 4E32A 2ONYA 4PIPA 2PBFA 3ERCA 3ME5A 3LX6A 3GGDA 4QTTB 4LECA 4ATNA 1V39A 4L7VA 5D1HA 1R6AA 3C6MA 1XCLA 2XYQA 1G6Q1 4PNEA 4YUYA 3CVOA 3OZRA 1UWVA 2YX1A 5LQCA 3EVAA 3TQSA 3UJ8A 5FHRA 3B7PA 3LDFA 2IPXA 2ZBRA 5DM0A 3OFKA 1YB2A 1Z3CA 5GOZA 3VSEA 1VP9A 2PVCA 1F3LA 3ELDA 1RI2A 2AOUB 2OB1A 3C0KA 4C08A 4EKGA 3HTXA 4E2XA 2IDJA 5ICEA 4M37A 3G2MA 4LWPA 3DUWA 4AX8A 5CVVA 3BWCA 2ZZNA 2ZBPA 3P2KA 3MERA 5HIJA 4P7KA 3TPZA 4AZTA 5CD1A 4CKEA 4QDKA 4HG2A 1EAMA 3CBGA 3K0BA 2GPYA 3CJRA 3HVHA 4OBXA 3KQPA 3GRZA 2AOVA 2P40A 3MGGA 5E9JA 1L3IA 2ESRA 3A7DA 5CCXA 2XVMA 2VZ9A 1AF7A 4PYLA 1HNNA 4E70A 2BR3A 1ZGAA 4ER6A 4EVIA 3P9IA 5HOQA 1TW2A 2BR4A 2Y1WA 3LKDA 5CM2Z 1NW8A 2XYRA 3EPPA 3KQYA 3REOA 1YFJA 4OQEA 1VP3A 1N7IA 5EIWA 5U4XA 3GNLA 1ZGJA 3I64A 4FP9A 1XXLA 4FS8A 1JQDA 1XDUA 3KPVA 4KIGA 4YV1A 2P7IA 3HA3A 1TW3A 2PJDA 4EK9A 4C4AA 3EEOA 5KYGA 3ID6C 3MQ2A 4YV0A 4RTOA 2ZVJA 1RJDA 4PINA 1DCTA 4CXMA 1IXKA 4C03A 1RJFA 3JWHA 4FSXA 2PT9A 2PX8A 1F38A 1Q0TA 4DM3A 2IBTA 3LHDA 2IH5A 2JG3A 3JWGA 4YV2A 2PV0A 3G5TA 1ZKDA 2AOTB 4GOND 2DULA 3DLIA 4CWAA 1BOOA 5EKXA 1WG8A 3KR9A 2G70A 3G2PA 2I62A 1UIRA 2CKDA 3HEMA 3SSOA 2ZWVA 3SSMA 2PY6A 3TLJA 3MHTA 1R00A 4HGZA 3QOWA 1QAQA 3R6TA 4RVDA 4YUZA 4PIMA 4C04A 5EMLA 3IYLW 1VQ1A 3EVFA 3KPUA 4QQNA 2YXDA 4WVLA 1VIDA 4IKPA 5DSTA 2AOWA 3G7UA 2O0LA 5FWAA 5C9ZA 3HA5A 4KDCA
chains in the Genus database with same CATH superfamily
4DV4B 1YUBA 3G2KA 3PFIA 3UW1A 3WXMA 1IATA 4C7OB 2OV1A 3N8IA 3SM3A 3IILA 3UCFA 1D0SA 5AI6A 1WDKA 2PH1A 4EYOA 3T35A 3MLAA 3VKFA 1U0JA 3ZGLA 2NUAB 2Z1NA 1CY2A 1T13A 1W4CA 2WU8A 3D8BA 3LLVA 3BDAA 3UUFA 2C4MA 4UDOA 4LX0A 1M1YA 2Y2UA 4MPRA 3PENA 3R8CA 1YFZA 4QGBA 5GPBA 1ISGA 2X0DA 1I0IA 2Q29A 3DO8A 2NP6A 4GOLD 3QPDA 2XYVA 4UCXA 4XUDA 1JEAA 3RV3A 5G02A 3T3GA 1FFHA 1JTEA 1CQIB 4IHQA 3LPNA 2V9CA 4Q3LA 1JQBA 1G4HA 4D6XA 2HB6A 4GQBA 3F6SA 4AK9A 1OFIA 1NLZA 2AW3A 3DEHA 1FFSA 1Q77A 2QDXA 2HJGA 4TVBA 4F5DA 1NXVA 1QIDA 1GQRA 1UKVY 2CYAA 3AY3A 3Q7TA 1F8UA 5DLEA 2W6PA 2QRHA 2QD2A 4RD0A 3DDWA 4XRRA 4K9OA 3HSKA 1QYIA 1GTJ1 1TEVA 1MP0A 3IQDB 3DDSA 1WUHS 3L8GA 4V03A 1U5BB 4YJHB 2P9JA 1Y1RA 1EESA 2BF7A 1RXUA 1E8DA 2HXGA 1DDOA 4IJKA 4JL5A 1TYAE 3UQYS 1D1PA 3WXBA 1GADO 5KPJA 2OOKA 4C07A 4M1WA 1Y8QB 2BOVA 2O2DA 5A06A 1V4VA 2H4XA 4QPPA 4R84A 1NVUQ 3IALA 3KJNA 2PZ8A 1FCJA 3DB2A 3RUCA 1LS1A 2KW5A 1ZMOA 1JEOA 1XLUA 2OENG 3DUFB 2ZU6A 3QKWA 4LSWA 2BKAA 4IUDS 1CY0A 3HR8A 2M6LA 3W8DA 3WNBA 4JOCA 2NAPA 5GM1A 4EP1A 4YRZA 1Y3BE 1GGFA 1N8NA 4LRQA 5KWIA 4UDXX 1GAQA 4WNAA 4C78A 2VSFA 3ZCPA 2AN4A 3QA9A 2OHFA 1XD9A 2F43B 1RNLA 2FB9A 2YFQA 1IUNA 2PX6A 1NHGA 1Z68A 3PWTA 4WH0A 4B4OA 1F1BA 2QUZA 1JHPA 1FMTA 1KP9A 1PS8A 5B3JA 2GPBA 2Q99A 1LWNA 3FJYA 1P61B 2Z4SA 4FHEA 2ZSEA 2B4QA 3BB4A 4I6EA 2CUTA 4GMHA 4KLAA 3RYHA 1EFVB 5CXXA 1Q0UA 1G2QA 2DJIA 1QVRA 1ZG3A 1Y7TA 2FGKA 3QE2A 4EUFA 1I2MA 2P8JA 4Q4HB 1G8YA 1IVNA 1G5QA 5F35A 1QG0A 4ALMA 3LNCA 1V6CA 2CVOA 2TMYA 5CK4A 2Q5EA 2YWGA 1MJFA 4CKWA 1RQPA 4WXPA 1CR4A 2AK2A 5CLQA 2PMBA 3U81A 1H8HD 2OG1A 2JLWA 2V7EA 3P2MA 1PR5A 2P2ZA 4PLWA 1Q1EA 1QF6A 3ZXIA 5C1DA 3BRSA 3DPSA 4RIEA 1WF6A 1Y1PA 2BEWA 2W90A 4IMPA 3TPCA 4MYCA 2BFNA 1JDTA 3JY6A 5EL0A 1DHRA 3R44A 3HBMA 4TWIA 4DM7A 4ESEA 1G0OA 1V45E 2PUTA 1WO8A 4S04A 3SSNA 4XWAA 4UCWA 3F5FA 4H4CA 4C87A 3GA0A 3MS7A 1GL6A 5HKKD 4EO9A 3F6CA 4KPGA 4NDNE 4L8FA 1TKRA 4LWZA 4MIOA 1NE7A 5G4KB 4GEGA 4U2KA 4DPLA 3DJFA 4ER7A 2JF0A 2WTNA 2ZI6A 3H2KA 4JLDA 1G55A 2PR2A 5TJ9A 4OM8A 4BVBA 4RX1A 4U6QA 3Q6NA 2Y66A 2FQ1A 1UM9A 2R25B 4ZCTA 3MCAA 5C1PA 3O7WA 1J0XO 3DJYA 3G1WA 4LNHA 3LECA 5I48A 3EXHA 3C85A 5F1PA 4KXQA 2X1MA 3RK1A 3ZN2A 3O1IC 3MTDA 4HVTA 4WZBA 5ALIA 3K0AA 4DA6A 2AZTA 3L7YA 1L4KA 1XNGA 3N70A 1E20A 1A4XA 2BMFA 3EGXB 4Y2VA 4EW1A 2G28A 3TZQA 2QX9A 5F1KA 4EY8A 2QYSA 1SB8A 3PDWA 1WY7A 4FHGA 5DYYA 3SBOA 2ODPA 1PNOA 1XTZA 3TD9A 4G0WA 3RSLA 1PS9A 1Z2OX 2BZ1A 1RI5A 2O23A 5I3CA 1T4DA 3QFSA 3L6RA 1YZHA 4X0EA 5AW9A 2PG3A 1GO2A 3LQ1A 2CNDA 3PCTA 3TTXA 1A88A 1RQXA 4OG2A 1DSSG 1YBVA 4BPRA 3GGOA 3UKDA 2G4CA 3D6JA 1PT5A 4R3NA 4B3XA 1XMPA 1K7XB 2XA9A 1LVUA 2YW2A 1XO1A 3ESZA 2NO9A 4TXMA 6CHYA 2I91A 1PHPA 2Y1KA 4N0MA 4ARAA 5CDYA 3LDAA 1NHWA 2ARKA 3F9RA 3QVGB 1P33A 2C5HA 1WM1A 3O3CA 2VHWA 5E7JA 4ZCMA 2E18A 5HDQA 1N7GA 4V1CB 2PWPA 4I9GA 1SEVA 4NU0A 1W48A 3HCAA 3HDJA 4YAFA 4CMHA 2E5LB 5EVJA 1TU0A 1NMYA 3NDIA 2ZBDA 4XIYA 2H31A 2R6ZA 4UJ3A 3ZZMA 2NTNA 4QEDA 4KQXA 4ZI5A 3DHWC 1SHTX 5HQTA 3T5BA 3OPYB 1KAQA 2ZJ8A 2V5UA 1FU4A 1QDEA 4M8KA 5SZIA 5EKTA 3ZU6A 4WX2B 3K3PA 4X7BA 1RWXA 3MCTA 1KBQA 1LSUA 4KXUA 3SY8A 4Z1OA 4FB5A 1VL5A 1EVLA 2CFTA 4QYWA 1H2FA 5LMZA 5A03A 4UHBA 2RK6A 3D8SA 1FQWA 4DA0A 1U7DA 2H85A 1GZ3A 2H5JA 3L6BA 3OCJA 3OOWA 2QT1A 5KYXB 4TLDA 1NYTA 2CC2A 2Z4TA 5BUSA 5I8ZA 5CYOA 4F92B 2W0MA 3NWJA 3I4LA 2QTRA 2BKVA 1UP4A 1JG4A 4YRLA 3W8RA 3WK8A 2WWIA 5EUCA 5IAJA 2GZAA 2EERA 2XF8A 4EHNA 3H2GA 4AO8A 4DE5A 3OQIA 5IASA 2FPPB 1CNEA 2BFFA 3LT0A 4KQ2A 1JA1A 3W6OA 3LWNA 3MIIA 2HRRA 1AM4D 1N6OA 2R6JA 3ASZA 4HXYA 2VL7A 3RI3A 3WBJA 2IYYA 1Y1QA 3LUGA 2GTHA 3WLIA 2D5LA 4AWAA 2COUA 5CLJA 3U26A 3NIDB 3FPEA 3ZQUA 2W2KA 3AJDA 1ZVKA 4BY9E 2VZ0A 4OXYA 1J5XA 3MINA 1NY6A 3G6WA 4D9HA 3OETA 2VYQA 1ZONA 4C7JA 3O74A 3ZH2A 3MZ0A 4ZANA 4QOIA 5LZ9A 1IHPA 1U3UA 3UMGA 5AIBA 1TQ6A 2GZ1A 3I39X 2GJ8A 3D7RA 3PRHA 1MG0A 3H2YA 2AIRA 1RPJA 1WCWA 4UHJA 4EEKA 5EIXA 3FHOA 3EF3A 3STHA 1VMEA 2I9PA 3FLBA 3LPLA 4TMXA 3EPJA 2G17A 3CUVA 3LSTA 4Q9DA 3DH0A 4RWZA 1M73E 5BO5A 3PICA 4EB0A 3WSTA 1GRVA 2UUCB 4UAVA 4BNJA 5GJCA 4LDQA 4QODA 2W6CX 3IRUA 4LHVA 4HAOA 2BGLA 5F5NA 4C4XA 5DLYA 4D4JA 2Y1GA 2GI4A 2IITA 2QD3A 5HFNA 3BM5A 1RAIA 4WNIA 2P1DA 1ISJA 1C4WA 2QROA 2BFCA 2ZITA 3BXGA 2AKAB 4JP1A 5I4BA 2C7PA 1CETA 1SG0A 4TL6A 2WF6A 2OBLA 1FDSA 4P2BA 3SGLA 3SIRA 2XKJE 3S2GA 4OU5A 4Q7JB 4MK4A 4TTSA 4CKXA 2XUGA 2GETA 3KL2A 4E31A 4TMFA 2DCMA 3T7TA 2AB0A 4XX0A 4AMYA 4NBNA 4DBZA 1DEAA 2WHXA 3UBMA 1CLUA 2NU8A 3E6AA 5DNDA 1OZGA 2FTKE 1Z9BA 3TTVA 3VJMA 4UTPA 5JZ9A 3K9FC 1R8QA 2FPOA 3FYUB 4IGAA 5EPOA 2ORIA 5BNTA 2YV4A 4HQ6A 1G21B 5K0GA 4QPNA 4K9RA 2XDQA 4K0RA 4QE3A 4UOQA 2BI4A 4LBVA 1KKUA 3O1LA 3NTLA 3SE7A 3KKEA 4ONEA 4A6PA 1MAAA 1H2ZA 5JCJA 3RB8A 4BNDB 5BYAA 4MAMA 4OQFA 2WA1A 3UJ7A 4R2IA 1FTYA 4GP7A 3NUQA 3FVVA 2QRPA 4JT2A 4HT3B 2ECOA 2GA9A 2JB9A 2WDZA 2XJ9A 1Y7PA 4BFYA 5F5LA 1JI0A 4H3HB 5DTEA 2RJOA 4EMSA 3N8KA 1YE8A 3Q10A 3R4VA 4NEQA 2VWPA 4BCBA 5LQDA 3ZDBA 4UBKA 5IUJC 1S8FA 2JIMA 5EP4A 4B3TB 3JX9A 1CVRA 4F97A 1X39A 2I2WA 4FHZA 4L0DA 4Y7CA 2ZFUA 3MWDB 3DC7A 2CJWA 4W9NC 4Y1GA 1DKLA 4C22A 4QTYA 4BCCA 2EU8A 3EZ6A 3GEEA 4DCSA 3EHDA 2JFBA 4E33A 3Q9LA 2H9AA 1AS3A 1XT6A 4OXRA 3QJ5A 3A1WA 3AP1A 4Q7MB 4RJKA 2H4HA 3HXMA 4IAOA 1JR6A 3GT4A 3DKRA 3HQ4O 4LSMA 3T3EA 1NIPA 3PJFA 1YQWA 4J3JA 2FSFA 1SXHA 1YFKA 3FHCB 3HO6A 3GPIA 1HFJA 1Y8ZA 4D42A 3UV6A 1YB7A 1FLAA 4MCAA 1JWAB 1KIMA 1W47A 1DIAA 1AHHA 1SNYA 4GXRA 5E2BA 1MC1A 1QFYA 2H59A 4HWPA 2VTEA 5IVIA 5A62A 4B3GA 5A3SA 2FWRA 1SG9A 3GLRA 4RABA 1P29A 4EGSA 2QZZA 4COOA 4ZYTA 2CNBA 2Y8EA 1DRVA 2GQ0A 1YBFA 1G5HA 1FUUA 1RVV1 2YZKA 3UPUA 4CUJA 2I99A 3TL3A 2HN9A 5DO9A 4MROA 3IUMA 5CK5A 2WJJA 4INOA 1JQ3A 4DC0A 1W5FA 3PWSA 3G0HA 4I3HA 5CFPA 1DKUA 1WP4A 3JALA 3QTTA 4OHBA 5TQ0A 4ZHQB 3D43A 5B36A 1Q7TA 1JR3A 1PR3A 1WOYA 2K4MA 1N9KA 2O8VA 3HDQA 3PC7A 2ZXFA 5FD8A 4YRGA 4I8DA 1B7GO 4UBOA 1QRRA 3OZAA 2AFIB 4B6JA 3OAAA 2AHRA 2R2AA 4YGYA 5EE1A 4MQ4A 3VKUA 2DBRA 5KWVA 1ORDA 5DCUA 1EU1A 3PI7A 4KCGA 1MFZA 4R2LA 3SC6A 4HN2A 2JLVA 5JT1A 1QVWA 2YV1A 4FZJA 1IB6A 1S8NA 1A69A 1VPTA 4B7XA 1U8YA 3L8ZA 4OBEA 4XKJA 3EIEA 1UMDA 2ENWA 4X1YA 5A4FS 3CPEA 3GL9A 3SKYA 2J0EA 3TLZA 3MGBA 3QE3A 1MHPA 4IIFA 4CKZA 3W4JA 5ICSA 3C15C 4UM5A 4JX9A 1LDGA 3DHNA 3G7NA 7ADHA 3PQ6A 2XD9A 1YQXA 1UZLA 5SY9A 2OPHA 3WGKA 4CDMA 1EFAA 1D4AA 2LUOA 1CJVC 2PYZA 3CGWA 1TAQA 1JFVA 5JSYA 4GXTA 1YR1A 1YCFA 5CIQA 3NHLA 3R7FA 3EZNA 3U7GA 1F51E 1C3JA 1GIAA 3W78A 3IAM6 2W93A 1VP9A 5TGDA 3CZ9A 5TT1A 4M86A 2LVBA 3BD8A 4OHOA 2YZ2A 3WLMA 3F97A 4BQRA 1Y42X 2DUNA 8ABPA 5JXWA 3H1AA 2ZYSA 5F2EA 4FYYA 4G84A 4XPIA 3F73A 3OIUA 1CUWA 3AW8A 5CVVA 3I2FA 4QARA 3B2QA 3G9ZA 1UC8A 3KD2A 3KXDA 2QVZX 5IEBA 4F1WA 5BQ3A 1M7HA 3JQFC 3ABRB 3GAAA 3P2YA 2X9NA 1ZZEA 2YXBA 3KZ1E 4BMCA 1DIOB 2N1MA 3IP6A 1ADCA 1E7WA 1I1OA 4HNAA 3X43A 4Y2RA 2SCUA 2QI9F 2R0QC 1G6HA 1P18A 1PEDA 2BR4A 3KKLA 3MN1A 1Z25A 3PNKA 4INPA 1OT3A 5KU1A 3PA6A 4ZI7F 2HPAA 4JUFA 1YK0A 5EIWA 3LFHA 2EL7A 2QBYA 4FP9A 4RUKA 4ZOBA 3M89A 3D0KA 3WK6A 3E4DA 2PSHA 5LMNB 1CEEA 1ZYUA 3WWDA 4U2CA 1G1AA 4CNBA 2H5IA 4BYGA 5CH5A 3PFCA 5AK6A 1WSWA 2WD9A 3ABIA 3HA3A 4R1TA 5KYGA 5DP1A 1HY3A 4D2IA 4F5EA 3LX5A 2O8BA 1VLQA 1DB3A 4CXMA 2Z58A 1QH1A 5G0VA 1IN7A 1XZGA 2BHLA 2R87A 3R20A 2XMZA 5TGZA 3DBLA 5AVVA 3HM9A 2HPZA 1ZI6A 4YT8A 2EL9A 4GOND 2PA0A 1FFBA 4GI7A 3JYHA 1TQ2A 3O91A 3FWKA 3PCRB 4FHDA 4UEWA 5ALLA 5L3SB 3FMIA 1BMFD 3LPCA 6PFKA 1X42A 4CVNA 1H69A 3R41A 5G1NA 5HMMA 2GJSA 5IC5A 2W8ZA 2WYWA 4JA0A 4EJMA 1DJNA 3OWOA 3TJZA 2OCAA 5IMBA 1REQB 3H84A 1IEQA 4RVDA 4B71A 2G40A 2BL4A 1B73A 3UJPA 2QE7D 4JJ8A 4HAVA 4UBLA 3OCUA 1ESZA 5KVVA 4K2HA 3PSHA 3VM6A 4WVLA 2ZDQA 2EHDA 2VJLA 3ITKA 4V0OA 3TDKA 1O95D 1YF3A 1FYXA 1ZHOA 4G0VA 1E6WA 5KNCA 1A4IA 4XI9A 3ZXUB 1DTWB 1L4LA 4EIWA 1OH5A 2HRDA 3TTWA 2W22A 4NZOA 1ACMA 1JPNA 3MYRA 1V47A 1WOMA 3GGGA 3JQRA 4I50A 4Q4LA 3AVPA 5G0TA 2E3JA 1TF2A 2E5WA 2E2WA 3TCXB 5FPHA 3HFJA 4RO0A 1RS0A 3QPCA 4YRTA 4IJUA 5IHXA 3PC8C 4PN3A 5JNVA 4FJ1A 3GOHA 2V1UA 3GT0A 2AE1A 3JYQA 1JLRA 2AFHA 1D7OA 3E82A 3EVDA 1Z38A 3LCUA 2RHRA 3A3OA 4W1RA 2VKQA 3N3AC 2BGUA 3AUUA 5BYJA 4Z7OB 4R8KA 1LTHR 1QHEA 1Z0SA 1QZXA 1XQ6A 2DE0X 1YVEI 2BBOA 2HY7A 3EMKA 1J07A 5EMHA 4II2A 1ONBA 2DFDA 4BN4A 4B76A 1L6RA 1Q3HA 4Z7NB 5F64A 1BOFA 1V1MB 2KHZA 1S4MA 1BO6A 2ABWA 2D7JA 5DZSA 4BGEA 5LKRA 5M04A 1KEPA 5ALPA 1OA0A 2A4MA 3RBAA 1SUDA 3VR0A 4Y1EA 3L46A 3O26A 4BNYA 5H3HA 1TVCA 3PTZA 1I4DD 2VBIA 2VCEA 2W6OA 4KVZA 4MO2A 4U2GA 4XGKA 3U44B 3CIOA 2F64A 3PB3A 2QW0X 2HMTA 3KTAA 5J5AA 3CNOA 4KR0A 1NI3A 4DQDA 2ECPA 5BQXA 3NTRA 4LNUA 3SR3A 3IOYA 1XZQA 4X41A 3RIXA 3EDCA 3DO6A 4QATA 4ZOLB 4EVSA 1FX0A 4KPUB 3MJCA 4LHSA 5FWDA 4LQLA 4HWKA 3PDUA 3ELBA 1Z5UA 1TZJA 2O3TA 1V3UA 1T8WA 4LNAA 1O4WA 1WW8A 2QTNA 3OQIB 4UUQA 4XYMA 1RAGA 3VU9A 1F7UA 4PAWA 1ZAYA 3DONA 3O4IA 5HKKA 5TLSA 1OAOA 3K71B 1QKIA 2RDMA 4NCKA 3VC2A 1BE1A 3AHDA 1M6VA 2X0NA 3QP9A 3LKZA 1DX6A 2PUJA 3F5MA 4BJ3A 2D74A 2XCRB 1GCGA 3ZQ6A 2ODWA 4AIIA 4FNGA 3AQ4A 2CNOA 5U1PA 4B8YA 3RSHA 3I83A 4PZAA 3KTFA 4YR9A 4PLZA 3RU2A 4J0EA 4WXMA 1UBHS 4XDYA 1JLSA 2FN4A 4E5PA 1JGTA 3Q8MA 4FFDA 1GPBA 3PPWA 3L7KA 3SEQA 1TU4A 2WWRA 2Q2QA 1E5TA 1HWYA 3A6EA 2FI1A 1PZEA 2VH2A 5JRJA 4ND5A 1A8QA 4GDFA 3AF4A 2FX5A 1DT5A 2I4OA 2YN4A 2L0XA 1EUCA 1YB1A 4MMZB 3KQLA 1G3QA 4PSUA 3FHTA 4HWOA 4B4UA 3HP1A 4LYFA 4N0PA 4UAUA 4WKGA 3LDUA 3VU1A 5C46F 2OKGA 3INNA 3CWQA 4Y98A 2VYVA 4KSYA 2EX1A 4HAYA 1VTKA 2I4IA 2DMRA 1Z7BA 2XLBA 5FT9A 1PT9A 3CVYA 4O2BF 1A9YA 2YS6A 3COVA 3T41A 1HH4A 3WG9A 3WP0A 4MYTA 3WI7A 1VIMA 5TPZA 1O9HA 2UUAB 3FWZA 2NWQA 4Z9BA 2BFCB 2H16A 4IQ8A 1G9XA 3H2ZA 1SIBE 4G23A 3WJ7A 3ZVRA 3DLTA 1M1NA 2HH9A 2WE7A 1R5JA 4FEGA 2XUQA 3NV7A 4R8RA 4U7WA 4ZQHA 4PZDA 5E2AA 3T9CA 1JH8A 3UV7A 1BA3A 1NBMD 2A33A 2JFOA 1ADBA 2R7NA 2WVJA 3WAKA 1IOWA 4N0EA 4HC4A 1XMVA 1XRQA 1KORA 1HDOA 2E5FA 1OWOA 2G5TA 1LBIA 4FLFA 4K9LA 3ZWAA 4NFSA 5JRDS 4EQ6A 1XDWA 4K81B 1OBCA 1V11B 5HA5A 3SXUB 4AAYA 1IM5A 5LIPA 1T3SA 4PLHA 1R4NB 4W7HA 1UPTA 1MQAA 2XDQB 3GLSA 1ZQ1A 4QYMA 4GUDA 4BVAA 3SLRA 2GXSA 4PF1A 3A1FA 4DEXA 5C0OE 1F5NA 1KDOA 1VKOA 1T2UA 3BH6A 3DCYA 3VOAA 3WO1A 1XLVA 3CA8A 3GFFA 4YUAA 2P6RA 4XVUA 1IEXA 3T3DA 3UVEA 2QLBA 1B2RA 1ABEA 2NGRA 1UL1X 4Z4GA 2OO7A 3GNTA 1H6BA 1VYTA 4I36A 2HF8A 3OTWA 4EB6A 1RXVA 4RE5A 4XJVA 1PJLA 2QKYA 2OHIA 5DCLA 1VMDA 1UBFA 5DGXA 4N3AA 2OHGA 3H11B 4HGOA 1C81A 1B76A 1SUIA 2ZKLA 4KR6A 3ITNA 4G5RA 2PL1A 5LB2A 3T9DA 3TZEA 3IRVA 2BEVA 4XZ3A 1V5WA 3AY0A 4ZKDA 4B6QA 1H2WA 4KPEC 3KQWA 3WB0A 3FPLA 3JWPA 3DOFA 3ZHZA 3A9RA 4Z7QB 3R75A 1AUOA 1P75A 3TG8A 2OCYC 2P0EA 3RHTA 5KYVA 1ECPA 1U8ZA 1FNMA 5EQTA 4MV8A 1GFWA 5HRUA 1VZ3A 1XTTA 4P33A 3SYTA 4H0NA 2H06A 3SAJA 3QKRB 3OQHA 2CFRA 5IDYA 2XGGA 2PZMA 4Q5IA 5B30A 2RGCA 3HEBA 3J80A 3O47A 3S6JA 3KCQA 3N74A 1Y8RA 4JN6B 3RRXA 1PFWA 1PVVA 3ACBA 1KS9A 1DRJA 2G0TA 1K5GA 1PAUA 1XB2A 3DSRA 4UE2A 1RBZA 1W76A 3PFFA 4OHFA 5DLQC 3T3OA 5KSWB 3LYAA 5E7MA 3FMVA 1KFJB 4OCZA 3QYJA 3UT5B 4GX2A 4JOBA 4IIHA 1K75A 2G0AA 3LHSA 3Q3JB 4LRTB 4EI7A 4WMLA 2IS1A 1OF1A 4DFDA 1JAYA 3DR3A 5T8KA 4DXAA 3NOOA 4LCBA 2ASEA 2IP4A 4ANFA 2FE1A 1VJ0A 3NC0C 1QIJA 3L8DA 3BQ9A 3FFTA 1X74A 1Z6XA 3KCNA 4I08A 4M0LA 2RG7A 4WWHA 3ORYA 3V8NA 4M9SA 2ZTLA 4AWXA 2HBRA 3HBFA 1UMDB 3KDAA 1C4XA 4W9RA 4X1YB 3UOGA 2P2YA 5AXBA 3AUJB 2PUGA 1A9ZA 1WEKA 2B78A 2QMHA 3IPAA 4IS3A 5JE8A 4TQUS 3T4PA 3CLSC 3PKIA 4GR9A 3C98A 3UAYA 5B4VA 1WNTA 2W6ID 4JX8A 3CLRC 3CNLA 5AW1A 2XODA 5KNBA 3PIDA 2OE2A 4CGZA 1A9QA 3C14C 4ZAVA 3BRCA 4P5EA 2EIXA 4ARBA 1C1DA 2DH6A 2G9UA 5DM70 1T8PA 1RWMA 4HOYA 5D51S 3AERB 3ZK8A 3ZCSA 4C30A 1QIHA 1P1FA 2ZATA 3OFSA 4IUBS 5EPEA 3ORSA 2WD8A 1V25A 1VMIA 4PONA 5ALQA 3LY9A 1JKXA 3E7XA 3FXAA 4L76A 1KI3A 3AOEA 4O02B 3R0VA 2ONKA 1EINA 2ZW9A 3CLTC 3KALA 2FN7A 5FHQA 1WD7A 3U1VA 3SVLA 1Y48E 1WKVA 3CINA 4XLZA 1GU1A 1JAZA 3Q1LA 2VO1A 4Y6RA 2WHPA 1OTYA 4D5EA 4HCJA 3HXKA 4FIZA 2AYXA 3JQAD 4GG1A 4KMOA 5L3VA 1RYNA 1G16A 3VSCA 3HCDA 4G97A 4BASA 4NOLA 2XUJA 4CFYA 1ZN8A 2GR9A 3REGA 4NU6A 4F85A 3QWIA 2AOTA 2VT6A 2CB9A 4HNAB 3UMFA 1YKFA 1KEEA 4NFLA 1RAHA 2V5AA 1ZW6A 4HDSA 1DGQA 1ODFA 3EB9A 4PSDA 4PAOA 1JXMA 5E4YA 5KWSA 2EQ5A 3HNPA 3WL7A 1O77A 1AOXA 4CLXA 1M2HA 3ASVA 3FLAA 2C2GA 3B12A 3OLWA 4TWBA 4ERXA 1YMUA 1GUAA 1ZW1A 5DK6A 3WRYA 2IYSA 1ZC3A 1HRDA 1IUOA 1US8A 3NNDA 2OFPA 4RMJA 3ZWPA 1U8XX 1P3JA 3UATA 1QX3A 3KWMA 1EHYA 2X9LA 4OLAA 4J1QA 3B3QA 4L2IA 3RPEA 4WK0B 5KDOA 5DGHA 4IHJB 3UJAA 2C9CA 3L3BA 4MJXA 3QXGA 4WASA 2QXYA 3QF4B 4H6VA 1M2NA 721PA 1V3TA 2VWGA 3RNOA 3VR3A 4G07A 1M3SA 4HPWA 1J2YA 3T5GA 5MN4A 2YOHA 5KINB 4HNHA 1Q21A 1OXMA 3HDYA 2G80A 3KM0A 5LP6A 3HS3A 2FOIA 2F3SA 1V8DA 2WE8A 3COZA 2JH9A 2PUEA 5L6LB 4HDQB 4L4YA 3KLOA 4CM9D 3VC7A 2XBLA 1T5IA 1H85A 4ZO8A 1FYVA 1AN9A 1SXJC 1BRMA 1FFYA 1K7FB 1DX9A 3EXFB 1ADJA 2QM3A 5EG5A 5HR5A 2PLWA 3IULA 4DQXA 1XIVA 1YR2A 4Y0AA 1KERA 3HLKA 4IJWA 3GB9A 5FF9A 2HX1A 3VPFA 3UZUA 2C9OA 2R62A 3V4LA 2PKEA 2DXIA 3GRYA 4IEFB 1CNFA 3KFXA 1G8PA 3LS2A 3QFRA 4MUAA 4DMHA 4YQZA 5EJ7A 5J4KA 2GEUA 2F4VB 5CT4A 4HBZA 4IILA 3T0IA 3ZY5A 4E5DA 5EJ6A 4BC1A 1R0KA 1ADGA 4YTEA 1IJKA 3QK7A 1PR6A 1W36D 1T5LA 5ALMA 3RSZA 1YA6A 1PT6A 1QAMA 1CP2A 1RMYA 4MQBA 3LVBA 4IDEA 4EYEA 8ATCA 1KAEA 5JW6A 3PGVA 5D00A 2E82A 4ZYLA 1XJ5A 3W4IA 3AK4A 3IL2A 3SZOA 3T5AA 2VP6A 4G9EA 3AI7A 1SD5A 4D1YA 4F84A 3R9XA 1SIWA 2LDXA 2YVKA 1IY9A 1X7XA 3EGVA 4LBYA 1WBBA 4KR3A 3VNUA 1LJUA 1EQAA 2UZ3A 4X6UA 3GARA 2Y1EA 2P6UA 3HWSA 3IUPA 4NCHA 2H9YA 4AM8A 4GWKA 4KH1A 3RYTC 2ID4A 1TZCA 4PYMA 3ND6A 4QYTA 3A9SA 4CIAA 4HZUA 4U7DA 4Y1RA 4GOOD 4ZHQF 3DDHA 1PL8A 2C29D 5KX5F 4E32A 1OQAA 1R6BX 5FLKA 4ZI7A 3IKJA 2BUCA 1ZMTA 5CT6A 3G8DA 3VPGA 1F9AA 2WAXA 3WOHA 5LMUB 3EXG2 4ND2A 4ALNA 4OI4A 5BN3B 3C6MA 5JOQA 2R1UA 3JYOA 4EA6A 3ZIUA 3AEUA 4JLPA 4LNUB 3OZRA 4RKFA 1PFVA 2B61A 2Z1DA 3U2QA 5EP3A 1U0EA 2NSLA 4YP1A 1Z82A 2G83A 5HBRA 4KX5A 5FTNA 2OV3A 3LC2O 4G8CA 1X8JA 3VSEA 3BERA 2UVPA 1NUTA 3OTHA 2PGLA 1RCUA 3M0EA 3RRJA 4JVMA 4QRDA 1I3OA 3OTGA 1EE9A 1BROA 1MEEA 3H0CA 1KMMA 1QBGA 1K8RA 1F2TA 3DUWA 4K6OA 4YONB 2E4YA 4FFNA 4O3FA 4AJIA 4XVRA 4XAQA 2OOSA 3VO1A 3OQOA 3T9FA 4DWWA 3CF2A 4JYMA 2ZT5A 3WL3A 2P75A 2QLMA 4WFQA 1CUEA 1PSZA 2WT9A 3CJRA 4FNAA 4U5QA 4EENA 4OP2A 3HXQA 1NF3A 2AOVA 3ZLJA 1J42A 3RUHA 1LPSA 3VYSB 4UC0A 1THMA 4HX2A 1APBA 1LPBB 2QOEA 4MYSA 5BY2A 1GUZA 4LTMA 1T9GR 2OWDA 4Z54A 2W8BA 4JY7A 4MKXA 3CRZA 3QEOA 3ADKA 4FR5A 2AQIA 4CMKA 2JI4A 4W7SA 2ZJZA 4HLQB 1DEHA 3GGSA 4E5KA 2JCSA 1EUCB 3MC1A 2FRDA 4NZYA 1Q95A 1U0OC 1RTTA 4Q47A 5IARA 2XB2A 4ND4A 2C8JA 1O6CA 2ZS8A 1YRQA 2R1TB 5LQSA 3VSBA 5DEIA 4C76A 1SUPA 2ENUA 3VH3A 4ZICA 1E2JA 1OYVA 1P5ZB 4YV0A 2XWQA 4EW6A 1JFLA 2HMUA 3T5PA 2QJTA 2YFHA 3D1VA 5G3YA 5LL6P 3GPCA 2O8CA 1W9HA 4CT5A 5CLHA 2VZLA 2PT9A 5AJHA 4EH1A 1XYVA 2P3SA 2GO1A 3LHDA 2I7VA 4YV2A 1AV7A 2GAOA 5K99A 5DGTA 3ZCRA 2I6TA 4B85A 1A7UA 1EK5A 1U0NA 1X1QA 2CBGA 4G4GA 4HB0A 5EKXA 3EOZA 4P98A 3OX2A 4FJ2A 2O2YA 1AQNA 3O8OB 1THZA 4QA9A 4DZTA 4RVCA 3W5AA 3K32A 2AMYA 3MHTA 2R4UA 3MJTA 1B41A 4QEKA 1R00A 3HWWA 1NAHA 3IR6A 4HGZA 4MW9A 2RGEA 5A9SB 5L3QA 2NIPA 2NU6A 3R6TA 2AG1A 4YALA 3QE9Y 2XADA 1NL3A 2DC1A 3IYLW 2XT6A 3AY6A 4XGNA 3ZHQA 3NT2A 3RVBA 5EMNA 2PD4A 1LH0A 4CF3A 2H7XA 5HCNA 4BZQA 4LYEA 2Q45A 2B1IA 5FLYA 4OI1A 3PIRA 4D92A 2MSEB 3FN4A 1IPFA 3V4FA 3RYCA 1I2ZA 3G2NA 5FNVF 3PZBA 1UBCA 3HU3A 1QOQB 3BTOA 1K9VF 4BU0A 3KL4A 1E9AA 1NIJA 1VG0B 4MPPA 1Z6ZA 5LXTF 4DIMA 5IZ4A 5DRYA 5CEFA 1D9ZA 3ZCQA 3WLLA 1T0BA 5FORA 3KWFA 5REQA 1M2WA 1K68A 1YJ8A 1Z83A 2BFDB 3CZMA 4CIVA 4F4JA 1CJMA 4I46A 4EFKA 4KWTA 3C74A 5HILA 1LNZA 2D1RA 3HYNA 4TOIA 3TVDA 5KYWB 3FCOA 4ZKEA 2ZIAA 3GJZA 2IQIA 3FWYA 4FMCF 2VHQA 3BHIA 3E48A 3T6KA 2ODBA 5TQ2A 5JIBA 4M0DA 1P1RA 4MW6A 1OXTA 1LVHA 1NJ2A 1RCTE 4KWCA 4Q39A 2BLNA 1O3YA 3K4PA 3E61A 2GUGA 2HRQA 3SF8A 1K4YA 2HIGA 2ACKA 1R6XA 3EW7A 3BRWA 4KLNA 1YA4A 1QTNA 1QV7A 2YZGA 3OFNA 3WWYA 1BFKA 5U4QA 1VSBA 1NV9A 5JZMA 1EGVB 4JK3A 3UT0A 1CBUA 1HMPA 2H51A 3K09C 3VV2A 3X2SA 2DFLA 2JZCA 4H3VA 1D6NA 2ZYGA 5CBKA 1OLUA 1FDVA 2AD5A 3QH4A 5LD2C 1LBTA 3WA7A 2X19A 4BVEA 1SPXA 1OW3B 4JCOA 1HOXA 1MAUA 3MRSA 3RYFB 6REQB 2QIPA 4MKZA 4R8LA 3I9KA 2ATCA 5EXXA 4NMXB 2HWUA 3KEQA 1XZAA 2HYDA 1WCV1 4K6MA 3IDSA 1KYIA 1KH2A 2X0JA 1FSPA 5BR7A 4D3FA 2JNWA 4O2BA 4K87A 1U7UA 5ALTA 4DBVO 4ZGWA 1EVIA 1PJZA 1TUBA 1WF3A 1P62B 1BDIA 4OF4A 1Z56C 1PJBA 1VB3A 1W75A 4FEAA 3NS7A 5LDHA 2C88A 4JDUA 3QVTA 2P2LA 4FNOA 1WMEA 3SCZA 4A8JC 4JKOA 2COEA 4V0RA 3LFUA 5LYJA 4B17A 1PNQA 5CW2A 2HNKA 2Y99A 2IXAA 4M0CA 4N5DA 4O4IB 4WCFC 2GJAA 1DKOA 2IX9A 3SIPA 1MD9A 1A9XB 1NBMA 4CRWB 5C2JB 4EPXA 4GYJA 2RKWA 3QPAA 3UWDA 1KBZA 1J8YF 3BWYA 4UKDA 2FUG1 3GWZA 1Z2PX 2DUJA 4M38A 4G85A 4NDAA 1A2KC 4U0JA 5EMJA 4FOSA 1HE1C 2GLTA 3CRQA 3M6IA 3BJZA 1O5TA 2O6HA 1GGMA 5F1YA 2J0QA 4P53A 2WPDA 3TUIC 1E2QA 3GLIA 4O2AB 4RD6A 2R65A 3CIFA 3T1QA 1NN0A 1XG5A 3PD0A 3CW9A 2QTBA 4CKYA 3EIUA 1ZVQA 2DJ5A 5CA0A 4KK3A 3MT7A 3U60B 1L9XA 4IXDA 4XRGA 5K03A 1KGDA 1U7PA 1VKZA 4P4LA 5JAPA 3NEPX 3TF5A 2XYGA 5EHQA 3TGWA 4MGYR 3NJ8A 4PQEA 4X91A 2IUFA 4ZC8A 4AF8A 3I4CA 2OZVA 3NBXX 3FMOB 2EP5A 3OE1A 1J0CA 2AEJA 4MCHA 3VZQA 3GEBA 5KTYA 2XBMA 2XQVA 2ZJ0A 3IQIX 1PR2A 2P78A 1B8UA 1BCSA 1A8UA 1CC1S 1QV9A 2BFBB 2X9QA 5CT5A 3DULA 1KRHA 1SU4A 4LHXA 3WIBA 1ESCA 3ZWCA 4EW3A 4N9WA 1DAOA 3KQHA 1Q91A 1K6EA 3K5PA 5KEIA 3BXXA 4KOAA 2FR8C 3B6KA 1L5HA 5FPKA 1TGYA 5CCXA 5AXAA 2ZI7A 4QLBA 5KTPA 4P3NA 4ZT2A 4RHYA 1JJFA 1BS2A 1HTWA 2EZ9A 2O50A 2OL4A 2YBEA 3SWWA 2VTBB 1CJTC 4L8WB 4FFBA 1BW9A 1W9MA 1T9GS 1FJHA 1DU4A 4M7PA 3QUSA 2QUKA 5GJWC 4DEYA 3JVIA 1KY5A 4RNCA 2GRAA 4NCJA 2NO7A 2Q41A 1CP3A 1E3MA 3D31A 5KNDD 3Q12A 2GOYA 1E61A 1YIOA 2C7VA 3AINA 3DDZX 1HPLA 1FRZA 2QG4A 3UG7A 3V55A 3X0DA 4C7BA 3I04A 4AZ0B 2BT4A 1ZEMA 2CLEB 2JLQA 4RSGA 1VKRA 4PFQA 2GEKA 2OQRA 1CQZA 4QBFA 1ZNYA 2WM2A 4NOJA 1A5BB 2Q4BA 1SO8A 5LP6B 1MV8A 1DRWA 3E9RA 2VDJA 3C4JA 1H42A 3R24A 5MFZA 2IU4A 2M6KA 1RYHA 1MAWA 4A2QA 3OZDA 4KU4A 1EXWA 2H1CA 3M9LA 2B30A 1I24A 2G9VA 2G1UA 4HUQA 1EB9A 4CCAA 3JD2A 2KJQA 1FDUA 4ZYUA 2BV3A 1JVNA 1QIMA 4L57A 3KB8A 4FYHA 4OMFG 1JI3A 1PGOA 3I61A 2XOEA 1GL7A 5BR1A 1F2DA 2W6IA 4TM7A 5KQMA 1J00A 2JBWA 5HFAA 2ID8A 2IVFA 4LJ4A 4LJ5A 4YIHA 1DELA 4R7ZA 4JB8A 4LHWA 1EBUA 4I3FA 2ZETA 4KI0A 2AUNA 4F46A 2XUKA 5AUQA 2ERYA 3ON5A 2QRKA 4NXMB 1ND5A 3WL4A 1AGPA 2IGTA 2WMNB 5IWCA 3VA7A 1TVMA 3ISVA 4J1TC 3ZDAA 1MDFA 1E9SA 2H11A 4P4GA 2GBGA 4PGGA 2BHRA 3LC1O 4CTNA 2WHRA 3EXEA 2GHRA 4RGBA 1EQUA 1FW8A 2ZBQA 4IFBA 4UHDA 4UULA 5A04A 3RR2A 5B1YA 3RROA 2B8NA 3GJ6A 1KDTA 4NQZA 3GCXA 3K9BA 4IQFA 3LA6A 4X3OA 1X7WB 2A5LA 4N5HX 1PKXA 1CIPA 4CKCA 2HA7A 3AONB 1YR6A 3JZIA 1KY3A 3WFIA 2CE7A 4XGRA 2G6BA 3O3NB 4WDRA 2V98A 4HZUB 1Z45A 4DLBA 1WHTA 1Q0HA 3ER9A 3C1UA 4OQMA 4X65B 4Q01A 2R85A 1M2FA 2X0KA 5TQVA 1FF9A 2HCFA 1V9SA 4LOIA 3SD7A 2NUTA 4OGKA 4Y2QA 4F56A 2ZIXB 1E3DA 1I8TA 2EV9A 4KN6A 5L51A 4C3VA 5ADHA 1TLLA 3CCCA 1F8YA 3AG6A 1QG2A 1XEWX 1G3IA 3EEYA 4MDHA 3CR8A 3I9NA 4MMXB 5DE3A 1J90A 5M5BA 2WKSA 4GOJA 3WA6A 1KZHA 1SVWA 1FDIA 1PR4A 3LLCA 3PU6A 2NQ8A 4HRAA 3ZFOA 4FINA 1JZSA 1Z4OA 2P0AA 5SV2A 1IHYA 2HEIA 5GINE 1Q5PA 1ZX1A 4JYCA 1DKMA 4PR3A 4IPTA 5JY1A 3BWBA 5LOVF 2QY6A 2QXTA 3NBUA 2I2CA 1GGHA 3UYKA 3PQ5A 1Q84A 3Q7IA 1X70A 3AB8A 5TE9A 4XQCA 1F2TB 1W0JD 2I66A 3CUUA 3UAVA 3C8HA 3ILXA 4CQMD 4FR2A 2E37A 4PZCA 4R71A 4HDAA 2JH8A 4M0KA 1BX0A 2Q6VA 3MHPA 1ECLA 2IU0A 2H2DA 2JZNA 2H54A 3V34A 3FOZA 2HFKA 1HXHA 1FSSA 1VZ2A 1J0AA 1CW2B 2ZU0C 2ZYAA 3C4VA 3DBRB 5IDWA 4YWHA 1JEEA 1GFIA 2OBMA 4ER0A 4FCVA 2NO1A 1QH9A 3TQRA 1FDTA 3AU9A 4KIFA 4CM9A 1R4MB 1WMSA 4NS4A 2PTHA 3ONDA 1XQXA 5KKNB 3DOCA 5T7BA 4M89A 2ONJA 4C2AA 4UHEA 3KQVA 2PSEA 4GYKA 1C8BA 4MR7A 4N6GA 2PXXA 3LZDA 3GRUA 1TC1A 1GARA 3ZHBA 1E4OA 2C9BA 1IZ0A 4N3BA 1P45A 3GNSA 5ALDA 5BWNA 3AKYA 1A5ZA 1U2SA 5EEGA 2IYLD 2HU7A 1NI4A 1TF5A 2ZYDA 3F6PA 3W04A 2WQ7A 1GZ6A 3GLKA 3I5UA 2X3UA 3TRJA 2GHIA 2Q9BA 1BAPA 1PGJA 1S2OA 1SH7A 1XXHB 3EEBA 3H83A 4RQTA 3D2CA 5DTMA 4ZRDA 4KR9A 2XWPA 1MO6A 2CY0A 4H08A 2YY7A 3PUZA 4FMPA 3Q3IA 4J0CA 4DADA 2HTEA 5I45A 1KVTA 1O97C 3D8TA 4V0QA 3KT8A 5EJ5A 2Q8QA 4QTUB 4MP6A 4EYQA 1XQYA 2V4ZA 5F2NA 4NZMA 2EG5A 3GDOA 2WSIA 3A4YA 1ONOA 3CMCO 1NOJA 5FL3A 3WB1A 1N7HA 1KRWA 3CW2A 1EG7A 1YA8A 1TUGA 3EVTA 3OWXA 3W79A 5L3QB 4G6ZA 3A4TA 2NU9A 2NU6B 3NG1A 3CZ5A 4UZFA 4YROA 3DEIA 5KX5A 2TYSB 1Z08A 4QBTA 2P9CA 4JI1B 1G4AE 1GR1A 1XU9A 3O95A 4RW0A 1EA5A 1HTBA 5CDFE 3DWGA 3OMWA 4GL4A 4HDRA 4BKMA 4W9NA 4Q3KA 4FFWA 1MO3A 4RKQA 3A0UA 4O8ZA 5I7UA 4I8XA 5L4SA 5C1IA 5CXSA 3HHPA 2FE4A 4MVJD 4WA7A 5GZ1A 1L1QA 3UC5A 1UT8A 2FAXA 4CIYA 5GVSA 4RM3A 3S8YA 3PX7A 3PPIA 2EFHB 1L5OA 3G0OA 4MVJF 4RSHA 5B5SA 2PKWA 3AJ8A 2JASA 5JDCC 3VPCA 3KETA 4MGEA 3HB7A 2UXDB 3ZJ4A 1DCMA 5FA8A 3Q3HA 4OK5A 1HM5A 2J5KA 4O8CA 1XZKA 2L17A 4OQDA 2G04A 2G8NA 1LPAB 2UUOA 3OUTA 4LC0A 3F7OA 4AMVA 5IUNC 4QUEA 3G0GA 1HDIA 2A78A 2XX3A 5KYUA 4G0OA 5I9IA 1M7BA 1HYHA 4HJRA 2AC2A 3K1YA 3G49A 2NYUA 3RTAA 5JZVA 4J0KA 4UTVA 2VQ3A 5I9MA 4CV0A 4CT0A 4NU8X 2Q5LA 2F67A 4QWWA 4U8GA 3C16C 3LHFA 4QTTB 1II8A 2EFDB 2NTVA 4UUMA 1OLUB 4CLOB 1JA0A 1HK7A 2Y0BA 5C34B 3O6VA 5ICMA 1LUAA 4KPFC 1BGXT 2AJ8A 3TI9A 3VU3A 1BCRA 1LV8A 2XTNA 4K03A 3USES 1UWVA 5D3MB 3E2MA 3EVAA 1QHGA 3MFQA 4JA2A 3ICVA 4PG7A 3SICE 3W2HA 4CN8A 4BEBA 4UTRA 2X8JA 3OFKA 3U9SA 3DVLA 4JV5B 5CNIA 1TQDA 3H65A 4JD5A 4PVCA 2FQXA 5E6SB 1YR8A 2OMKA 2C8LA 4FC6A 4ILEA 1M2GA 1LW7A 1K97A 2TMKA 4P34A 5BOVA 1PSWA 3N0WA 4L4XA 5BVHA 3RSGA 4BUZA 1O08A 2M1ZA 1K1EA 3QNMA 3R4CA 3T3MB 3EW9A 3KEFA 4RHCA 2F17A 3FR7A 3QLUC 4HXFB 1B14A 1QF7A 2FVXA 2PO7A 3ENKA 2OGSA 1KOLA 1YACA 4I5IA 5CYGA 1P77A 1T34A 4OBXA 4IBOA 5LJIA 1SCDA 5TNXA 3G7SA 4DSUA 4K5QA 2BFPA 4MQUA 4PSAA 2J67A 3EPKA 2Q3DA 1KF0A 5ECDA 1HNXB 4QAJA 1P0FA 1M2VB 1WVGA 3EGCA 2F1OA 4PVDA 1U5AA 3JQFA 4J0IA 3QBDA 4QPZA 4MEJA 5DMXA 3K0SA 1S9HA 2EKZA 1YIAA 2XQIA 3PNPA 1AGYA 2QP4A 3KZVA 1C9JA 5EZYA 1E1NA 3AEKB 3I5AA 4P5DA 1BJRE 4PO1A 5FNVA 1EGAA 3EIOA 2V7QD 4WZAB 4Y2XA 5LXTA 2Y0CA 2IS6A 1JPJA 1RWQA 1TW3A 5FBLB 1RRKA 2A9FA 2GCOA 3K2BA 1UQTA 2YBDA 1JQLB 2V97A 4RF5A 1Z18A 1IXKA 4LRWA 3ROPA 1P2GA 4PZYA 5F9FA 2P9TA 3P96A 3RYIA 3KKNA 1BH6A 3NM5A 4JVNA 5FFFA 2WOOA 2W00A 2VYND 4RFVA 2PZKA 3B1XA 1SHZA 2CVHA 1TJ4A 3KSZO 4PLGA 3UANA 3V4VB 1N5RA 3U3KA 2PV0A 3G5TA 3VXKA 1MAHA 4JJAA 3VI3B 4QGGA 1I6LA 3O4JA 3LVQE 1U28C 4J07A 2Q5QA 3SHQA 4GHWA 4U5XA 5G1OA 4TYPA 3CTPA 3DV0A 1UIRA 4KMRA 4UNIA 4Z8XA 4ASUA 4CF6A 2XE6A 2JAHA 4BFUA 3CKLA 5I7VA 3H9CA 3CZRA 1CF2O 1J06A 5JANA 2PLNA 4JQOA 1L5VA 1FFDA 4JEUA 3I1IA 3SIXA 2D2XA 1SA0A 2Z2JA 1JDBC 3ZZUA 5K9ZA 3Q7QA 4D80A 3GAZA 1QQ5A 2FQQA 3LYLA 3TUZC 1Z3IX 5AJXA 1SQ6A 1PDWA 1VE1A 3DE2X 3DOUA 4HQNA 5FH9A 5IC4A 4CHTA 1SHKA 3IO5A 5F4BA 2IDZA 2PU5A 3B3AA 3W5IA 5BOSB 2YNMC 4PW0A 5JCPA 3VTAA 5FA6A 1DWOA 2FW9A 2W37A 3PYMA 3L04A 2OO5C 3JQQA 3F96A 3WDMA 2PUDA 3M6VA 1R3UA 4LGMA 5TS2A 4AJHA 1DC3A 2Q1TA 5MN5A 5TMPA 4EWLA 3TE6A 5F23A 1VHTA 3IT2A 4RVHA 3W5DA 2ZRHA 1WABA 1SOUA 1QHFA 5HJ7A 4GQAA 4BO9A 3IXLA 3HEAA 4KQ1A 2R86A 4UHCA 3AW9A 2EAUA 2VP9A 4B3IA 4MDFA 3RRFA 4D41A 4LJRA 2O8FA 3GVHA 2SKDA 4C0HA 1D4FA 2G5GX 2JGFA 3ZFTA 1YGYA 4IV0A 4L0QA 4BLUA 4RTMA 2B6HA 4AKIA 1JEJA 2IHYA 2OXEA 3PC8A 1S89A 1AY0A 3G0BA 4Q48A 3U7QB 5CVUA 2H00A 2V96A 1XJQA 1BS1A 1BJTA 1UZMA 1KPHA 4MYHA 3VFDA 4DF3A 1AGNA 4X64B 1A9OA 1V7QA 4RC9A 4R1UA 1C9MA 4B75A 2CB0A 5ITSA 3ZVMA 3F8SA 1WDLA 1IBKB 2Y4NA 3THYA 1N2JA 2J9RA 1XP8A 3H2BA 3LQFA 3IMEA 3COYA 3VZRA 1DG1G 1Y3IA 2XPCA 3ZOKA 5K0NA 5IRCD 1UXIA 2P9EA 1PT8A 1KO8A 3V4SA 5KUTA 1WHSB 2BDUA 4YMTA 1AE1A 3DZCA 2LD4A 1USIA 4BFZA 2EJCA 1J8QA 3LT5A 4FC7A 5HK8A 3W6UA 4G0UA 4E2FA 2D8AA 4OXXA 1CRLA 3JARA 3KYDB 3S1AA 1PKEA 2NXEA 4KQ9A 5ECGC 4AJ1A 3H5OA 4OKSA 2JLBA 3G9XA 3RUDA 4EITA 1KDZA 3VKHA 3BH0A 1YT5A 4JUDX 1GTMA 1BVYF 2CL5A 3K8YA 4YP5A 2C84A 3CVUA 1F0KA 2AF3C 4PTZA 9MHTA 1QB7A 4YT5A 4F6RA 1TYEB 4JVSB 2K7ZA 2FWJA 1KSFX 3BREA 5KQSA 1D4ZA 2VP3A 3EVNA 3PUYA 4FQ7A 4LX8A 5ESRA 4D4LA 2C5GA 3OZBA 5HE8A 1RACA 3DQZA 4RZUA 3ZHOA 5JSUA 5F2OA 3EBLA 5CDSA 4IO0A 1WHTB 1Z8HA 4JGBA 4ZOCA 2C98A 1QR6A 3M6LA 3UK0A 2JFUA 3LT4A 2PO5A 5AICA 5E8JA 5IUKC 4S2UA 1GG9A 1XTVA 3LVRE 4MLZA 5KC8A 3U61B 3QYPA 3OE7A 4PXAA 3O9VA 5A4AA 3AMVA 1NN1A 1T9CA 4ED9A 3KRTA 3TFQA 1ZP6A 4O4IF 1Z2AA 1E0SA 3WLKX 4AWBA 4QT4A 3GVIA 4OQZA 5BQFA 5K8UA 1Z34A 1E3WB 1OR8A 5DXAA 3DMTA 4NEHB 2IYPA 1NUSA 4E15A 2RGYA 5KNDA 1KMCA 3C39A 3HVUA 3HUDA 1O2DA 4WRRA 4CKEB 2FF7A 3O1JC 2PT6A 2UZ0A 1MF7A 1F17A 2Y6UA 5IDQA 2VRBA 3S2SA 1XVTA 1W0KA 3FOAA 4PC6A 3OJ0A 2PL5A 5TMEA 2QSJA 3OSUA 3I37X 4JZYA 4O2AF 3L41A 4JXKA 4E2YA 6AT1A 4DNXA 1CFJA 4NECA 2V6BA 3INYA 2FEMA 3Q40A 3MFDA 4TZKA 3SZLA 5EXTA 1PT7A 1OTHA 5HIMA 5CAEA 4DB4A 4AQYB 1N6LA 3CG0A 3TLGA 2E4XA 3P8ZA 2XGMA 4K9DA 2GWRA 1N2GA 4PQRA 5CCDA 3L5OA 5AD1A 5K05A 5DBHX 2CVPA 2A1UB 2LIVA 1XE3A 4WGFA 4L0CA 3DVQX 3C3PA 4ODIA 4BMOB 1FRFS 3SBDA 3UPDA 2YVLA 1ZVMA 2CEAA 3ZK7A 3VPSA 2BJHA 3FE2A 5FOVA 4DMFA 5AK5A 3WQBA 1YQTA 1SD1A 1Z8FA 5AW2A 4AKTA 4M1OA 3OE5A 3NJRA 4NCXA 1CU1A 3S27A 4B2PA 1RRPA 2VP4A 5JTUA 2V0NA 4JP5A 4LZPA 3UNXA 5AHXA 5K0EA 2J0SA 4BGIA 4KVAA 3KAPA 2OGTA 2K5UA 3LDGA 4QUAA 3U09A 5DNAA 2BLLA 1E2GA 3G5AA 3A11A 2JW5A 9LDTA 2V6IA 1CEXA 4GMGA 4U8HA 2JJ8A 4DV3B 2QK4A 4KXXA 3S2IA 3DVRX 2FV8A 4YAOA 5EZQA 1DS6A 3UC9A 2O3RA 3ZDDA 3Q3VA 4B6OA 3SF0A 3HDGA 5A9TA 4Z0PA 1XVIA 4IV5A 3AVXA 2CT8A 1F3OA 1RC0A 1X1RA 2WIDA 4GC5A 5E95A 3S44A 3HUEA 3GEDA 4J9UE 5HKOA 5G0UA 2VAMA 1VL6A 1XF1A 1QQTA 3PVCA 4X8MA 4X44A 1JSXA 2AMLA 2W9XA 2YHIA 3L0CA 4QPDA 4YP0A 9ABPA 4LF7B 3M6XA 5GONF 4AECA 3D0RA 1SBHA 3HH8A 5HSGA 3ELWA 2Q8NA 3F90A 4LAFA 5FYQA 3UHOA 5GADl 3N2IA 3CW8X 3G5LA 3QU4A 5C3MA 3H18A 1VPVA 3M81A 1QHNA 1PL6A 2CWDA 1JRLA 1T15A 3CX3A 3GJQA 4JGIA 1NW6A 1VE9A 1FTGA 2XMCA 3GZNB 3H8SA 2LR0A 3DYVA 1HE4A 3A36A 1U80A 4ZCQA 4AURA 3H5IA 1YASA 2OHJA 3KZXA 2RHTA 2VIIA 4PGAA 3HU1A 3EDOA 4AS3A 4MUIA 4I1UA 4NCNA 1PTJC 1Z39A 5JAUA 5LOVA 1X2EA 1XMOB 4F9GA 2DR2A 4BB6A 4C6SA 2B3DA 5I4IA 1JEYA 2EATA 4LK2A 3B1FA 4JZKA 4J2HA 2FFJA 1Z5VA 1KYXA 2WWFA 3BWVA 4AIRA 2BRUC 4QUIA 4D4HA 2BSQA 1VHQA 2NZWA 3MUEA 4M0EA 4HB4A 4BP9A 2PHZA 1T24A 4KLCA 1U0RA 1YUMA 4MR9B 4CQMA 1Q1GA 2AOUA 1QC5A 3ICWA 3CLUC 1L4YA 3N8NA 4NAUA 5FA5A 3E9CA 3HHEA 3C1OA 2UZ1B 3DV2A 4E46A 4F3KA 5I7OA 1WXDA 1IBMB 1Z4MA 2HQBA 2GLXA 3O3MB 4LBWA 2IXEA 3JWEA 4GLJA 3I9V1 1F9EA 1CX9B 4E7OA 3M5WA 4UFOA 1S2MA 4TV9B 10MHA 4RWEA 2P4SA 4FW8A 4B9EA 4BIMA 2OZEA 2HMWA 2AE2A 1ZC4A 2EHJA 3OBIA 5FBVB 1WD5A 4DLSA 1PWYE 1Z7GA 5SZJA 4JHLA 1K08A 4OM7A 1VE7A 1J2RA 3NVAA 1JU4A 3AF0A 3B6MA 3FKQA 3P9PA 4H18A 4AZWA 3A0RB 4RDXA 2VATA 2ZTUA 5AJYA 4EL5A 3U13A 4RGQA 3R5XA 2B35A 4QFCA 5FBHA 3P0FA 5JASA 2XZLA 1TD9A 4G0PA 2P3OA 4BBZA 1I5EA 3MJRA 2VJMB 1ZI8A 1DIRA 2V8BA 1IK6A 1DOAA 2Q5OA 3KQOA 3IEVA 1NULA 4GPEA 4JQYA 1C3OA 4ZVRA 3JR7A 1ZCAA 2ZJ2A 1G8SA 1E92A 1DFIA 2JJMA 3L1IA 1NVTA 4GD3Q 2FW8A 2ZT6A 4CM5A 1L8AA 2A0YA 5BMVA 1I01A 2AFRA 1NSYA 5FOXA 2FXVA 4PHFA 4BO6A 5DI3A 5KYTA 3BGVA 4LJSA 3CRRA 5KJ1A 1UPAA 4WKPA 4WJZA 1UBTS 2OGWA 1C5KA 1P7YA 2HWYA 2P11A 3RARA 1QZTA 4D8XA 3IAUA 4L8YA 4YRNA 3DXYA 3SQMA 4QDTA 4YCCA 4CJXA 1KDRA 3KJQA 3LUJA 3BFXA 1UDWA 5FFMA 3EVBA 3KAQA 5GQSA 1FLDA 5DM60 1U3GA 4ENWA 2EQAA 3A25A 4FU0A 4CM4B 1F0NA 4LPSA 4XSVA 1PBTA 3PVSA 4HGRA 4YJ2F 3GLHE 1NDHA 2AN1A 1TM5E 4DLKA 1DTSA 4O4JF 2HNAA 4X60A 4IO1A 3LAWA 2HXYA 4J4HA 3CH4B 3HADA 2NYAA 5EZYB 1KSHA 4M1KA 3VYRB 2QV0A 4D8TA 1N1DA 2GM4A 2C3UA 1LK5A 2QR2A 3A4IA 3SNKA 4BWFB 1K6XA 3NRJA 4GKBA 2W2QA 2IQ5A 2ZJAA 5HTKA 4JNKA 4EG4A 5FEMA 4M9RA 1XRSB 2LRHA 1DL5A 1FRNA 3M4NA 3NC4A 3IEPA 3KR2A 3OD5A 4P6VF 1KK0A 1P2BA 3PJEA 4MQ6A 4DUGD 1U1EA 3MCWA 3ICCA 3EE6A 3U3MA 4M1QA 3CN7A 1TTHA 1EK2A 4FOTA 2Q3CA 3I5XA 2VT3A 2HAEA 3BUSA 1JNYA 3AILA 4EY4A 2XZTA 3ILVA 4YP7A 2C0CA 4LKRA 3TINA 5B7NA 5JFTA 2RB4A 4UEKA 2ZRDA 2QTAA 1D2MA 4JC4A 4L8LA 5KVAA 1A4UA 3EXIB 2A88A 4MA0A 3IP7A 4QICA 1IH8A 1C0LA 5C3UA 3ZCXA 5IBPA 4PGHA 1R6UA 1J7JA 4KK4A 3IVMA 1HX7A 3CVJA 3P2IA 4UBMA 2NP7A 3KXIA 3WQSB 1P17A 4ZHSA 3ED1A 4B79A 4AF6A 2OK8A 1Q0SA 2JJ2D 4OLFA 3MF4A 5DK4A 2AUMA 4A23A 5EXPA 1P7WA 4NI5A 1L4EA 1O96A 4AVYA 3IB6A 1WWKA 1WV0A 1JILA 4CT4B 2Q6TA 1DEXA 2H07A 4A8HA 3WHLA 1X86B 1G8JA 1OGIA 3EWAA 4FZRA 8AT1A 3RE1A 1RYYA 2Q07A 2FR0A 4RKRA 1SXJA 1UXHA 3GDWA 4JBNA 4WBSA 2GD6A 4LE0A 5K0TA 4F7DA 3AB3A 2F90A 3DFUA 3IEIA 4U2FA 2NG1A 2V45A 2BP7B 2DBVO 2QW1A 3J81k 3GDFA 1XZBA 3G88A 3C7KA 3RADC 3O8QB 1ILWA 3G0DA 1PR9A 2C77A 2OSBA 5ERGB 5FBQB 3K5WA 2W2MA 2OBFA 4Y6GB 4C4PA 1G5RA 1GTSA 2GD2A 1VL2A 3OESA 4PZEA 3A27A 2ERCA 4Q05A 4RPCA 5JSZA 3CZPA 2P9ZA 4R7TA 1WIWA 4J2OA 1CY1A 5ELMA 1XTBA 2RD2A 2I8LA 2XR1A 4QOGA 1J7KA 3FCCA 1PLJA 2X1VA 4TTJA 1MNAA 1M8JA 1HFWA 1RJEA 3OX3A 4LSGA 3TLMA 1QDLB 1T8TA 1NNLA 1UQRA 2IUUA 3FTDA 3H2HA 3I3OA 5IZCA 4PHCA 5EJ8A 2QT0A 4F98A 5L8VA 3EQ9A 4N6NA 3ERCA 3Q2OA 1OJ7A 5EGNA 2J87A 4M1ZA 5D84A 4FMBB 4QG7A 2G3YA 3DMDA 1V39A 3B2EA 3GUZA 2VQSA 3JQBC 1E9VA 2HCBA 2XYQA 2J6IA 4G8JA 3EH2A 3QEAZ 4PNEA 4NENA 2QUJA 1JKJA 1FY2A 4LCJA 5C8YF 1ESEA 2IXDA 3OOHA 3JARB 3TQSA 1GKIA 1KKMA 1Q1NA 2V7QA 2ZUUA 5FL7D 4ERNA 5CA1B 5K3AA 2BPOA 3H17A 1XNJA 2Q2WA 1S3IA 3TQOA 2HMVA 3WMXA 4ENRA 5EJEA 1KNXA 4BX3A 5LLDA 3BMNB 1XTKA 4OEHA 3A6LA 1YMQA 2IEDA 2KI5A 2VOJA 1R0YA 3SJBA 4F6RB 2PV7A 2K7FA 4M37A 1X7DA 1GNQA 1ONPA 3ASYA 1KI1A 4UREA 4EARA 3K1TA 4I66A 3UJ3X 1ESMA 1HYQA 1XAGA 2OXIA 2BGIA 4ENTA 1X80A 1KJYA 1GRNA 2NYVA 2FA9A 2WAAA 3ESRA 3M1AA 4NE2A 4GH5A 4R40A 2NVWA 3K4QA 2O7RA 4G1CA 5IU6A 4FFPA 2XV1A 3HKDA 5ER6A 5B7QA 5DNYB 4BLOA 3BMCB 2ALJA 3GJ4A 5TGTA 3ROEA 4QOHA 4BNGA 3ROTA 5E3HA 2HF9A 3NANA 2P40A 5JH7B 5AJTA 4K9MA 5KQLA 1PCXA 5HZGA 1CUVA 1DXQA 2GBPA 4BL5A 1JFTA 2RI0A 1JHQA 4CQJA 4YPOA 4Z86A 4AULA 2BDTA 2XYRA 4IM7A 2RC5A 2ZVDA 1JEDA 2YV5A 4EJFA 4GI2A 1UBLS 3PGMA 2G4VA 5I8WA 1DNPA 1DT3A 1K3FA 1KQ3A 1UOQA 2X1HA 3ZGOA 3THWB 1MTZA 1E62A 5I7RA 2HLPA 4MX8A 4MWDA 1RRVA 1ZCBA 3TXXA 4IVQA 3I2JA 1DV2A 1NP3A 4BQNA 3OKAA 4JUCA 4M8IA 2PPVA 3GJTA 1JBEA 1F2UB 2AZ4A 4EMUA 4CV2A 4HB3A 4KI7A 3G3EA 3AESA 4ZDJA 1X8XA 1W7AA 5FLXA 2IPAB 3HB5X 4RZHA 5EJGA 4JJ6A 3T9AA 2CUKA 1OBFO 1Z4JA 3AI2A 2DGDA 4GBGA 3T7AA 3U9LA 1T0HB 1ZKDA 3B1VA 3K8QA 4HX9A 1C8KA 1EMDA 1P9WA 2MYUA 1EZZA 2ST1A 2X14A 3RF7A 4B6GA 3H3FA 4HEJA 4YACA 2IE0A 2ZWVA 5CAEB 4DIOA 3QOWA 1MH9A 3TLGB 1PG2A 2KYRA 2Z8YA 5DXFA 3CTMA 3FAKA 2D5AA 3PITA 1XP5A 2VF7A 3W1WA 4GYWA 1PZMA 4Y8VA 1SKQA 2JBHA 2VNHA 3L4BC 4KO4S 4CLRA 3K0EA 4MS1A 3SYLA 4DLVA 1Q1QA 2BC9A 4BBAA 1P1KA 4A0HA 3KR1A 1RQRA 1LI5A 2WTEA 4YXWD 2ILVA 2I71A 2Z3WA 1QXSA 2ZUVA 3IP3A 1XA0A 3JATB 1GDDA 4PS0A 4CM7A 1GGEA 3ESXA 5LBIA 1EBFA 4YJFA 3W90A 1RI4A 1WCIA 4D9NA 1SRRA 2DB3A 1N1MA 2VHXA 3JD4A 4QDUA 4OGWA 5CXQA 3NGLA 2ZJ1A 4B6FA 1OH6A 2ECFA 4FWTA 3B7WA 1AQUA 3CNBA 1JIUA 3GHYA 3KG2A 4UU7A 3PUWA 3BQMB 5BUQA 2QD5A 3NYQA 4JFAA 4DMKA 4H6PA 2C8KA 3LV8A 3O8LA 4PGMA 4X61A 1N5IA 2IHBA 2RHJA 1GUFA 4CMIA 3PG5A 1NFFA 3UTCA 1WCXA 1ODCA 2Q5CA 3QFFA 4A92A 3NMUF 2FEXA 4YMWA 3QQPA 1P7CA 1YBAA 4H0FA 2TRSB 4NLLA 3ZBTA 3WO0A 4L1KA 1HA3A 4RV9A 3BSWA 1X1AA 2QN7A 1JT9A 1SOAA 3BA1A 4HVAA 5F7XA 3NXSA 3HKCB 4FD2A 3ZV5A 2EF0A 3WYEA 4JJ4A 1H1DA 4X24A 1J24A 3I62A 3HV0A 5CYPA 5DW3A 3KBOA 3WIUA 1T3ZA 3ZZ1A 4ZVPA 1ZUNA 3O75A 2H2FA 3AV0B 1KNQA 2FSGA 5T4HA 1QK5A 3U7JA 2I1LA 3QENA 2WG0A 3L7MA 1A7JA 4PC1A 4WERA 5F3RA 4BP1A 4JSYA 4R8SA 2UUPA 3D6UA 3JASB 1G1MA 3M5PA 2AXQA 3QHQA 4NP6A 1Q20A 4PZ0A 4RS3A 2VJOA 2CNKA 3DFMA 4KP7A 1NXTA 4BWYA 2X4LA 2ZDHA 2R8XA 2ZRLA 3FY4A 3K09A 5LA6B 3ZDRA 3WIVA 2JIZD 1IN1A 1FPMA 3QEMB 3ESBA 4GDMA 4R9NA 3RK0A 2A0FA 2WG2A 2PD6A 4QM6A 4FGUA 1UBMS 1ZCZA 2GYVA 4N8EA 1E32A 4W1SA 1LLQA 1GPH1 1W8IA 1X38A 1YRAA 3EXAA 3NM6B 5EHXA 2V7VA 1NMSA 4J6FA 2JIDA 2YWRA 5ALXA 2RGUA 4NCBA 2BGWA 1TJ5A 3CLVA 3GD7A 4NAVA 1MVLA 2GGSA 3EOAI 2CLHB 2RIRA 4NHEA 1IHXA 4MUHA 1ZM7A 2C2WA 3FKSA 5EJIA 4HNGA 1DBSA 1QMGA 1UMCA 2O3QA 5L3RA 1KTVA 2Z83A 4KO3S 1IAVA 1B0AA 1QHSA 2E7ZA 4K1XA 1OLXA 3REQA 1G2IA 1FMJA 2CUZA 1EKXA 2YCBA 1Y6JA 3IE0A 5A1TA 5AQEA 3V7WA 1EDZA 4A8JA 3TNLA 1ZRSA 5EOVA 1EGQA 2HEGA 2C58A 1U9CA 3RU7A 4D25A 1EGHA 1H0HA 4WCFA 1NUAA 3QW4B 5BYBA 2IZ7A 2JBAA 2GDJA 3OWHA 4CMCA 3FPKA 3L6UA 5JSKA 1TOAA 1BE8A 3DL7A 4MKGA 2DKFA 2ZSDA 3BMXA 5E1DA 5ERYA 4DDKA 2FYTA 2P9BA 2ZIGA 4PAGA 2MSNA 2VWQA 4DQKA 3H5WA 3PHLA 1E1CB 4D74A 3ZGZA 2IDKA 3W3AD 3OM1A 3QTBA 3H0KA 4HWGA 4RPLA 4RZQA 4XWGA 3DAHA 4IHKA 5AKGA 5BMVB 2WU3A 3AR3A 3E15A 3LBAA 3NCTA 5IYZB 1QLHA 3JZDA 3KEGA 5CVCA 4TZ6A 2IIBA 5EGSA 3GUUA 3RTGA 4V1CI 2IODA 3OO1A 3K0FA 5BXYA 2C5SA 2Q3EA 1QGUA 2NTEA 2ZYTX 4HAWA 1B6GA 1PJTA 1QZZA 1W88A 4IJVA 1OXKB 4PBRA 4OIFA 4WK4B 3H1GA 3SU8A 1ZM9A 2NUPA 2RMKA 2WJ4A 4ZVNA 4ARZB 4A0GA 3C6BA 3QVXA 1I4WA 1XNHA 3OPYI 4F86A 4Z6KA 1B8OA 3RUIA 2GEFA 5GONA 4QOSA 5I51A 5KTRA 1E9EA 3RVLA 3SHTA 1N9GB 1U7ZA 2ZR8A 4D3ZA 3SS8A 3HCCA 4X63A 1ZIOA 5KSOA 1JBKA 3UH1A 2P6OA 3R7DA 2FR8A 1W5TA 2VBFA 3VV3A 1IRXA 3U7FB 1U1FA 3KTDA 1YAHA 2X6RA 2IE8A 1SUAA 4OA8A 3DLAA 3R9KA 4BZXA 3BULA 4AJNA 3KKPA 4FDAA 1NSFA 3RIEA 2VR1A 2WFLB 2B69A 2B25A 4HLDA 5M2QA 1P4AA 4Q7QA 2WUDA 4D26A 3HN2A 5KNCH 4E7PA 4NONA 3JQGA 3L01A 4POOA 1TTPB 1NR5A 3FOBA 2VTKA 5BV1A 4RS4A 1Y1LA 1KFBB 2IZ5A 3C1TA 3HYCA 3P9ZA 2QZ9A 1IWBB 3N2KB 4KQJA 4MDEA 1USUA 2H2IA 2ZQZA 3KHKA